Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2708.262ON63263229660.0
Skud_4.3718.262ON58058323080.0
Smik_4.3568.262ON57658222370.0
YDR110W (FOB1)8.262ON56658322220.0
TDEL0F038908.262ON4763988241e-102
KAFR0B055408.262ON5193648061e-99
SAKL0H17028g8.262ON5503427584e-92
NCAS0B038508.262ON5885187606e-92
ZYRO0C01650g8.262ON5863357144e-85
NDAI0J013808.262ON6243657122e-84
Kwal_56.237998.262ON4883376916e-83
Ecym_43088.262ON5293446852e-81
KLTH0G13684g8.262ON5083376822e-81
Kpol_392.68.262ON4573376661e-79
KLLA0F19140g8.262ON5273506441e-75
AGR086C8.262ON5343376415e-75
Kpol_543.388.262ON4423636073e-71
KNAG0H032408.262ON5193695969e-69
CAGL0B01771g8.262ON5363895892e-67
TBLA0E044308.262ON4813384774e-52
TPHA0J007408.262ON4083334261e-45
TPHA0A018108.262ON4573374231e-44
TBLA0F030708.262ON4453733735e-38
NDAI0B06160singletonON140394910.029
NDAI0G00600singletonON48891890.035
NDAI0G00550singletonON41256870.063
Kpol_2000.35singletonON704149771.0
Kpol_1035.3singletonON1130145771.2
Kwal_36.16338singletonON60499742.3
Kwal_39.16409singletonON73499733.1
Kwal_27.11219singletonON74499733.2
Suva_9.2392.651ON97144724.6
Kwal_33.15089singletonON47899706.3
Kwal_27.12438singletonON64199707.5
Kwal_54.19470singletonON54299707.7
Kwal_60.24910singletonON52499707.9
Kwal_26.7891singletonON31099698.1
Kwal_13.691singletonON86599708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.270
         (632 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...  1147   0.0  
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   893   0.0  
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   866   0.0  
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   860   0.0  
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   322   e-102
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   315   1e-99
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   296   4e-92
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   297   6e-92
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   279   4e-85
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   278   2e-84
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   270   6e-83
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   268   2e-81
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   267   2e-81
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   261   1e-79
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   252   1e-75
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   251   5e-75
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   238   3e-71
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   234   9e-69
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   231   2e-67
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   188   4e-52
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   168   1e-45
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   167   1e-44
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   148   5e-38
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            40   0.029
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    39   0.035
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    38   0.063
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...    34   1.0  
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    34   1.2  
Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A ...    33   2.3  
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...    33   3.1  
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...    33   3.2  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    32   4.6  
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...    32   6.3  
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...    32   7.5  
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...    32   7.7  
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...    32   7.9  
Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON...    31   8.1  
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...    32   8.3  

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/632 (88%), Positives = 561/632 (88%)

Query: 1   MKVSNFSLFRGKVGKRKNCKMIPHRINVSWLVDSSIQRRSSPQGHIGNEKMAKLRYKGTL 60
           MKVSNFSLFRGKVGKRKNCKMIPHRINVSWLVDSSIQRRSSPQGHIGNEKMAKLRYKGTL
Sbjct: 1   MKVSNFSLFRGKVGKRKNCKMIPHRINVSWLVDSSIQRRSSPQGHIGNEKMAKLRYKGTL 60

Query: 61  FDDEGDXXXXXXXXXXXXXQRRKTTSPRESRESLKDRLLILPLMGESYTEYVDSYXXXXX 120
           FDDEGD             QRRKTTSPRESRESLKDRLLILPLMGESYTEYVDSY     
Sbjct: 61  FDDEGDSLPSESAKSKSSPQRRKTTSPRESRESLKDRLLILPLMGESYTEYVDSYLNLEL 120

Query: 121 XXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQY 180
                  TPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQY
Sbjct: 121 LERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQY 180

Query: 181 YVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIID 240
           YVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIID
Sbjct: 181 YVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIID 240

Query: 241 WVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCR 300
           WVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCR
Sbjct: 241 WVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCR 300

Query: 301 DYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYG 360
           DYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYG
Sbjct: 301 DYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYG 360

Query: 361 LRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPT 420
           LRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPY             PT
Sbjct: 361 LRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPT 420

Query: 421 QVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALVXXXXXXXXX 480
           QVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALV         
Sbjct: 421 QVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALVNEGESSNNN 480

Query: 481 XXXXXXXXXXXXFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTLTPEENTSHNVX 540
                       FEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTLTPEENTSHNV 
Sbjct: 481 ENLNNTNIGNDNFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTLTPEENTSHNVE 540

Query: 541 XXXXXXXXXXXDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDRSVEITSPETSY 600
                      DLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDRSVEITSPETSY
Sbjct: 541 EERIESTSETTDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDRSVEITSPETSY 600

Query: 601 YQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632
           YQTEELPSTKRQKVGKQGHGDITRDFGLSMEL
Sbjct: 601 YQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/583 (76%), Positives = 465/583 (79%), Gaps = 4/583 (0%)

Query: 51  MAKLRYKGTLFDDEGDXXXXXXXXXXXXXQRRKTTSPRESRESLKDRLLILPLMGESYTE 110
           M   RY G LFDD  D             Q RKTTSPRESRE LKDRLLILP MGESYT 
Sbjct: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60

