Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2698.257ON72572537950.0
Skud_4.3708.257ON71471126380.0
YDR109C8.257ON71569826310.0
Smik_4.3558.257ON70469725560.0
SAKL0H17160g8.257ON73971622220.0
KLTH0G13794g8.257ON72569721790.0
Kwal_56.236078.257ON72571321680.0
TDEL0F038408.257ON72671521390.0
KLLA0F19041g8.257ON76375921300.0
ZYRO0C01782g8.257ON73072220940.0
NCAS0B038708.257ON59651017050.0
Kpol_392.98.257ON59450017050.0
KAFR0B055608.257ON60551316810.0
NDAI0J014008.257ON58850016770.0
KNAG0H032608.257ON58049816610.0
Ecym_43138.257ON59750016060.0
TBLA0E044008.257ON58950415950.0
CAGL0B01727g8.257ON57749815650.0
TPHA0B032408.257ON58549815430.0
AGR092W8.257ON59650014950.0
Suva_14.931.111ON5434975135e-56
Skud_14.891.111ON5694934645e-49
Smik_14.861.111ON5435104423e-46
YNL249C (MPA43)1.111ON5425044352e-45
KLTH0F03080g1.111ON5334904247e-44
ZYRO0F16016g1.111ON5424734151e-42
Kwal_33.135301.111ON5345004105e-42
TDEL0C059001.111ON5434533982e-40
SAKL0C03432g1.111ON5475093885e-39
KNAG0F006601.111ON5355013789e-38
KLLA0C02937g1.111ON5164993079e-29
NCAS0A007801.111ON5495161645e-11
NDAI0H002204.9ON810100910.029
NCAS0C059004.9ON703102810.48
TPHA0K022804.9ON667106800.61
Kwal_47.175064.113ON92452733.6
SAKL0H12936g8.426ON131742725.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.269
         (725 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...  1466   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...  1020   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...  1018   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   989   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   860   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   843   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   839   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   828   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   825   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   811   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    661   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   661   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   652   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   650   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   644   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   623   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   619   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   607   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   598   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   580   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   202   5e-56
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   183   5e-49
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   174   3e-46
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   172   2e-45
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   167   7e-44
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   164   1e-42
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   162   5e-42
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   157   2e-40
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   154   5e-39
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   150   9e-38
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   122   9e-29
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    68   5e-11
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    40   0.029
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    36   0.48 
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    35   0.61 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    33   3.6  
SAKL0H12936g Chr8 (1107451..1111404) [3954 bp, 1317 aa] {ON} wea...    32   5.4  

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score = 1466 bits (3795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/725 (97%), Positives = 704/725 (97%)

Query: 1   MNVYKYKELQNKMPLKNASYSGQLPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIID 60
           MNVYKYKELQNKMPLKNASYSGQLPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIID
Sbjct: 1   MNVYKYKELQNKMPLKNASYSGQLPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIID 60

Query: 61  QFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDAT 120
           QFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDAT
Sbjct: 61  QFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDAT 120

Query: 121 CSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVE 180
           CSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVE
Sbjct: 121 CSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVE 180

Query: 181 MDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSK 240
           MDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSK
Sbjct: 181 MDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSK 240

Query: 241 LGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIV 300
           LGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIV
Sbjct: 241 LGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIV 300

Query: 301 GSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDP 360
           GSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDP
Sbjct: 301 GSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDP 360

Query: 361 IFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYL 420
           IFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYL
Sbjct: 361 IFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYL 420

Query: 421 NSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVT 480
           NSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVT
Sbjct: 421 NSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVT 480

Query: 481 YLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYID 540
           YLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYID
Sbjct: 481 YLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYID 540

Query: 541 XXXXXXXXXXXXXXXXXXXXXNEKTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAF 600
                                NEKTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAF
Sbjct: 541 AAVVFGSALLGAAASEASDLANEKTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAF 600

Query: 601 DVSPPNSTPSYIKNIPATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCN 660
           DVSPPNSTPSYIKNIPATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCN
Sbjct: 601 DVSPPNSTPSYIKNIPATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCN 660

Query: 661 SGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVEIPL 720
           SGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVEIPL
Sbjct: 661 SGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVEIPL 720

Query: 721 VNKSK 725
           VNKSK
Sbjct: 721 VNKSK 725

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/711 (69%), Positives = 569/711 (80%), Gaps = 5/711 (0%)

Query: 7   KELQNKMPLKNASYSGQLPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIIDQFGKIL 66
           K+L+ +M +K        PS+   L    L+D + KF+VGVDVGTGS RACIIDQ G +L
Sbjct: 4   KKLRRRMQIKTCHLEVS-PSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNML 62

Query: 67  SLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVV 126
           SLAEKPIKREE+R NFITQSS+EIWDAVCHCVKAV+QES VDP +VHG+GFDATCSLVVV
Sbjct: 63  SLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVV 122

Query: 127 SATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKI 186
           SATD KG+AVGPDF+ NDQNIILWMDHRAMKETEEINS+ DKCLKYVGGQMSVEM+IPKI
Sbjct: 123 SATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKI 182

Query: 187 KWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEE 246
           KWLKNNL +E+F+DCKFF+LPDYLTFKATGKENRSF+SAVCKQGFLPAGVE S LGWSEE
Sbjct: 183 KWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEE 242

Query: 247 FLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIID 306
           FLN+IGLSEL  +DFE+LGGSLR KKNFLSAGEC+G LD  +A ELGLT++C+V SG+ID
Sbjct: 243 FLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLID 302

Query: 307 AYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGV 366
           AYAGWVGTVAAKP S I GL+ENE    + N AIGRLAAVAGTSTCHILLSKDPIFVHG+
Sbjct: 303 AYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGI 362

Query: 367 WGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLET 426
           WGPYRDVLAR FW AEGGQSCTG LL HVIK HPA+TELSQL +AA +S FEYLNSMLET
Sbjct: 363 WGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLET 422

Query: 427 LVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACE 486
           +V+KRNERSV+SLA+H FFYGDYHGNRSPIAD NMRACIIGQSMDNSVEDLA+TYL ACE
Sbjct: 423 MVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACE 482

Query: 487 FISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXX 546
           FISQQTRQI+E ML++GH+IDAIFMSGGQCRN LL RLLADC+GLPI+IPRYID      
Sbjct: 483 FISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVVFG 542

Query: 547 XXXXXXXXXXXXXXXNEKTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAFDVSPPN 606
                            +    T++SS S +E  +N  Y   QN +   QNLA DV+   
Sbjct: 543 SALLGAAASEAFDLAKGRRTLTTKKSS-SAQEFFINS-YPSPQNSAMRHQNLASDVTCSY 600

Query: 607 STPSYIKNIPATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLW 666
           + P+ I + P T+N H S I ++    + S    + K T  +   R L+++R     +LW
Sbjct: 601 NLPNSISSAPDTMNRHSSTISKQSRGDMSS--EESSKGTLNTVALRSLEEKRYRGTGILW 658

Query: 667 KVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           KVMQELTG+AK VNPN  THPDRILLDTKYQIFLDMAE Q++YR+MVD +E
Sbjct: 659 KVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score = 1018 bits (2631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/698 (70%), Positives = 562/698 (80%), Gaps = 11/698 (1%)

Query: 24  LPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFI 83
           L SQ   + + S QD + KF+VGVDVGTGS RAC+IDQ G +LSLAEKPIKRE++ SNFI
Sbjct: 20  LSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFI 79

Query: 84  TQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNN 143
           TQSS+EIW+AVC+CV+ V++ES VDP++V GIGFDATCSLVVVSAT+ + IAVGPDF+NN
Sbjct: 80  TQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNN 139

Query: 144 DQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKF 203
           DQNIILWMDHRAMKETEEINS+GDKCLKYVGGQMSVEM+IPKIKWLKNNLEA IF+DCKF
Sbjct: 140 DQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKF 199

Query: 204 FNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFER 263
           F+LPDYLTFKATGKENRSF SAVCKQGFLP GVE S +GWS+EFLNSIGLSELT NDFER
Sbjct: 200 FDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFER 259

Query: 264 LGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAI 323
           LGGSLR+KKNFL+AGEC+  LD  +AC+LGLT+HC+V SGIIDAYAGWVGTVAAKP SA+
Sbjct: 260 LGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAV 319