Query: 111 YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAE 170
           YVDSY            TPIFLESLTRQLTQ+IYELIKTKSLTA+TLQQISDKYDGV AE
Sbjct: 61  YVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120

Query: 171 NKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 230
           NKLLFL+RQYYVDNEGNVRD RNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH
Sbjct: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180

Query: 231 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIE 290
           FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEP+ G AIE
Sbjct: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240

Query: 291 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYD 350
           GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFLSFAR+PIFVTSSTLDKDDLYD
Sbjct: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300

Query: 351 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXX 410
           ICEEIASKYGL IGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPY     
Sbjct: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRR 360

Query: 411 XXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFAL 470
                   P QVLLSEVPGHNAKFETKRERVIENTY+RNMF MAGGKGLIYLEDVNTFAL
Sbjct: 361 RNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420

Query: 471 VXXXXXXXXXXXXXXXXX-XXXXFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTL 529
                                  FEEEVQKQFDLTEQNYIDEYDDLAHDSSEGE+EP+TL
Sbjct: 421 ANEAENNGNNNRNHPDNNFGNDDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480

Query: 530 TPEENTSHNVXXXXXXXXXXXXDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDR 589
           TPEE  SH V            DLDGNTK+E DE EE N N +E  +     Q +   D+
Sbjct: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHN-IEETDGTR--QADPQVDQ 537

Query: 590 SVEITSPETSYYQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632
           SVEIT P+TSYYQT   PS KRQK+ +Q HGD+TRDFG SMEL
Sbjct: 538 SVEITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/582 (73%), Positives = 459/582 (78%), Gaps = 6/582 (1%)

Query: 51  MAKLRYKGTLFDDEGDXXXXXXXXXXXXXQRRKTTSPRESRESLKDRLLILPLMGESYTE 110
           M K RY G LFDD+ D             Q RK TS RESR+S KDRLLILP MGESYTE
Sbjct: 1   MTKPRYNGVLFDDD-DSLPSESATRKAPSQGRKATSSRESRDSSKDRLLILPSMGESYTE 59

Query: 111 YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAE 170
           YVDSY            TPIFLESLTRQLTQKIYELIKTKSLTA+TLQQISDKYDGV AE
Sbjct: 60  YVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 119

Query: 171 NKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 230
           NKLLFL+RQYYVD+EGNVRD RNNDKIYCEP HIYDMVMATHL+NKHLRGKTLHSFLFS+
Sbjct: 120 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSY 179

Query: 231 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIE 290
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEP+ G+ IE
Sbjct: 180 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIE 239

Query: 291 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYD 350
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFLSFAR+PIFVTSSTLDKDDLYD
Sbjct: 240 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 299

Query: 351 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXX 410
           ICEEIASKYGLRIGLGLKSSARFHTGGILCI YALNSYKEECLADWGKCLRYGPY     
Sbjct: 300 ICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRR 359

Query: 411 XXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFAL 470
                   P QVLLSE+PGHNAKFETKRERVIENTY+RNMF  AGGKGLIYLEDVNTFAL
Sbjct: 360 RNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFAL 419

Query: 471 VXXXXXXXXXXXXXXXXXXXXXFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTLT 530
                                 FEEEVQKQFDLTEQNYIDEYDDLAH+SSEGE+ PSTLT
Sbjct: 420 ANKADNSYNNGSSHNNDVDNDNFEEEVQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTLT 479

Query: 531 PEENTSHNVXXXXXXXXXXXXDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDRS 590
           PEE  +                L+ NT++E  E E+++    +A      PQTE   D+S
Sbjct: 480 PEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADAT-----PQTEPEVDQS 534

Query: 591 VEITSPETSYYQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632
           +EI  PETSY+QT E PSTKRQK+ +Q HGD+TRDFG+SMEL
Sbjct: 535 LEIAKPETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/583 (74%), Positives = 458/583 (78%), Gaps = 18/583 (3%)

Query: 51  MAKLRYKGTLFDDEGDXXXXXXXXXXXXXQRRKTTSPRESRESLKDRLLILPLMGESYTE 110
           M K RY   LFDD+               QRRK TSP ESRES KDRLLILP MGESYTE
Sbjct: 1   MTKPRYNDVLFDDDD---SVPSESVTRKSQRRKATSPGESRESSKDRLLILPSMGESYTE 57

Query: 111 YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAE 170
           YVDSY            TPIFLESLTRQLTQKIYELIKTKSLTA+TLQQISDKYDGV AE
Sbjct: 58  YVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 117

Query: 171 NKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 230
           NKLLFL+RQYYVD+EGNVRD RNNDKIYCEPKH+YDMVMATHLMNKHLRGKTLHSFLFSH
Sbjct: 118 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSH 177

Query: 231 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIE 290
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEP+ G+AIE
Sbjct: 178 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIE 237

Query: 291 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYD 350
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFL+FAR+PIFVTSSTLDKDDLYD
Sbjct: 238 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYD 297

Query: 351 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXX 410
           ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYK+ECLADWGKCLRYGPY     
Sbjct: 298 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRR 357

Query: 411 XXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFAL 470
                   P QVLLSEVPGHNAKFETKRERVIENTY+RNMF MAGGKGLIYLEDVNTFAL
Sbjct: 358 RNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 417

Query: 471 VXXXXXX-XXXXXXXXXXXXXXXFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTL 529
                                  FEEEVQKQFDLTE+NYIDEYDDLAHDSSEGE+EP+TL
Sbjct: 418 ANEADNSCNNNGILHNNNIGNDNFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTL 477

Query: 530 TPEENTSHNVXXXXXXXXXXXXDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDR 589
           TPEE   HNV             + G  + E+ + +E +           A Q     D+
Sbjct: 478 TPEEKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESD----------GASQV----DQ 523

Query: 590 SVEITSPETSYYQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632
           SVEIT PETSYYQT E PSTKRQK+ +QG+GD TRDFG SMEL
Sbjct: 524 SVEITRPETSYYQTLESPSTKRQKLDQQGNGDQTRDFGTSMEL 566

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 237/398 (59%), Gaps = 13/398 (3%)

Query: 80  QRRKTTSPRESRESLKDRLL----------ILPLMGESYTEYVDSYXXXXXXXXXXXXTP 129
           QRR         ++ +D++L          + P MGESY EY +SY              
Sbjct: 10  QRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLL 69

Query: 130 IFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVR 189
            + ES+  Q+   IYELI+T SLT ETL   SDK+D  +AE+K +FL R+YY +N G VR
Sbjct: 70  KYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVR 128

Query: 190 DRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKC 249
           DRR  DKI CEP  I+D++M  HLMN H+  + +++ L   ++N +   +    ++CS C
Sbjct: 129 DRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSC 188

Query: 250 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWL 309
           N  G  +PL++Y+  +++  LLP+ER+HIE+FE +  ++I  K+  VL CRDY + F+WL
Sbjct: 189 NPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWL 248

Query: 310 LPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKS 369
            PLK+TKFKHL+  V +L L    +PIF+ SSTLDK DL+DICE++  KY +++GLG  S
Sbjct: 249 APLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANS 308

Query: 370 SARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPG 429
           S++FH  GI  ++  LN+ K +C++DW  CLRYGPY             P  +L      
Sbjct: 309 SSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHT 368

Query: 430 HNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNT 467
           +   F  K+E +I+   A+N+  +   KGL+YLED N+
Sbjct: 369 NRKHFRPKQEMIIDELPAQNVVHV--NKGLLYLEDENS 404

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  315 bits (806), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 228/364 (62%), Gaps = 2/364 (0%)

Query: 100 ILPLMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159
           I+P MGESYT Y DS+               F +S+   LT++ Y+LI+T SLT ETL  
Sbjct: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107

Query: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219
            + K+  + AE + LFL+R+YY DN G + D    DKI CEP +++DM+M  HLMN H  
Sbjct: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167

Query: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 279
            K +H  L + ++N +  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227

Query: 280 VFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVT 339
           +FEP+  + IE KY ++L CRDY S ++W+LPLK+TKFKHL+P ++SLFLSF R PIF+ 
Sbjct: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287

Query: 340 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 399
           +++LD  D++DICE+IA +Y L+IGLG      FH  GI  ++  L +++EECL  W  C
Sbjct: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347

Query: 400 LRYGPYXXXXXXXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGL 459
           L+YG Y             P  +L S++   + KF+ K  +++EN  + ++  +    GL
Sbjct: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405

Query: 460 IYLE 463
           I+LE
Sbjct: 406 IFLE 409

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  296 bits (758), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 143/342 (41%), Positives = 220/342 (64%), Gaps = 1/342 (0%)

Query: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRD 190
           +LES+  QLTQ  YELIKT +LT ETL  ++D      AE K LFL+R+YYVD++  VRD
Sbjct: 57  YLESVKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRD 116

Query: 191 RRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 250
            + +D I CEP+ +Y+++++ HL+N HL  + LH FL S ++N +   +    ++CS+CN
Sbjct: 117 HKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECN 176

Query: 251 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYG-GKAIEGKYPYVLLCRDYRSSFMWL 309
            + ++KP  ++K  + Y  LLP+ERIH+E+F+P+G  + IE KY +VL CRDY S F+WL
Sbjct: 177 PQEEVKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWL 236

Query: 310 LPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKS 369
            PL    F+ L+P ++   LS  R+PIF+ ++TLD+ D++D+CE IA KY L IGLGL +
Sbjct: 237 SPLTGITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNN 296

Query: 370 SARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPG 429
           S+ F+  GI  ++Y L + K++C  DWG CL+YG Y                +L +EV  
Sbjct: 297 SSHFYKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSS 356

Query: 430 HNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALV 471
              KF+ KRE++I   +A N+ T+    G++Y+E+ N+  ++
Sbjct: 357 CGKKFKLKREKIIHELFAHNVVTLKDTGGMVYVENENSVFIM 398

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  297 bits (760), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 170/518 (32%), Positives = 261/518 (50%), Gaps = 44/518 (8%)

Query: 94  LKDRLLILPLMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLT 153
           LK +  ++P +GE Y +YVD                 F +++  QL +  YELIKT SLT
Sbjct: 77  LKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLT 136