Query: 324 PGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEG 383
            GL+E E+ K D N AIGRLAAVAGTSTCHILLSK+PIFVHGVWGPYRDVLAR FW AEG
Sbjct: 320 KGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEG 379

Query: 384 GQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHF 443
           GQSCTG LL H+I THPAFTELS +A+ A +S FEYLN +LETLV+KR  RSV+SLAKH 
Sbjct: 380 GQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHL 439

Query: 444 FFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENG 503
           FFYGDYHGNRSPIADPNMRACIIGQSMDNS+EDLAV YL ACEFISQQTRQIIE ML++G
Sbjct: 440 FFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSG 499

Query: 504 HRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXXXXXXXXXXXXXXXXXNE 563
           H I+AIFMSGGQCRN LLMRLLADCTGLPI+IPRY+D                      E
Sbjct: 500 HEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTRE 559

Query: 564 KTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAFD-VSPPN---STPSYIKNIPATL 619
           K   + ++SS ++ E+  ND Y  IQ LS ED+N     VSP N   STPS     PA +
Sbjct: 560 KRTLKGQKSSQTKTER-FNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPS----APAKI 614

Query: 620 NSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLWKVMQELTGEAKVV 679
           N++  PI  +Q   +      + KD S +     L + R N    LWKVMQELTG A++V
Sbjct: 615 NNYSLPICTQQ--PLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWKVMQELTGNARIV 672

Query: 680 NPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           NPN+KTHPDRILLDTKYQIFLDM E QRKYR MVD+VE
Sbjct: 673 NPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/697 (69%), Positives = 557/697 (79%), Gaps = 5/697 (0%)

Query: 21  SGQLPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRS 80
           S   PSQ     + S  +S+ KF+VGVDVGTGSTRACIID+ G ILSLAEKPIKREE+ S
Sbjct: 8   STTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLS 67

Query: 81  NFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDF 140
           NFITQSS+EIW+AVC+CV+ V+QE+ VDP ++HGIGFDATCSLVVVSATD K IAVGPDF
Sbjct: 68  NFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDF 127

Query: 141 SNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKD 200
           +NNDQNIILWMDHRAMKETEEIN +G+ CLKYVGGQMSVEM+IPKIKWLKNNLE+ IF+D
Sbjct: 128 TNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQD 187

Query: 201 CKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTND 260
           CKFF+LPDYLTF+ATGKENRSF+S VCKQGFLP GVE S LGWS++FL+SIGLSELT ND
Sbjct: 188 CKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDND 247

Query: 261 FERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPS 320
           FE+LGGSLR++KNFLSAGEC+G LD  +A +LGLT++C+V SGIIDAYAGWVGTVAAKP 
Sbjct: 248 FEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPE 307

Query: 321 SAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWT 380
           S I GL+ENE  K+D N AIGRLAAVAGTSTCHILLSK  IFVHG+WGPYRDVLAR FW 
Sbjct: 308 SEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWA 367

Query: 381 AEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLA 440
           AEGGQSCTG LL HVI THPAF++LSQLADAA++S FEYLNS+LE LV+KR ERSV+ LA
Sbjct: 368 AEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLA 427

Query: 441 KHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAML 500
           KH FFYGDY GNRSPIADPNMRACIIGQSMDNS++DLAV YLGACEFISQQTRQIIE ML
Sbjct: 428 KHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVML 487

Query: 501 ENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXXXXXXXXXXXXXXXX 560
           ++GH I+A+FMSGGQCRNGLLMRLLADCTGLPI+IPRYID                    
Sbjct: 488 KSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDL 547

Query: 561 XNEKTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAFDVSPPNSTPSYIKNIPATLN 620
              + + ++++SSL Q E  +   Y  IQNL  E  N + +V           N PA  +
Sbjct: 548 NKRRRVIKSKKSSLVQTE-FLEGLYPSIQNLPLE--NHSTNVVASYKLACSNLNAPARTS 604

Query: 621 SHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLWKVMQELTGEAKVVN 680
           S + PI + Q   ++S  +++ K  S       L++ER    ++LWKVMQELTG AKV+ 
Sbjct: 605 SDLFPISKEQPADMIS--DKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKVIC 662

Query: 681 PNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           PN KTHPDRILLDTKYQIFLDM E QR YR MVD+VE
Sbjct: 663 PNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVE 699

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/716 (59%), Positives = 525/716 (73%), Gaps = 24/716 (3%)

Query: 26  SQNKLLPQT----SLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSN 81
           SQ +LL Q+    S++ ++  ++VGVDVGTGS RACIID  G ILSLAE+PI+R+E++ +
Sbjct: 13  SQQRLLSQSMSALSMEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPS 72

Query: 82  FITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFS 141
           +ITQSS+EIW A+C+CVK+V+++S V P+K+HGIGFDATCSLVVV     K +AVGPDF 
Sbjct: 73  YITQSSQEIWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFF 132

Query: 142 NNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDC 201
           N +QNIILWMDHRA+ ET+EIN+T DKCLKYVGGQMSVEM+IPKIKWLKNNL  E F+ C
Sbjct: 133 NTEQNIILWMDHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKC 192

Query: 202 KFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDF 261
           KFF+L DYLTFKATG E RS+ S VCKQG LP GVESSK GWS+EFL +IGL +L  +DF
Sbjct: 193 KFFDLADYLTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDF 252

Query: 262 ERLGGSLRDK----KNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAA 317
            +LGGS++        FLSAGEC+G LD ++A ELGL  HC+VGSG+IDAYAGWVGTVAA
Sbjct: 253 RKLGGSIKSDGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAA 312

Query: 318 KPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARN 377
           +    IP L E ++EK  I+ A GRLAAVAGTSTCHI +SKDPIFV GVWGPYRDV+A  
Sbjct: 313 RTDVDIPELVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPG 372

Query: 378 FWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVV 437
           FW AEGGQSCTGALLAHV+  HPA+TELS L+DAAS+S F+YLNS LE L Q+R  RSVV
Sbjct: 373 FWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVV 432

Query: 438 SLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIE 497
           +LAKH FFYGDYHGNRSPIADP+MRA +IGQSMDNS++DLA+ YLGACEFI+QQTRQI+E
Sbjct: 433 ALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVE 492

Query: 498 AMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXXXXXXXXXXXXX 557
            M  +GHRI AIFMSGGQCRNGLLMRLLADCTGLPI+IPRYID                 
Sbjct: 493 KMSVSGHRIAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 552

Query: 558 XXXXNEK-TICQTRRSSLSQKEKVVNDPYK-PIQN-LSGEDQNLAFDVSPPNSTPSYIKN 614
               ++  ++ + R+SSLS K +   D  + P +N LS      + D+  P + PS   +
Sbjct: 553 FNLNHKSGSLSRRRKSSLSGKYEEFKDSMEIPKKNFLSKLGGTASGDLPSPYTAPSATAS 612

Query: 615 ---IPATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTR--------GLQKERCNS-- 661
              I +T+     P+       ++   +  + + + S  ++         L+KE+  S  
Sbjct: 613 TSQIASTVGGFPFPVTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGK 672

Query: 662 GDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           GD LW VM  +TG  KVV P+   HPDR+LLD KY+IFLDMAE QR+YR  VD+VE
Sbjct: 673 GDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/697 (59%), Positives = 501/697 (71%), Gaps = 19/697 (2%)

Query: 35  SLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAV 94
           SL+  +  ++VGVDVGTGS RACIID  G ILSLAE+PI+RE++++NFITQSS+EIW AV
Sbjct: 26  SLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAV 85

Query: 95  CHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHR 154
           CHCVK+V+++S V  +K+HGIGFDATCSLVVV     K +AVGPDFSN DQNIILWMDHR
Sbjct: 86  CHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHR 145

Query: 155 AMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKA 214
           A++ET+ IN+TGDKCLKYVGGQMSVEM+IPKIKWLKN+L    F +CKFF+L DYLTFKA
Sbjct: 146 AIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKA 205

Query: 215 TGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK--- 271
           +GKE RSF S VCKQG LP GVE S  GWS EFL  IGL EL  +DF R+GGS+++    
Sbjct: 206 SGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKG 265

Query: 272 KNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEH 331
           KNFLSAGE +G +D   A ELGL+ HC+VGSG+IDAYAGWVGTVAA+   +IP L + + 
Sbjct: 266 KNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQ 325

Query: 332 EKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGAL 391
           EK  ++ A GRLAAVAGTSTCHI +S+DPIFV GVWGPYRD LA NFW AEGGQSCTGAL
Sbjct: 326 EKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGAL 385