Query: 154 AETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHL 213
            ETL   + K D   A ++L+FL R+Y +D +GNVRD+   +++ CEP  IYDM+M  HL
Sbjct: 137 QETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHL 196

Query: 214 MNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPM 273
           +N H R +  H  L   ++N +   ++ + QFCS CN   +  P K+YK  + +  LLP+
Sbjct: 197 INDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPL 256

Query: 274 ERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           ER+ +EVFEP+ G+ + GKYP +L  RDYRS F+W++PL+++KF HL+ ++S +  S  R
Sbjct: 257 ERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIR 316

Query: 334 IPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECL 393
           IPIF  ++T++  D +DI E+I  KY + IGLG K   +  T G+  I+  L  +KEECL
Sbjct: 317 IPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECL 376

Query: 394 ADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTM 453
           ADW  CL+YGP+             P  +L  ++P    K   K E+++++    N+  +
Sbjct: 377 ADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI 436

Query: 454 AGGKGLIYLEDVNTFALVXXXXXXXXXXXXXXXXXXXXXFEEEVQKQFDLTEQNYIDEYD 513
             G+G IYLED N                            E+ + +++    +  D  D
Sbjct: 437 --GRGCIYLEDRNP---------------------------EDPEAEYEANTDDESDTED 467

Query: 514 DLAHDSSEGEYEPSTLTPEENTSHNVXXXXXXXXXXXXDLDGNTKEERDESEERNLNSVE 573
           ++ H   + E   + ++P  + +               D   N  EE        +  VE
Sbjct: 468 NVEHRQEDEEDIGAMMSPMIDNTRTEDELENGEKSHEDDNHSNDNEE-------GVTKVE 520

Query: 574 AVNAVTAPQTEANGD--------RSVEITSPETSYYQT 603
                T  + + N           S EIT P TSYYQT
Sbjct: 521 GSVPTTPKRRKLNNKNVTNTQETESPEITEPSTSYYQT 558

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  279 bits (714), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 213/335 (63%), Gaps = 4/335 (1%)

Query: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNE-GNVR 189
           F  ++  QLTQ+IYELI++ +L+   L++   K+ G ++E +  +L  +Y+V  E G V 
Sbjct: 70  FQGTVAGQLTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYYYLRSRYFVSEENGMVC 128

Query: 190 DRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKC 249
           DR+ +D+I CEP  ++ +VM +HL N H+    +H  L   +AN +   I     +CSKC
Sbjct: 129 DRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKC 188

Query: 250 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWL 309
           N   K KP ++ +  ++Y +LLP+ER+HIEVFEP+ G+ I+G++ ++L  RDY S ++W+
Sbjct: 189 NPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWI 248

Query: 310 LPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKS 369
           LPL++ K KH+I  +SS  L   RIPIF+ S+T+D++ L+D+C +IA  Y L++GLG+K+
Sbjct: 249 LPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKN 308

Query: 370 SARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPG 429
           S RFH  GI  ++  L S+KEECL DW  CL+YGP+             P  +L + VP 
Sbjct: 309 SQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPD 368

Query: 430 HNAKFETKRERVIENTYARNMFTMAGGKGLIYLED 464
            N KF  KR  VI +T ++ +  +  G+G+++LE+
Sbjct: 369 CNRKFVKKRNDVILDTPSQQVVHL--GEGVLFLEN 401

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  278 bits (712), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 209/365 (57%), Gaps = 5/365 (1%)

Query: 100 ILPLMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159
           ++P +GESY +YVD                 F  S+  QL + +YELI+TKSLT ETL  
Sbjct: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149

Query: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219
            +  +    A  +    +R+Y  DNEG VRD+   ++I C+P  +Y+M+M  HLMN H +
Sbjct: 150 -AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208

Query: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 279
            +  H  L S +AN +   +    QFCS CN    + PL ++K  + Y  +LP+ER+HIE
Sbjct: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268

Query: 280 VFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVT 339
           +FEP+ GK IEGKY +V+ CRDYRS ++ L PLK+TKFK+L+  ++ L  +  RIPIF+ 
Sbjct: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328

Query: 340 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 399
           + +L+  D +DI E I  KY + +GLG+K++ RFHT G+  ++  L  +++ECL DW  C
Sbjct: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388

Query: 400 LRYGPYXXXXXXXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGL 459
           L+YGP+             P  +L   V     K   K E++I      N+  +  G G 
Sbjct: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGS 446

Query: 460 IYLED 464
           IYLE+
Sbjct: 447 IYLEE 451

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  270 bits (691), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 129/337 (38%), Positives = 201/337 (59%), Gaps = 4/337 (1%)

Query: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRD 190
           + ES+  QLTQ+ ++L+++ +LTAE L   SDK      E K L L+R++YVD +G VRD
Sbjct: 50  YQESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRD 109

Query: 191 RRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 250
            + +D + CEP+ ++D++M  HL N H+  + LH +L   +ANT+ A      ++CS+CN
Sbjct: 110 FKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECN 169

Query: 251 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLL 310
            +  ++P ++++  ++Y  LLP+ER+H+E+  P+  K IEG Y +VL  RDY S F+W+ 
Sbjct: 170 PEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPF-PKLIEGLYSHVLYLRDYYSRFVWMQ 228