Query: 392 LAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHG 451
           LAHV+ THPA+TELSQLADAAS+S F+YLNS LETL Q++  RSVV LAKH FFYGDYHG
Sbjct: 386 LAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHG 445

Query: 452 NRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFM 511
           NRSPIADP+MRA IIGQSMDNS++DLA+ YLGACEFI+QQTRQI++ M  +GH + AIFM
Sbjct: 446 NRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFM 505

Query: 512 SGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXX-XXXXXXXXXXXXXXXXXNEKTICQTR 570
           SGGQCRNGLLMRLLADCTGLPI+IPRYID                          +  +R
Sbjct: 506 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSR 565

Query: 571 RSSLSQKEKVVNDPYKPIQNLSGEDQNLAFDVSPPNSTPSYIKNIPATLNSHISPIVERQ 630
           +SS++ +      P K   +  G  Q    D+  P + PS   +     ++   P    +
Sbjct: 566 KSSIAGEPANAGQPKKSAVSKFG--QLGGDDLPSPYTAPSATASTSQIASTIGFPFPTPE 623

Query: 631 LHVVVSARNRNDKDTSTST-------------VTRGLQKERCNSGDLLWKVMQELTGEAK 677
               +      +KD   ST             +   ++    ++GD +W VM  +TG  K
Sbjct: 624 DAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK 683

Query: 678 VVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714
           VV P  + + DR+LL+ KY+IFLDMAE QRKYR +VD
Sbjct: 684 VVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/713 (58%), Positives = 511/713 (71%), Gaps = 23/713 (3%)

Query: 26  SQNKLLPQT----SLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSN 81
           SQ +++ ++    SL+  +  +++GVDVGTGS RACIID  G ILSLAE+PI+RE+++ N
Sbjct: 13  SQQRMMSRSMTGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPN 72

Query: 82  FITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFS 141
           FITQSS+EIW AVCHCVK+V+++S V  +K+HGIGFDATCSLVVV     K +AVGPDF 
Sbjct: 73  FITQSSQEIWQAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQ 132

Query: 142 NNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDC 201
           N +QNIILWMDHRA++ETE+IN+TGDKCLKYVGGQMSVEM+IPKIKWLKN+L    F +C
Sbjct: 133 NTNQNIILWMDHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDEC 192

Query: 202 KFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDF 261
           KFF+L DYLTFKA+GKE RSF S VCKQG LP GVE SK GWS EFL  IGL +   +DF
Sbjct: 193 KFFDLADYLTFKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDF 252

Query: 262 ERLGGSLRDK---KNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAK 318
            ++GGS+++    KNFLSAGE VG +D   A ELGL+ HC+VGSG+IDAYAGWVGTVAA+
Sbjct: 253 RKIGGSVKNSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAAR 312

Query: 319 PSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNF 378
              +IP L + + EK  ++ A GRLAAVAGTSTCHI +S+DPIFV GVWGPYRD LA NF
Sbjct: 313 TDVSIPALVKIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNF 372

Query: 379 WTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVS 438
           W AEGGQSCTGALLAHV+ THPA+TELSQLADAAS+S F+YLNS LETL Q++  RSVV 
Sbjct: 373 WCAEGGQSCTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVH 432

Query: 439 LAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEA 498
           LA+H FFYGDYHGNRSPIADP+MRA IIGQSMDNS++DLA+ YLGACEFI+QQTRQI+E 
Sbjct: 433 LARHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEK 492

Query: 499 MLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXXXXXXXXXXXXXX 558
           M  +GH + AIFMSGGQCRNGLLMRLLADCTGLPI+IPRYID                  
Sbjct: 493 MTTSGHDMAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF 552

Query: 559 XXXNEKT-ICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAFDVSPPNSTPSYIKNIPA 617
                 + +  +R+SS++      + P K   +  G  Q  + D+  P + PS   +   
Sbjct: 553 DLSGTTSELSVSRKSSIAGHPTDGSQPKKSAVSKLG--QFGSDDLPSPYTAPSATASTSQ 610

Query: 618 TLNSHISPIVERQLHVVVSARNRNDKDTSTST-------------VTRGLQKERCNSGDL 664
             ++   P         +  +   D D   S+             +   ++    ++GD 
Sbjct: 611 IASTVGFPFPTPDDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDA 670

Query: 665 LWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           +W VM  +TG  KVV P  + +PDR LLD KY+IFLDMAE QRKYRN+V+ VE
Sbjct: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/715 (58%), Positives = 510/715 (71%), Gaps = 30/715 (4%)

Query: 26  SQNKLLPQTSLQDSQEK---FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNF 82
           +Q + + Q+    S E+   ++VGVDVGTGS RACIID  G ILSLAEKPI+REE++ N+
Sbjct: 14  AQQRFMSQSMAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNY 73

Query: 83  ITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSN 142
           ITQSS+EIW ++CHCVK+V+++S V  +++HGIGFDATCSLVVV   D K + VGP F+N
Sbjct: 74  ITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLVVVDDED-KEVGVGPVFAN 132

Query: 143 NDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCK 202
           NDQNI+LWMDHRA+ ET EIN+T DKCLKYVGGQMSVEM+IPKIKWLKNNL  E F  CK
Sbjct: 133 NDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCK 192

Query: 203 FFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDF- 261
           FF+L DYLTFKAT K+ RSF S VCKQG +P GVE SK GWS++FLN+I L EL  N F 
Sbjct: 193 FFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFC 252

Query: 262 -----ERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVA 316
                     +     +FLSAGE VG LD  +A ELGL  HC+VGSG+IDAYAGWVGTVA
Sbjct: 253 QDRWPATATAADGTTHSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVA 312

Query: 317 AKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLAR 376
           A+    +P L+E +  K  I+ A GRLAAVAGTSTCHI LS+DP+FV+GVWGPYRDV+A 
Sbjct: 313 AQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAH 372

Query: 377 NFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSV 436
            FW AEGGQSCTGALLAHV+ THPAFTELS L+DAA+IS F+YLNS LETLVQ+R +RSV
Sbjct: 373 GFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSV 432

Query: 437 VSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQII 496
           V+LAKH +FYGDYHGNRSPIADP+MRA IIGQSMDNS++DLA+ YLGACEFI+QQTRQI+
Sbjct: 433 VALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIV 492

Query: 497 EAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXXXXXXXXXXXX 556
           E M + GH+I  IFMSGGQCRNGLLMRLLADCTGLPI+IPRYID                
Sbjct: 493 EKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 552

Query: 557 XXXXXNEKT-ICQTRRSSLSQKEKVVNDPYK--------PIQNLSGEDQNLAFDVSPPNS 607
                + K+ I + R+SSL+       DP          P+  L     +L    + P++
Sbjct: 553 SFNSHHAKSEITRRRKSSLTNL-----DPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHA 607

Query: 608 TPSYIKNIPATLNSHISPIVERQLHVVVSARNRNDKDTS----TSTVTRGL-QKERCNSG 662
           T S    I AT  S   P+V      +    N ++   S     +T   GL  +   N+G
Sbjct: 608 TSS-TSQIAATSGSFPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATRNPPNNG 666

Query: 663 DLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           D LW VM ++TG  KVV P+ +  PDR+LL+ KY+IFLDMA++QR+YR  +D+VE
Sbjct: 667 DALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/759 (55%), Positives = 524/759 (69%), Gaps = 62/759 (8%)

Query: 19  SYSGQLPSQNKLLPQT----SLQDSQEK-FHVGVDVGTGSTRACIIDQFGKILSLAEKPI 73
           S+S    SQ +LL  +    SLQ+ ++  ++VGVDVGTGS RAC+ID  G ILSLAE+PI
Sbjct: 7   SHSSLSISQQRLLSHSMSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPI 66

Query: 74  KREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKG 133
           +R E++ N+ITQSS+EIW+A+C+CVK V+++S VDP+ +HGIGFDATCSLVVV   + + 
Sbjct: 67  QRHELKPNYITQSSQEIWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLVVVDNNN-ED 125

Query: 134 IAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNL 193
           + VGPDF++N QNIILWMDHRA++ETEEIN+TGDKCLKYVGGQMSVEM+IPKIKWLKNN+
Sbjct: 126 VGVGPDFTDNLQNIILWMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNI 185

Query: 194 EAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGL 253
             + F  CKFF+L DYLTFKATG E RS+ S VCKQG LP GVE SK GWS+EFL  IGL
Sbjct: 186 PEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGL 245

Query: 254 SELTTNDFERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVG 313
            EL  +DF +LGGS+ +   FLSAGEC+G L   SA ELGL+ HC+VGSG+IDAYAGWVG
Sbjct: 246 EELIADDFAKLGGSVTET-TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVG 304

Query: 314 TVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDV 373
           TVAA+    IP L +++  K+ I+ A GRLAAVAGTSTCHI +SKDPIFV GVWGPYRDV
Sbjct: 305 TVAARTDVEIPALVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDV 364

Query: 374 LARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNE 433
           +A  FW AEGGQSCTGALLAHV+ THPA+ ELSQL+DAA++S F+YLNS LE L Q+R  
Sbjct: 365 MAPGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKA 424

Query: 434 RSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTR 493
            SVV+LAKH FFYGDYHGNRSPIADP+MRA IIGQSMDNS++DL++ YLGACEFI+QQTR
Sbjct: 425 SSVVALAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTR 484

Query: 494 QIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXXXXXXXXX 553
           QI+E M  +GH + AIFMSGGQCRNGLLMRLLADCTGLPI+IPRYID             
Sbjct: 485 QIVEQMCNSGHELAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAV 544

Query: 554 XXXXX-------------XXXNEKTICQTRRSSLSQKEK-VVND---------------- 583
                                + K +   R+SSLS+K+  ++ D                
Sbjct: 545 ASESFNACAKLEETASDPATTSNKDVSIRRKSSLSRKDAGIIGDGSRSRSGSAASGLGHG 604

Query: 584 ---PYKPIQNLSGEDQ---NLAF-DVSPPNSTPSYIKNIP--ATLNSHISPIVERQLHVV 634
                KP+ + +   +   +L F D+  P + PS   +    +T   +  P++      +
Sbjct: 605 GGNTLKPLTSFAKAQKKTNDLKFADMPSPYTAPSATSSTAQISTTGGYPFPVMASNEEAI 664

Query: 635 VS---------------ARNRNDKDTSTSTVTRGLQKE-RCNSGDLLWKVMQELTGEAKV 678
           +                A+    K+ +TS       K  R  + D LW+VM  +TG  KV
Sbjct: 665 IDEMEEENEDESLLTFDAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKV 724

Query: 679 VNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           V P ++  PDR+LL+ KY+IFLDMA  Q+KYR +VD V+
Sbjct: 725 VWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/722 (57%), Positives = 509/722 (70%), Gaps = 37/722 (5%)

Query: 26  SQNKLLPQTSLQDSQEK---FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNF 82
           SQ +LL Q+ L  S E+   +++GVDVGTGS RAC+ID  G I+SLAEKPI+REE++  +
Sbjct: 13  SQQRLLSQSMLGLSLEQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTY 72

Query: 83  ITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSN 142
           ITQSSKEIW A+C+CVK V+++S VD +++HGIGFDATCSLV V++ D   + VGPDF N
Sbjct: 73  ITQSSKEIWSAICYCVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFEN 132

Query: 143 NDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCK 202
            DQNIILWMDHRA++ET EINST    LKYVGGQMS+EM+IPKIKWLKN++  E F D  
Sbjct: 133 PDQNIILWMDHRAVQETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTV 192

Query: 203 FFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFE 262
           FF+L D+LT+KATG   RSF S+VCKQG LP GVE S  GWS EFLN I L EL  NDF 
Sbjct: 193 FFDLADFLTYKATGLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFA 252

Query: 263 RLGGSLRDK-----KNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAA 317
           +LGGS++ K      NFLSAG+ VG L   +A +LGL  HC+VGSG+IDAYAGWVGTVAA
Sbjct: 253 KLGGSVKPKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAA 312

Query: 318 KPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARN 377
           +    IP L++ E  K  ++ A GRLAAVAGTSTCH+ LS+DPIFV GVWGPYRDV+A  
Sbjct: 313 QTDEEIPELAKCEKGKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPG 372

Query: 378 FWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVV 437
           FW AEGGQSCTGALLAHV+ THPA+T+L  L+++A +S F+YLNS LE LV  R ERSVV
Sbjct: 373 FWCAEGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVV 432

Query: 438 SLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIE 497
           +LAKH FFYGDYHGNRSPIAD  MRA IIGQSMDNSV+DLA+ YLGACEFI+QQTRQI+E
Sbjct: 433 ALAKHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVE 492

Query: 498 AMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDXXXXXXXXXXXXXXXXX 557
            M ++GH I +IFMSGGQCRNGLLMRLLADCTGLPI+IPRYID                 
Sbjct: 493 IMCKSGHNISSIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASES 552

Query: 558 XXXXNEKTICQTRR-SSLSQKEKVVNDPYK-PIQNLSGEDQNLAFDVSPPNSTPSYIKNI 615
               + KT  + RR SSL  K++ +    K  +  LS     L  D   P + P      
Sbjct: 553 YNAHHTKTDLRKRRASSLGSKDQAIAGLGKGGLSKLS----ELQTDQPSPYTAPH----- 603

Query: 616 PATLNSHIS-----PIVERQLHVVVS-----ARNRNDKDTST-----STVTRGL-QKERC 659
            AT +SH+      PIV       +S     A   ++++  T     ST    L +K   
Sbjct: 604 -ATSSSHMGGGSYFPIVGSDAAANLSPGEAIAETEDEEEPVTFKSVKSTTQENLAEKTDT 662

Query: 660 NS-GDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVEI 718
           NS G+ LWKVM ++TG  KVV PN  T+PDR+LL+ KY+IFLDMA  QR+YR+ +DRVE 
Sbjct: 663 NSNGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVEA 722

Query: 719 PL 720
            L
Sbjct: 723 NL 724

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/510 (60%), Positives = 388/510 (76%), Gaps = 15/510 (2%)

Query: 38  DSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHC 97
           D Q  ++VG+DVGTGS RAC++D  G +LSL EK I REE++ NFITQS++EIW A C C
Sbjct: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70

Query: 98  VKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMK 157
           VK  +++ +VD   V GIGFDATCSLV +     K + VGP+F N D N+ILWMDHRA+K
Sbjct: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130

Query: 158 ETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGK 217
           E  EIN+T DKCLKYVGG MSVEMDIPKIKWLKNN++  +FK C+FF L DYLTFKATGK
Sbjct: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190

Query: 218 ENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRD--KKNFL 275
             RSF S VCKQGFLP GVE S  GWS+EFL+SIGL +L  N ++ LGG+L++  + NF 
Sbjct: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250

Query: 276 SAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHE-KN 334
           S+G+C+G L   +  ELGL+++C+VG+GIIDAYAG +GT+AA         SE  H+ KN
Sbjct: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAAT--------SEGSHQIKN 302

Query: 335 D----INSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGA 390
           D    + +AIGRLA+VAGTSTCH+LLSKDP+FV GVWGPYRDV+A  +W AEGGQ+CTG 
Sbjct: 303 DSSIGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGE 362

Query: 391 LLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYH 450
           LL++V+  HPAF EL   +  A I  F+YLN+ML+ L  K    S + LAKH FFYGDY 
Sbjct: 363 LLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYR 422

Query: 451 GNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIF 510
           GNRSP ADP M A IIGQSM++++E+LAVTYL ACEFI+QQTRQI+E + + G  +  I+
Sbjct: 423 GNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIY 482

Query: 511 MSGGQCRNGLLMRLLADCTGLPIMIPRYID 540
           MSGGQCRN LLM+LL+DCTGLPIM+P+Y+D
Sbjct: 483 MSGGQCRNKLLMKLLSDCTGLPIMLPKYVD 512

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%)

Query: 646 STSTVTRGLQKERCNSGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAEN 705
           +T+  +R   +  C+ G +LW+ M  +T    ++ PND  HPDR LLD KYQIFLDMAE 
Sbjct: 524 ATADASRKSVEIECDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAET 583

Query: 706 QRKYRNMVDRVEI 718
           QRKYR MVD ++I
Sbjct: 584 QRKYRQMVDDIDI 596

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/500 (61%), Positives = 389/500 (77%), Gaps = 4/500 (0%)

Query: 44  HVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQ 103
           ++GVDVGTGS RAC+I+  G+ILSL  K I +EE++ N+ITQSS+EIW  +C CV  VLQ
Sbjct: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63