Query: 311 PLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 370
           PL S +   +     +  LS  R+PIFV +STL + DL+++CE IAS+YGL IGLG+  S
Sbjct: 229 PLASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRS 288

Query: 371 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGH 430
             F   G+  ++Y L   +E CL  W  CL++G               P  +L S V  +
Sbjct: 289 TTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDY 348

Query: 431 NAKFETKRERVIENTYARNMFTM---AGGKGLIYLED 464
             +FE KRE +IE  +A N+  +      +G+IYLED
Sbjct: 349 GRQFELKREELIEKLFASNVVELRNEGRRRGMIYLED 385

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  268 bits (685), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 128/344 (37%), Positives = 201/344 (58%), Gaps = 4/344 (1%)

Query: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRD 190
            + ++  QLTQ IYELI + +L+ +TL +  DK      ENK + L+R+Y +  +GNV D
Sbjct: 66  LINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSI-LQGNVVD 124

Query: 191 RRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 250
            +  D    EP  ++D++MA HL+N HL  + +H  L + +AN +    + V  +CS CN
Sbjct: 125 HKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCN 184

Query: 251 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPY---GGKAIEGKYPYVLLCRDYRSSFM 307
               +K    YK  ++YDK++P+ER H+E+F P+   G + IE KY +VL CRDY S F+
Sbjct: 185 TDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFV 244

Query: 308 WLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGL 367
           W+LPL+   F+ L+P ++ L  S  R+PIF+ ++TLD+ D++D+CE IA KY L+IGLGL
Sbjct: 245 WMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGL 304

Query: 368 KSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEV 427
            S   F   G+  I+     +KE+C+ +W  CLR                 P+ +L +E+
Sbjct: 305 NSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEI 364

Query: 428 PGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALV 471
                KF+ K+ ++I+  YA ++       G+IYLED N+  +V
Sbjct: 365 SNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVV 408

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 130/337 (38%), Positives = 205/337 (60%), Gaps = 4/337 (1%)

Query: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRD 190
           + ES+  QLTQ  ++L+++ SLT + L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109

Query: 191 RRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 250
            + +D + CEP+ ++D++M  HL N HL  + LHS+L  ++ANT+ A      ++CS+CN
Sbjct: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169

Query: 251 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLL 310
            + +++P K+++  ++Y  LLP+ER+H+E+  P+  +AIEG Y +VL  RDY S F+W+ 
Sbjct: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQ 228

Query: 311 PLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 370
           PLK    + +   + +  L   RIPIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 229 PLKGDDVRDITKGLLATLLLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288

Query: 371 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGH 430
           + F   G+  ++Y L   +E+CL  W  CL+YG               P  +L S V  +
Sbjct: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348

Query: 431 NAKFETKRERVIENTYARNMFTM---AGGKGLIYLED 464
             +FE KRE +IE  +ARN+  +      +G+IYLED
Sbjct: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLED 385

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  261 bits (666), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 134/337 (39%), Positives = 206/337 (61%), Gaps = 4/337 (1%)

Query: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGN-VR 189
           F  ++   L+Q+IY+LI T  LT + + +   K+   + E K  FL+ +YYV ++G  VR
Sbjct: 92  FQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVR 150

Query: 190 DRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKC 249
           DRRN+DKI C P  + ++V+ THL+N+H   K++H  L   +AN S  I      +CS C
Sbjct: 151 DRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFC 210

Query: 250 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGG-KAIEGKYPYVLLCRDYRSSFMW 308
           N    +KPLK+ K+ ++Y+ LLP ERIHIE+F+P+G  K IEG Y ++L  RDY S ++W
Sbjct: 211 NPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVW 270

Query: 309 LLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLK 368
           L PLK T FK L   + + F +  + PI++ SST++++DL  + ++IA KY LRIG+G+ 
Sbjct: 271 LYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIG 330

Query: 369 SSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLL-SEV 427
           +S+ FH  G+  ++  L  +++ECL DWG CL+YG               P  +LL S +
Sbjct: 331 NSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGI 390

Query: 428 PGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLED 464
              + K+++K+  VI+ T+  NM  +  GK  IYLED
Sbjct: 391 SECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLED 427

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  252 bits (644), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 194/350 (55%), Gaps = 11/350 (3%)

Query: 132 LESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRDR 191
           + ++  QLTQ IY+L+ + +LT E L + SDK      ENK + L+R+YYV  E  + D 
Sbjct: 89  INTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYV-QENLLHDV 147

Query: 192 RNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNK 251
           +  D +  EP  ++D++M+ H++N H+  K +++ L + +AN + +    V  FCSKCN+
Sbjct: 148 KRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNE 207

Query: 252 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGK----------AIEGKYPYVLLCRD 301
            G     K++K  +++  L+P+ R H+E+F P+              IEGKYP+VL CRD
Sbjct: 208 SGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRD 267

Query: 302 YRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGL 361
           Y S ++WL PLKS     L+PV++ L  S  R+PIF+ + TLD+ D++D+CE IA  Y +
Sbjct: 268 YYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKI 327

Query: 362 RIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQ 421
           +IGLG+ SS  F   GI  ++     +KEECL DW  CL+                 P+ 
Sbjct: 328 KIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSD 387