Query: 104 ESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEIN 163
           ES++ P  V GIGFDATCSLVV+     + + VGP+F ++++NIILWMDHRA+KET+EIN
Sbjct: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123

Query: 164 STGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFA 223
           +TGDKCLKYVGG+MSVEM++PKIKWLKNNL   +F +CKFF+L DYLT+KAT K+ RSF+
Sbjct: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183

Query: 224 SAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKK---NFLSAGEC 280
           S VCKQG LP GVE S +GWS+EF   I L EL++++F  +GGS+  ++   N  S GE 
Sbjct: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243

Query: 281 VGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAI 340
           VG L   SA ELGL   CIVGSGIIDAYAGWVGTVAAK    I  ++ ++   + ++S+I
Sbjct: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASSKLDSSI 302

Query: 341 GRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHP 400
           G LA +AGTSTCHI LS  PIFV+G+WGPYRDVL+ NFW AEGGQSCTGALL H++ THP
Sbjct: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362

Query: 401 AFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPN 460
           A+ EL +  +  S+  FE+LN+ L  L ++ + RS++SL KHFF YGDYHGNRSPI+D +
Sbjct: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422

Query: 461 MRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGL 520
           MRA IIGQSMD S++ LA+ YL ACEFISQQ+RQII  +++ GH I  I+MSGGQ RN L
Sbjct: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482

Query: 521 LMRLLADCTGLPIMIPRYID 540
           LMRLLADCTGLP++IPRYID
Sbjct: 483 LMRLLADCTGLPVVIPRYID 502

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (68%)

Query: 660 NSGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           + G  LW  M +LT    V+NPN   HPDR+LL+ KY+IFLDMAE QRKYR  +D +E
Sbjct: 532 DHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/513 (60%), Positives = 388/513 (75%), Gaps = 7/513 (1%)

Query: 33  QTSLQDSQEK----FH-VGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSS 87
           Q  L + +EK    FH +GVDVGTGS RAC+ID+ G IL+L +KPI REE++  FITQSS
Sbjct: 5   QNPLTNGKEKGGDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSS 64

Query: 88  KEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNI 147
           +EIWD++C CV+ V+ ++++   KV GIGFDATCSL VV    L+G+AVGP FS NDQNI
Sbjct: 65  EEIWDSICFCVRKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNI 124

Query: 148 ILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLP 207
           I+WMDHRA +ET+EINS  D  LKYVGG+MS+EM++PKIKWLKN++  E F+   FF+LP
Sbjct: 125 IMWMDHRASQETDEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLP 184

Query: 208 DYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGS 267
           DYLTFKATG +NRS  SAVCKQG LP GVE S  GWS  FL++ GL EL  N+FER+GG 
Sbjct: 185 DYLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP 244

Query: 268 LRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLS 327
             + +NFLSAGE V  L  +S  +LGLT+ C+VGSG+IDAYAG +GT+AA+   +    +
Sbjct: 245 GNNSRNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ART 302

Query: 328 ENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSC 387
           +++    D+ +AIGRLAAVAGTSTCHI LS  PIFV+GVWGPY+D+LA+++W AEGGQSC
Sbjct: 303 QDDANGQDLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSC 362

Query: 388 TGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYG 447
           TG LL HVI THPA+ EL   A  + + +FE LN ++  L +++   +++ L K  F YG
Sbjct: 363 TGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYG 422

Query: 448 DYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRID 507
           DYHGNRSPIADP MRA IIGQSMD +VE LA+ YL ACEFI+ QTR II  M E GH I 
Sbjct: 423 DYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIR 482

Query: 508 AIFMSGGQCRNGLLMRLLADCTGLPIMIPRYID 540
           +I+MSGGQCRN +LM LLAD TGLP++IP+YID
Sbjct: 483 SIYMSGGQCRNNILMELLADFTGLPVVIPKYID 515

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%)

Query: 665 LWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714
           LW  M ++TG    + P    H  + LL+TKY+I++DMA+ Q+KYR+++D
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/500 (60%), Positives = 390/500 (78%), Gaps = 8/500 (1%)

Query: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102
           +++GVDVGTGS RACIID  G I S AE  I R+E++++ ITQSS+EIW AVC CVK V+
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 103 QESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEI 162
            E      +V GIGFDATCSLVVV     +G+AVGPDF++++Q+IILWMDHRA+KET+EI
Sbjct: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126

Query: 163 NSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSF 222
           NST D+CLKYVGGQMS+EM++PKIKWLK ++  ++F  C+F++L DYLTFKATG++ RSF
Sbjct: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186

Query: 223 ASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK--KNFLSAGEC 280
            S VCKQG +P GVE SKLGWS++FL +I L ELT ND+ +LGGS+     +NFL+AGE 
Sbjct: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246

Query: 281 VGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAI 340
           +  L+  +  EL L++ CIVGSGIIDAYAGW+GTV +        +   +  +  + +AI
Sbjct: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT------VDLEQLFRVGMANAI 300

Query: 341 GRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHP 400
           GRLAAVAGTSTCHI+LSKDPIFV GVWGPY+D + + +W  EGGQSCTGALL HV++THP
Sbjct: 301 GRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHP 360

Query: 401 AFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPN 460
           ++ EL ++++   ++ F+YLN+ L  + ++ NERSV+ LAKH FFYGD HGNRSP+ADP+
Sbjct: 361 SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS 420

Query: 461 MRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGL 520
           M+  I+G SMD S+++LA TYL ACEFI+QQ RQIIEAM + GH I AI+MSGGQCRN L
Sbjct: 421 MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSL 480

Query: 521 LMRLLADCTGLPIMIPRYID 540
           LM+LLADC+GL ++IP YID
Sbjct: 481 LMKLLADCSGLSVIIPEYID 500

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 41/58 (70%)

Query: 660 NSGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           N+ ++LW  M ++T     + P  K HPDRILLD KY+IFLDMA+ Q++YR +VD VE
Sbjct: 530 NTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/498 (59%), Positives = 379/498 (76%), Gaps = 8/498 (1%)

Query: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102
           +++GVDVGTGS RA ++   G  L+L E PIKR+E+R +FITQSS EIW AVCHCV+ V+
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 103 QESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEI 162
            +S V+P+ V GIGFDATCSLV V A     + VGP+F ++ QNIILWMDHRA +ET+ I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 163 NSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSF 222
           N+TGD+CLKYVGGQMSVEM++PKIKWLK ++    F  CKFF+LPDYLTF AT K+ RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 223 ASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVG 282
            SAVCKQG LP GV+ S+  WS EFL ++GLSEL   +F +LGG+   K  FL+AG+ VG
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQPVG 245

Query: 283 FLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGR 342
            L + ++ + GL+  CIV SG+IDAYAGW+G+V AK         +  H+ + ++ AI R
Sbjct: 246 QLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAK--------FDQSHKSSGLDVAITR 297

Query: 343 LAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAF 402
           LA +AGTSTCHI+LSK P FV GVWGPYRDVL   +W AEGGQSCTGALLAH+++THPA 
Sbjct: 298 LALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAH 357

Query: 403 TELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMR 462
            EL +LA    +S FEYL  ML+TL+ KR  R+V+ L++ FF YGD+HGNRSP+ADP+MR
Sbjct: 358 EELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMR 417

Query: 463 ACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLM 522
           A +IGQSMD S+E LAV YL ACEFI+ QTRQI+E M+ NGH ++ ++MSGGQCRN LLM
Sbjct: 418 ATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLM 477

Query: 523 RLLADCTGLPIMIPRYID 540
           +L+AD  G+P+++P+Y D
Sbjct: 478 QLIADSVGVPVVLPKYTD 495

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 665 LWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRV 716
           LW +M  +T     V PND +  +R  +D KY IFLDM E Q+ YR+ +D+V
Sbjct: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/500 (58%), Positives = 377/500 (75%), Gaps = 9/500 (1%)

Query: 42  KFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAV 101
           + ++GVDVGT S RAC++D  G ILSLA KPI R+E++ N++TQSS EIW A+C C++ +
Sbjct: 3   QHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKI 62

Query: 102 LQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEE 161
           + +S+V    + GIGFDATCSLVV+     KG+AVGP+F + +Q+IILWMDHRA+ E  E
Sbjct: 63  ICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNE 122

Query: 162 INSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRS 221
           INSTG +CLKYVGG+MS+EM IPKIKWLKNNL    F  C+F++LPD+LT++ATG + RS
Sbjct: 123 INSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRS 182

Query: 222 FASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRD-KKNFLSAGEC 280
           F S VCK G LP GV+ S  GW ++    IGL+EL   +F +LGG +     NFLSAG+ 
Sbjct: 183 FCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDY 242

Query: 281 VGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAI 340
           VG L   +A +LGLT  CIV SG+IDAYAGWVGT+AA  +    G      +++++ S+ 
Sbjct: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDG------QESELASS- 295

Query: 341 GRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHP 400
            RLA VAGTSTCHI +SK P F+ GVWGPYRD L   +W  EGGQSCTGALLAHV+K+HP
Sbjct: 296 -RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHP 354

Query: 401 AFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPN 460
           A+  L +LA    IS F+++N+ LE L ++R  +SV +L KH FFYGDYHGNRSPIADPN
Sbjct: 355 AYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPN 414

Query: 461 MRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGL 520
           MRA IIGQSMD SV+DLA+  LGACEFI+QQTRQI+E + ++GH I +I+MSGGQCRN +
Sbjct: 415 MRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLV 474

Query: 521 LMRLLADCTGLPIMIPRYID 540
           L++LLA+CT LPI++P+YID
Sbjct: 475 LIKLLANCTKLPIVLPKYID 494

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 645 TSTSTVTRGLQKERCNS-----GDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIF 699
           + T++V+  + ++R  S       +LW VM  LTG  +++ P++    +  LLD KY+IF
Sbjct: 517 SDTASVSTIVDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIF 576

Query: 700 LDMAENQRKYRNMVDRVE 717
           LDM E Q++YR++V R E
Sbjct: 577 LDMIETQKRYRDLVTRAE 594

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/504 (57%), Positives = 377/504 (74%), Gaps = 6/504 (1%)

Query: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102
           +++GVDVGTGS RAC+ID  G ILS+ E  I R+E++  +ITQS+ +IW+ +C C++ +L
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 103 QESEVD--PKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
           QES VD    K+ GIGFDATCSLVV+++   + +AVGP+F +NDQN+ILWMDHRA+ ET 
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 161 EINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENR 220
           EINST  KCLKYVGGQMSVEM+IPKIKWLKNN+   ++KDCKF +LPD+LT+KATG   R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 221 SFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRD----KKNFLS 276
           SF SAVCKQG LP GVE S  GW+EEFL +IGL +L  ++F +LGG ++     K +F +
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 277 AGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDI 336
           AGE +G+L   S+  +G++  C V SGIIDAYAGW+GT+AA     I  L+  +   N +
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302

Query: 337 NSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVI 396
             + GRLA VAGTSTCHI L+  PIFV GVWGPYRDVL  NFW AEGGQSCTGALL HV+
Sbjct: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362

Query: 397 KTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPI 456
           +THPA+ EL  ++    IS+FE LN+ +  L  +R+    V L K+ FFYGD+HGNRSP+
Sbjct: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422

Query: 457 ADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQC 516
           AD  MR  IIG SMD+S+ DL   YLGACEFI+QQTR I++ M ++G+ + +++MSGGQC
Sbjct: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482

Query: 517 RNGLLMRLLADCTGLPIMIPRYID 540
           RN LLM+L+++C GLP++IP+ ID
Sbjct: 483 RNELLMQLISNCVGLPVVIPKNID 506

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%)

Query: 664 LLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714
           +LW VM ++TG+  VV+P D +     LL  KYQI+LDM   Q++YR+MV+
Sbjct: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/498 (58%), Positives = 364/498 (73%), Gaps = 6/498 (1%)

Query: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102
           +++GVDVG+GS RAC++D  G +LS+A + I +EE     +TQSS EIWDAVC+CVK+ +
Sbjct: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62

Query: 103 QESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEI 162
             S V+   + GIGFDATCSLVV++    + +A GP+F NN+QNII+WMDHRA++ET+EI
Sbjct: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122

Query: 163 NSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSF 222
           N +GD CLKYVGGQMSVEM+IPKIKWLKN++  E FK   F +LPDYLTF A+G   RS+
Sbjct: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182

Query: 223 ASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVG 282
            SAVCKQGFLP GVE S  GWS EFL  IGL E++ ++F  LGG   +  NF  AG  + 
Sbjct: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241

Query: 283 FLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGR 342
            +  +      +   CIVGSGIIDAYAGW+GTVA+  +  +P    N  E  DI    GR
Sbjct: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASS-TIEVP----NNKEVVDIEECAGR 296

Query: 343 LAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAF 402
           LAAVAGTSTCHI+LSK  IFV GVWGPYRDVL  ++W AEGGQS TGALLAH++  HP+ 
Sbjct: 297 LAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSA 356

Query: 403 TELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMR 462
            ELS L    ++  F +LN+ +  L +K N  + + L K FF YGDYHGNRSPIADPNMR
Sbjct: 357 NELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMR 416

Query: 463 ACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLM 522
           A IIGQSMD S++DLA TYL ACEFI+ QT+ II+ ++  GH I AI+MSGGQCRN +LM
Sbjct: 417 AAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILM 476

Query: 523 RLLADCTGLPIMIPRYID 540
           +L+A+CTGLP++IP+YID
Sbjct: 477 QLIANCTGLPLIIPKYID 494

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%)

Query: 663 DLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714
           DLLW  M  +T +   V P  +   +R L++ K++IFLDMA+ Q+ YR +V+
Sbjct: 522 DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/498 (57%), Positives = 368/498 (73%), Gaps = 3/498 (0%)

Query: 44  HVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQ 103
           ++GVDVGTGS RACI ++ G+IL++  K I ++E++  FITQSS EIWDA+   +K V+ 
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 104 ESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEIN 163
            S VDP  + GI FDATCSLVV     L+ IAVGP+F +++QNIILWMDHRA  ET+ IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 164 STGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFA 223
           ST DK LKYVGG+MSVE ++PKIKWLK++L  E F  C F +L D+LT+KATGK   SF+
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 224 SAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKK-NFLSAGECVG 282
           SAVCKQG LP GVE SKLGWS+EFL  IGL EL+TN+FE+LGGS+  K+ NFL  G+ VG
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243

Query: 283 FLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGR 342
            +D   A    L  HC+VG+G+IDAY+GWVGTVA+  S  +   S++  E N I  ++GR
Sbjct: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRV--CSDSPQELNKIEGSLGR 301

Query: 343 LAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAF 402
           +A V+GTSTCHI+LSK P+F+ GVWGPYRDVLA N W  EGGQS TGALL ++I+THPA+
Sbjct: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361

Query: 403 TELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMR 462
            EL ++    + +IF YL+  LE L   R   SV  L K+ F YGDY+GNRSP+ADP M 
Sbjct: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421

Query: 463 ACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLM 522
             IIGQ+MD+S+ DLA+ YL ACEFI+ QTR II+ ++ +GH I AI+MSGG C+N LLM
Sbjct: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481

Query: 523 RLLADCTGLPIMIPRYID 540
            L+++C  LP+++ +YID
Sbjct: 482 ELISNCCVLPLVLSKYID 499

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 663 DLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRV 716
           D+LW  M+ +T +  ++ P  +    R  L  KY+++LDM +   KYR  ++ V
Sbjct: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/500 (55%), Positives = 351/500 (70%), Gaps = 9/500 (1%)

Query: 41  EKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKA 100
           ++++VGVDVGT   RACIID+ G IL+  + PI R + + + ITQSS EIW AVC  V+A
Sbjct: 7   KQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRA 66

Query: 101 VLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
            + ES+V   +V GI FDATCSLVV+       +AVGPDFS+N QN+ILWMDHRA+ E  
Sbjct: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEAS 126

Query: 161 EINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENR 220
           EINSTG   L+YVGG+MSVEM +PKIKWL+ ++    F  CKF++LPD+LT++ATG E+R
Sbjct: 127 EINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESR 186

Query: 221 SFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKN-FLSAGE 279
           SF S VCK G +P GV+SS  GWS EFL  IGL EL  + F RLGG+L +  + F SAGE
Sbjct: 187 SFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGE 246

Query: 280 CVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSA 339
            VG L   +A  LGLT  C+VGSG+IDAYAGWVGTV A P  A         E   +   
Sbjct: 247 PVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEEL 298