Query: 422 VLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALV 471
           +L S     + KF T +  VI      ++       G+IYLED N+  L+
Sbjct: 388 LLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNLL 437

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  251 bits (641), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 124/337 (36%), Positives = 201/337 (59%), Gaps = 4/337 (1%)

Query: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRD 190
            ++++  QLTQ+IY+LI + +L+ + L +  DK      ENK + L+R+Y V   G V D
Sbjct: 60  IMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRY-VAKGGIVID 118

Query: 191 RRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 250
           R+  D    EP  ++DM+M+ HL+N H+  + ++  +   +AN +  + + V  +CS CN
Sbjct: 119 RKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCN 178

Query: 251 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPY---GGKAIEGKYPYVLLCRDYRSSFM 307
               ++    YK  ++++KL+P+ER H+EVF P+   G + I+GKY + L CRDY S F+
Sbjct: 179 MDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFI 238

Query: 308 WLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGL 367
           WLLPL+   F++L+P ++ L  +  R+PIF+ ++TLD+ D++DICE IA +Y  +IGLGL
Sbjct: 239 WLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGL 298

Query: 368 KSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEV 427
            S   F   GI  ++  L+ YKEEC  DW  CLR                 P+ +L +E+
Sbjct: 299 NSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEI 358

Query: 428 PGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLED 464
           P  + KF+ K++++I+  YA ++       G+IYLED
Sbjct: 359 PNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLED 395

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  238 bits (607), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 204/363 (56%), Gaps = 1/363 (0%)

Query: 102 PLMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQIS 161
           P +G +  EY+DS                +L+S+   L+Q +YELI+   L  +TL +  
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104

Query: 162 DKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGK 221
            ++  + A  K L+L+R+Y +  +G V D    +KI  EP   YD +++TH++N+HL  +
Sbjct: 105 TRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164

Query: 222 TLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 281
            +H  L + ++N S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224

Query: 282 EPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSS 341
           EP+  + I+ +Y +++  RDYRS F+W+ PLK+TKFK L   +  L L   RIPI++ ++
Sbjct: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284

Query: 342 TLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLR 401
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  ++  LN  K++CL DW  CL+
Sbjct: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344

Query: 402 YGPYXXXXXXXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIY 461
            G Y             P+++ L E+      FE+KR  +I +   +N +  +  KGL+Y
Sbjct: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404

Query: 462 LED 464
            +D
Sbjct: 405 AQD 407

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  234 bits (596), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 124/369 (33%), Positives = 204/369 (55%), Gaps = 8/369 (2%)

Query: 100 ILPLMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159
           ++P++G+ ++ Y D                 +  +   +++Q++Y L K   +T E + +
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94

Query: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219
           +           K++++ R+YY D  G +RD   N++I  +P H +D++M+ HLMNKHL 
Sbjct: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154

Query: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 279
            + ++  L   +AN    +I    ++CS CN   K+ P K   +P +++K LP+ERI IE
Sbjct: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIE 213

Query: 280 VFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVT 339
           + EP+  + +EGKY  +++ +D+   F WL PLK+TKFK+++PVV+ + LSF R+PI+V 
Sbjct: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273

Query: 340 SSTLDKDDLYDICEEIASKYGLRIGLGL--KSSARFHTGGILCIQYALNSYKEECLADWG 397
           S+TLD  DL+DI E I +KYG++IGLG   +SSA   T     I   LN + +ECL D+ 
Sbjct: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATAR---INRDLNDHHDECLFDFN 330

Query: 398 KCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGK 457
            CL+YGP              P  ++        AKF  KR  +++  ++ +   M  G 
Sbjct: 331 NCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILK--HSPSSCVMNRGM 388

Query: 458 GLIYLEDVN 466
           G +YLE  N
Sbjct: 389 GTLYLESPN 397

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  231 bits (589), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 209/389 (53%), Gaps = 20/389 (5%)

Query: 99  LILPLMGESYTEYV---DSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAE 155
            ++P + E+Y +Y+   DS                F E L  +LTQ+ Y L+   +LT E
Sbjct: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119

Query: 156 TLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMN 215
           T+ +  + +   AAE K   L +++Y D EGN+RD + ++ I  EP  ++++++  HL N
Sbjct: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179

Query: 216 KHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMER 275
            HL+   L   L   +AN +   +     +C++CN    IKP+++ +  ++ ++LLP+ER
Sbjct: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239

Query: 276 IHIEVFEPYGGK--------------AIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLI 321
           +HIEVF P+  +               IEGKY +V  CRD+R+ ++W  PLK+ KFK L+
Sbjct: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299

Query: 322 PVVSSLFLS-FARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILC 380
             +++ F++     PIFV SST+D+DDL +I E +ASKYGL++GLG  +  +FH  GI  
Sbjct: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359

Query: 381 IQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGHNAK-FETKRE 439
            +  L+  K EC  DW  CL+ G Y              + +L +E+ G   +    K+ 
Sbjct: 360 FKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKA-SNILFTELMGQFERDMRKKKL 418

Query: 440 RVIENTYARNMFTMAGGKGLIYLEDVNTF 468
           + IE +++ N+ T     G I++E V  +
Sbjct: 419 KYIEQSFSENIKTYPKSGGCIFIEHVQDY 447