Query: 340 IGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTH 399
            GRLAAVAGTSTC I+LS+ P FV GVWGPYRDVLAR +W  EGGQSCTGALLAH + TH
Sbjct: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358

Query: 400 PAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADP 459
           PA+TEL Q A    ++ F+Y+N  L+ L  +   RS+ +LAKH F YGDYHGNRSP+ADP
Sbjct: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418

Query: 460 NMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNG 519
           +MRA ++G SMD S +DLA+  L A EFI+ Q R I++ M   G  +D +++SGGQ RN 
Sbjct: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478

Query: 520 LLMRLLADCTGLPIMIPRYI 539
           LL +LLAD    P++ PR++
Sbjct: 479 LLTQLLADAVRRPVVTPRHV 498

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 665 LWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717
           LW++M  LT    VV+P+    PD  LL+ KY++FL+MAE Q+ YR +VD VE
Sbjct: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  202 bits (513), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 150/497 (30%), Positives = 231/497 (46%), Gaps = 77/497 (15%)

Query: 45  VGVDVGTGSTRACIIDQFGKIL-SLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAV-- 101
           +G+D+G+ S R  I D +  +L ++A++P+      S    + S + W      +KA+  
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSS----KKSWKFWQKSTEIIKALQN 64

Query: 102 -LQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
             QE ++    V   G  ATCSL +    DL    + P    N+ N+I WMD  A+ E E
Sbjct: 65  CFQELKITQYNVRSCGVSATCSLAIFQK-DLTNGNLIP--YPNEDNVIFWMDSSAVDECE 121

Query: 161 EINSTGDKC----LKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATG 216
            +N   +KC    L Y+GG+   EM IPK+K+  N       K    F+L  Y+ ++   
Sbjct: 122 WLN---EKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGR 178

Query: 217 KENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLS 276
               +      ++     G +    GWS  F N I                       L 
Sbjct: 179 LYRWNTDELSARENINGIGNDGEASGWSSSFYNDIMK---------------------LP 217

Query: 277 AGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDI 336
           +   +G   +NS      T  C      ID+YA W    +       P L          
Sbjct: 218 SNVTIGLTGLNSNNSSSTTTVC----SCIDSYASWFAVSS-------PNLE--------- 257

Query: 337 NSAIGRLAAVAGTSTCHILLSKDPIF---VHGVWGPYRDVLARN--FWTAEGGQSCTGAL 391
                 L  +AGTSTC++  S  P+    + GVWGP+  +L  N  +     GQSCTG L
Sbjct: 258 ----ASLFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGKL 311

Query: 392 LAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHG 451
           + H+ K+HPA  ++ +  +     I+E L + ++  ++K+N +S+  LAKH FFYGDY G
Sbjct: 312 IEHLFKSHPAARKIQRSGE----DIYEVLENSIQD-IEKKNRKSIHILAKHMFFYGDYEG 366

Query: 452 NRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAM--LENGHRIDAI 509
           NR+P AD  MR   IG+S D S+ +L   Y+   EF+S QT+ II+      +G RI+ +
Sbjct: 367 NRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEEL 426

Query: 510 FMSGGQCRNGLLMRLLA 526
            +SG Q +NG L+ L++
Sbjct: 427 RVSGSQAKNGRLLSLIS 443

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%)

Query: 691 LLDTKYQIFLDMAENQRKYRNMVD 714
           LL  KY+I LDMA+ Q++Y  +VD
Sbjct: 513 LLSVKYRIHLDMAKQQQQYHRLVD 536

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  183 bits (464), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 144/493 (29%), Positives = 226/493 (45%), Gaps = 69/493 (13%)

Query: 45  VGVDVGTGSTRACIID-QFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAV-- 101
           +G+DVG+ S R  I + +   +L +A++P+   +  S    ++S + W      +KA+  
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSS----RTSWKFWQRSTEIIKALQK 89

Query: 102 -LQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
            LQ+ ++    V   G  ATCSL +       G  +   + N D N+I WMD  A+ E +
Sbjct: 90  CLQKLKITEYNVKSCGVSATCSLAIFEKDKRNGSLI--PYPNED-NVIFWMDSSAIDECK 146

Query: 161 EINS-TGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKEN 219
           ++N+    + L ++GG    EM IPK+K+  N       K    F+L  Y+ ++ +    
Sbjct: 147 QLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLYQ 206

Query: 220 RSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGE 279
            +    + ++     GV+    GWS  F  +I                       L +  
Sbjct: 207 WNNEVLLKRENNKMVGVDGEASGWSPSFYENI---------------------MHLPSNV 245

Query: 280 CVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSA 339
            +G    N A    +    IV S  ID+YA W    +       P L  +          
Sbjct: 246 IIG---SNGATCKKIASSAIVRS-CIDSYASWFAVSS-------PHLETS---------- 284

Query: 340 IGRLAAVAGTSTCHILLSK-DPIFVHGVWGPYRDVLARN--FWTAEGGQSCTGALLAHVI 396
              L  +AGTSTC++  +    I + GVWGP+  +L  N  F     GQSCTG L+ H+ 
Sbjct: 285 ---LFMIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLIEHLF 341

Query: 397 KTHPAFTE-LSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSP 455
            THP   E L + AD     I++ L   +   ++K+N +SV    K  FFYGDY GNR+P
Sbjct: 342 VTHPCAKEILKRGAD-----IYQVLERTIHD-IEKQNGQSVHVFTKDIFFYGDYEGNRTP 395

Query: 456 IADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLEN--GHRIDAIFMSG 513
            ADP M+   IG++ D S+ +L   Y+   EF+S QTR II+       G  I  + +SG
Sbjct: 396 FADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELRISG 455

Query: 514 GQCRNGLLMRLLA 526
            Q +N  L+ L++
Sbjct: 456 SQAKNKRLLSLIS 468

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 689 RILLDTKYQIFLDMAENQRKYRNMVDRV 716
           R LL  KY+I LDMA+ Q++Y  ++D V
Sbjct: 536 RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  174 bits (442), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 150/510 (29%), Positives = 233/510 (45%), Gaps = 80/510 (15%)

Query: 45  VGVDVGTGSTRACIIDQFG-KILSLAEKPIKREE---VRSNFITQSSKEIWDAVCHCVKA 100
           +G+D+G+ S R  I   +   +L +A++P+   +    +S    Q S EI +A+  C   
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKC--- 65

Query: 101 VLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
             Q+ ++    V   G  ATCSL +         A+ P    N+ N+I WMD  A  E E
Sbjct: 66  -FQKLKITEYNVKSCGVSATCSLAIFERVHTSE-ALIP--YPNENNVIFWMDSSATDECE 121

Query: 161 EINSTGDK-CLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKEN 219
            +N+   K  L Y+GG+   EM IPK+K+  N       K    F+L  Y+ ++      
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYEL----G 177

Query: 220 RSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGE 279
           R +   +   G L             E +N IG      ND E  G S    KN ++   
Sbjct: 178 RLYQWNI--DGLLRG-----------ENINGIG------NDGEASGWSSSFYKNIMNIPS 218

Query: 280 CVGFLDVNSACELGLTQHCIVGSGI----IDAYAGWVGTVAAKPSSAIPGLSENEHEKND 335
            V    V      GL    ++ + +    ID+YA W    A  P    P L  +      
Sbjct: 219 NVIIGPV------GLVSKKVISTTVVRSCIDSYASWF---AVSP----PFLERS------ 259

Query: 336 INSAIGRLAAVAGTSTCHILLSKDPIF---VHGVWGPYRDVL--ARNFWTAEGGQSCTGA 390
                  L  +AGTS+C+  +   P+    + GVWGP+ ++L    +F     GQSCTG 
Sbjct: 260 -------LFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGK 310

Query: 391 LLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYH 450
           L+ H+ ++HP   ++ +    +   I++ L   +   ++K+   S+  LAK  FFYGDY 
Sbjct: 311 LIEHLFESHPCARKILK----SGADIYQVLEQTIHG-IEKKKGLSIHILAKDMFFYGDYE 365

Query: 451 GNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGH--RIDA 508
           GNR+P ADP M+   IG++ D S+ +L   Y+   EF+S QT+ II+         RI  
Sbjct: 366 GNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQE 425

Query: 509 IFMSGGQCRNGLLMRLLADC-TGLPIMIPR 537
           + +SG Q RN  L+ L++    G+ I  PR
Sbjct: 426 LRISGSQARNERLLSLISLVNNGMSINRPR 455