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  188 bits (477), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 110/338 (32%), Positives = 178/338 (52%), Gaps = 14/338 (4%)

Query: 139 LTQKIYELIKTKSLTAETLQQISDKY-DGVAAENKLLFLERQYYVDNEGNVRDRRNNDKI 197
           LTQ+  +++ T +L+ E + +   K  +   A  K  F  R+YY++ + N+ D+R   +I
Sbjct: 73  LTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRI 132

Query: 198 YCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKC--NKKGKI 255
            CEPK++YD+V+A HL  K      +   L   F+N     ID+  ++CSKC  ++   +
Sbjct: 133 ICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHM 190

Query: 256 KPLKE---YK--RPDMYDK-LLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWL 309
           K   +   +K  R ++ D+ L PMERIHIE+F P+    IE KY  +L  RDY + ++W 
Sbjct: 191 KLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWT 250

Query: 310 LPLKSTKFKHLIPVVSSLFLSFA-RIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLK 368
             LK  K KH+  +++  FLS A  +PIF+ SST+D  DL+DICE+I+ +Y + +GLG  
Sbjct: 251 FTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTN 310

Query: 369 SSA-RFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVL-LSE 426
           +    FH  GI   +  +N  K +CL  W   L +G               P  ++  + 
Sbjct: 311 NKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNN 370

Query: 427 VPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLED 464
           +     KF  +R R+I+ T   N   +     +I++ED
Sbjct: 371 LAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIED 408

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  168 bits (426), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/333 (30%), Positives = 162/333 (48%), Gaps = 10/333 (3%)

Query: 139 LTQKIYELIKTKSLTAETLQQI-------SDKYDGVAAENKLLFLERQYYVDNEGNVRDR 191
           LTQK+Y LI+ K+   ET ++        S KY G A + K + +E +Y ++  G + D+
Sbjct: 62  LTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANK-KFMLMEDRYQLNELGQITDK 120

Query: 192 RNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNK 251
           RN+ K+   P  IYD++M  H +N HL    +H  L   ++N S A++    Q CS CN 
Sbjct: 121 RNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP 180

Query: 252 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGG-KAIEGKYPYVLLCRDYRSSFMWLL 310
           K   K + EY R    DK    E+IH+E+F+P+        K+ +V+  RDY + ++WL 
Sbjct: 181 KSTYKHI-EYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLY 239

Query: 311 PLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 370
           PL+    K L   +++  L   RIPI++ S TLD+ +L  I + I+    L +G+G    
Sbjct: 240 PLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKL 299

Query: 371 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGH 430
             F   GI  ++      +E C  +W K +                  P  ++  E    
Sbjct: 300 DEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD 359

Query: 431 NAKFETKRERVIENTYARNMFTMAGGKGLIYLE 463
           N  ++ KR+R I  T ++N   +  GK  +Y E
Sbjct: 360 NKTYKKKRQRTILLTLSKNTILLKNGKSALYKE 392

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  167 bits (423), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 172/337 (51%), Gaps = 6/337 (1%)

Query: 134 SLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRN 193
           S T  L++++Y+L+K   LT + +  ++   D   A  +L+ L+ +YY D++  V DR  
Sbjct: 63  SKTNYLSKELYDLVKNDDLTRKNVA-VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSK 121

Query: 194 NDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKG 253
            +KI  +P H + MVM THL+N HL    ++  L   FAN S   I    ++CS CN   
Sbjct: 122 QNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK 181

Query: 254 KIKPLKEYKRPDMYDK--LLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLP 311
             K ++  K P + +   +L  ER+ ++V  P+G K I+ +Y ++L   D+ + FMW  P
Sbjct: 182 --KNIRRKKEPQLSNSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFP 239

Query: 312 LKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSA 371
           LK+ K + +I  V+   ++    P+F++S TL  +D++++C  +A +Y + IGLG ++  
Sbjct: 240 LKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQ 299

Query: 372 RFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGHN 431
           + ++     +   LNS+K ECL  W  CL++                    L S +    
Sbjct: 300 KAYSKNPY-VTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFL 358

Query: 432 AKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTF 468
            K+E + + +I    + N   +  G   IY ED  +F
Sbjct: 359 KKYEERSKMIIGRLPSENFINIDEGSHFIYSEDEFSF 395

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  148 bits (373), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 181/373 (48%), Gaps = 11/373 (2%)

Query: 102 PLMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAETLQQIS 161
           P +G+    Y DSY            T  F  +L + +T  +Y  ++ +SL  +     +
Sbjct: 31  PPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPA 90

Query: 162 DKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGK 221
                    +K ++L+ +Y  +++G++ + + N K+ CEPK+IY + M  H MN H+R  
Sbjct: 91  SL---KIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSN 146

Query: 222 TLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEV 280
            L+  L   + N  + ++  V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++
Sbjct: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206

Query: 281 FEPYGGKAIE--GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFV 338
            +P+    I+   KY ++LL RDY S + W+ PLKS   K++   +    ++  R PIF+
Sbjct: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266

Query: 339 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSAR--FHTGGILCIQYALN--SYKEECLA 394
            S  + +  L  I  +I  +Y ++I +G+       F   GI  + Y LN    KE+C +
Sbjct: 267 HSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKS 326

Query: 395 DWGKCLRYGPYXXXXXXXXXXXXXPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMA 454
           DW +C+R   +                ++  +    N  FE KR+ ++ +    N+  + 
Sbjct: 327 DWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIG 386

Query: 455 GGKGLIYLEDVNT 467
               +IY ++ N+
Sbjct: 387 ECGSIIYFDNNNS 399

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 7/94 (7%)

Query: 239 IDW--VQQF-CSKCNKKGKIKPLKEY--KRPDMYDKLLPMERIHIEVFEPYGGKAIEGKY 293
           +DW  + +F C  C   GKI   K     R        P E IH ++F P  G  I    
Sbjct: 338 VDWSGIDKFQCKDC-LAGKITKHKHIVGSRLKYQKSYEPFEYIHTDLFGPVSGVDITSP- 395

Query: 294 PYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSL 327
            Y +   D  + F W+ PLK     H++P+   L
Sbjct: 396 KYFISFTDENTRFRWVFPLKKKDADHILPIFQQL 429

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 4/91 (4%)

Query: 239 IDW--VQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYV 296
           +DW  + +F  K    GK+   K      +  K  PM  IH ++F P  G  I     Y 
Sbjct: 151 VDWSGIDKFQCKDCLTGKLTKHKHIVGSRLNIKS-PMSYIHTDLFGPVSGVDITSP-KYF 208

Query: 297 LLCRDYRSSFMWLLPLKSTKFKHLIPVVSSL 327
           +   D  + F W+ PLK     H++P+   L
Sbjct: 209 ISFTDENTRFRWVFPLKKKDADHILPIFQQL 239

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 272 PMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSL 327
           P E IH ++F P  G  I     Y +   D  + F W+ PLK     H++P+   L
Sbjct: 290 PFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQL 344

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 61/149 (40%), Gaps = 20/149 (13%)

Query: 233 NTSHAIIDWVQQFCSKCNKKGKIK----PLKEYKRPDMYDKLLPMERIHIEVFEPYGGKA 288
           N++  ++D V+Q C +C    K +     L E +R  ++       R H++   P   K 
Sbjct: 342 NSNLLLLDVVKQ-CPRCETYQKFRDIPIELPEIRRIPVF------SRWHLDFAGPLKDK- 393

Query: 289 IEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDL 348
               Y Y LL  DY S+ + + PL+   F  +  ++ +++  F    + +T      D+ 
Sbjct: 394 --DGYKYFLLAADYTSNLILVKPLREQTFHSVYEIMRAIYAIFGSPHMLIT------DNG 445

Query: 349 YDICEEIASKYGLRIGLGLKSSARFHTGG 377
                 I  +    + L    S+ +H  G
Sbjct: 446 RQFANAIIPQVARSLKLKYYQSSAYHPRG 474

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 59/145 (40%), Gaps = 12/145 (8%)

Query: 233 NTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGK 292
           N++  ++D V + CS+C    K   L   + P+++   +   R H++   P         
Sbjct: 789 NSNLLLLD-VVRLCSRCETYEKFSDL-PIELPEIHRTPV-FSRWHLDFAGPLPA---HNG 842

Query: 293 YPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDIC 352
           Y Y LL  DY S+ + + PL    F  +  ++  ++ +F R  + VT      D+     
Sbjct: 843 YKYFLLAADYTSNLILVRPLAEQSFTSVYDLIFDIYATFGRPHMLVT------DNGSPFA 896

Query: 353 EEIASKYGLRIGLGLKSSARFHTGG 377
             I       + +    S+ +H  G
Sbjct: 897 NNIVPTIAAHLKIKYYQSSAYHPRG 921

>Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A -
           TyA Gag protein [contig 364] PARTIAL
          Length = 604

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 5/99 (5%)

Query: 239 IDWVQQF---CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW++     C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 85  VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 143

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A -
           Ty ORF [contig 372] FULL
          Length = 734

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 5/99 (5%)

Query: 239 IDWVQQF---CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW++     C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 246 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 304

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 305 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 343

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 5/99 (5%)

Query: 239 IDWVQQF---CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW++     C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 140 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 198

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 199 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 237

>Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa]
           {ON} YIR023W (REAL)
          Length = 971

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 300 RDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTL 343
           RDY  +++W+L + S  F  L   ++++ L FA+IP  +T   L
Sbjct: 707 RDYLRNYIWVLKIGSKYFDKLSNALNNMHLLFAQIPGLLTDEPL 750

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 239 IDW--VQQF-CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 85  VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 143

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 239 IDW--VQQF-CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 246 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 304

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 305 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 343

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -
           TyB Gag-Pol protein [contig 416] FULL
          Length = 542

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 239 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 239

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 239 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW++   F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 381 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 439

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 440 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 478

>Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 55] FULL
          Length = 310

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 239 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW++   F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 85  VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 143

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
           YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 239 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYP 294
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 239

Query: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,857,024
Number of extensions: 2555464
Number of successful extensions: 8192
Number of sequences better than 10.0: 57
Number of HSP's gapped: 8421
Number of HSP's successfully gapped: 58
Length of query: 632
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 516
Effective length of database: 40,180,143
Effective search space: 20732953788
Effective search space used: 20732953788
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)