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  172 bits (435), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 230/504 (45%), Gaps = 68/504 (13%)

Query: 45  VGVDVGTGSTRACIIDQFG-KILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAV-- 101
           +G+DVG+ S R  + + +   +L +A++P+   +  S    + S + W      +KA+  
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSS----KKSWKFWQKSTEIIKALQK 64

Query: 102 -LQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
            LQ+  +   +V   G  ATCSL +        + +      N+ N+I WMD  A+ E +
Sbjct: 65  CLQKLNIREYEVKSCGVSATCSLAIFERDRTSNMLIPYP---NEDNVIFWMDSSAVNECQ 121

Query: 161 EIN-STGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKEN 219
            +N     + L Y+GG+   EM +PK+K+  +       K    F+L  Y+ ++ +    
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYE 181

Query: 220 RSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGE 279
            +    + ++     G +    GWS  F  +I    L +N               +S G 
Sbjct: 182 WNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI--INLPSN---------------VSIGT 224

Query: 280 CVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSA 339
               L  N      + + CI      D+YA W          A P L  +          
Sbjct: 225 TS--LVANKHISTTVVRSCI------DSYASWFAV-------ASPHLETS---------- 259

Query: 340 IGRLAAVAGTSTCHIL-LSKDPIFVHGVWGPYRDVLAR--NFWTAEGGQSCTGALLAHVI 396
              L  +AGTS+C++   +     + GVWGP+  +L    +F     GQSCTG L+ H+ 
Sbjct: 260 ---LFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEHLF 316

Query: 397 KTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPI 456
           ++HP   ++  L D A I  ++ L   +   ++K N  S+  L K  FFYGDY GNR+P 
Sbjct: 317 ESHPCARKI--LKDGADI--YQVLEQTIRD-IEKNNGLSIHILTKDMFFYGDYEGNRTPF 371

Query: 457 ADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAML-ENGH-RIDAIFMSGG 514
           ADP ++   IG+S D S+ +L   Y+   EF+S QT+ II+    EN +  I  + +SG 
Sbjct: 372 ADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRISGS 431

Query: 515 QCRNGLLMRLLADC-TGLPIMIPR 537
           Q +N  L+ L++    G+ I+ P+
Sbjct: 432 QAKNERLLSLISLVNNGVAIIKPK 455

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 689 RILLDTKYQIFLDMAENQRKYRNMVDRV 716
           R LL  KY I LDMA+ Q++Y  +VD V
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  167 bits (424), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 136/490 (27%), Positives = 222/490 (45%), Gaps = 68/490 (13%)

Query: 45  VGVDVGTGSTRACIID-QFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQ 103
           +G+D+G+ + R  I D +  K++ +  KP+       N +TQSS +I  A+  C+    Q
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCI----Q 66

Query: 104 ESEVDPKKVHGIGFDATCSLVVVSA--TDLKGIAVGPDFSNNDQNIILWMDHRAMKETEE 161
           +   D K V   G  ATCSL V +    DLK + +         N++ WMD  A  E E 
Sbjct: 67  DLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 162 INSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRS 221
           +N T  +  +++GG    EM IPK+  +    EAE  K  + F+L  Y+ ++   K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAEGHK-LEVFDLHSYIAYELAIKYGWD 185

Query: 222 FASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECV 281
            +  + K      G +    GW   F N          D  +L  +++           +
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFYN----------DVLKLPANVK-----------I 224

Query: 282 GFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIG 341
           G +   +      T+  +  +  ID Y+ W    ++ P+++                   
Sbjct: 225 GPIHALN------TESPVRVASCIDCYSNWFSMCSSSPNNS------------------- 259

Query: 342 RLAAVAGTSTCHILL-SKDPIFVHGVWGPYRDVL----ARNFWTAEGGQSCTGALLAHVI 396
            L   AGTSTC++   +++   + GVWGP+ ++L    A+ +   E GQS TG L+ H+ 
Sbjct: 260 -LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLF 318

Query: 397 KTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPI 456
           +THPA    S   D + +  F  + S +E L Q   E SV   +KH F YG+  GNR+P 
Sbjct: 319 ETHPAARAYSM--DKSKL--FSAIESAIEKLEQDFGE-SVHFRSKHMFTYGELQGNRTPY 373

Query: 457 ADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQC 516
            D +M    IG++ D S +DL + Y+   EF++ Q + I E        I  I ++G Q 
Sbjct: 374 CDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EIKDIRIAGSQA 430

Query: 517 RNGLLMRLLA 526
           +N  L+ L +
Sbjct: 431 KNTRLLTLFS 440

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 674 GEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRV 716
           G  K+ N N K    + LL+ KY+I+LDMA+ Q +YR MVD V
Sbjct: 494 GPMKLGNHNTKL---KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  164 bits (415), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 131/473 (27%), Positives = 206/473 (43%), Gaps = 88/473 (18%)

Query: 45  VGVDVGTGSTRACIID-QFGKILSLAEK--PIKREEVRSNF-ITQSSKEIWDAVCHCVKA 100
           +G+D+G+ S R  + + Q  +I++   K  P       +N+  TQSS+EI  A+  C   
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQC--- 66

Query: 101 VLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
             QE  +D  ++   G  ATCSL +    D   I    D  + D+N++ WMD  A+KET+
Sbjct: 67  -FQELNIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSIAIKETQ 123

Query: 161 EINSTGDKCLK-YVGGQMSVEMDIPKIKW----LKNNLEAEIFKDCKFFNLPDYLTFKAT 215
           E+N      ++ ++GG    EM +PK++     LKN      F+     +L  Y+     
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMSLA 180

Query: 216 GKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFL 275
            +    + +          G +    GWS  F  ++                        
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV------------------------ 216

Query: 276 SAGECVGFLDVNSACELGLTQHC-------IVGSGIIDAYAGWVGTVAAKPSSAIPGLSE 328
                   L +     +G T+H        +  S  ID Y+ W         + +P   +
Sbjct: 217 --------LQLPPNIVIGPTKHSQHSSKQGLKVSSCIDCYSNWF--------ALLPSNLQ 260

Query: 329 NEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVH---GVWGPYRDVLARN--FWTAEG 383
           N             L  V GTSTC++  S +  F H   GVWGP+ ++  R+  F   E 
Sbjct: 261 NS------------LFIVGGTSTCYLYASSE--FSHHIPGVWGPFSNIFDRSDQFSIYEA 306

Query: 384 GQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHF 443
           GQSCTG L+ H+ KTHPA    S +       +F  +N  +E  V++  + S+    KH 
Sbjct: 307 GQSCTGKLIEHLFKTHPA---SSHIDTRDWPHLFSQINDFIEK-VEQNTQDSIHMQTKHM 362

Query: 444 FFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQII 496
           FFYGD  GNR+P ADP+M    IG++ D S  +L   Y+   EFI+ Q + ++
Sbjct: 363 FFYGDLDGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHML 415

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 691 LLDTKYQIFLDMAENQRKYRNMVDRV 716
           LL+ KYQI+ +MAE QRKYR  V+ V
Sbjct: 507 LLEVKYQIYFNMAEQQRKYRKQVNNV 532

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  162 bits (410), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 132/500 (26%), Positives = 212/500 (42%), Gaps = 80/500 (16%)

Query: 42  KFHVGVDVGTGSTRACIID-QFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKA 100
           +  +G+D+G+   R    + +  + +++  + +   E      TQSS EI  A+  C ++
Sbjct: 5   RIGLGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFES 64

Query: 101 VLQESEVDPKKVHGIGFDATCSLVVVSATDLKGI---AVGPDFSN-NDQNIILWMDHRAM 156
           +     +D   V   G  ATCSL V      KG+    V  D    NDQN++ WMD  A+
Sbjct: 65  L----NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAI 120

Query: 157 KETEEINSTGDKCLKYVGGQMSVEMDIPKIKWL-----KNNLEAEIFKDCKFFNLPDYLT 211
           +E   IN        Y GG    EM +PK+        KNN + E+F      +L  Y+ 
Sbjct: 121 EECSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNNSDFEVF------DLHTYVA 174

Query: 212 FKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK 271
           +    +     +  + +      G +    GW +EF                      +K
Sbjct: 175 YDLANRYGWDASFLINRPNHNGIGHDGEIKGWKDEFY---------------------EK 213

Query: 272 KNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEH 331
              L     +G L +N          CI      D Y+ W    ++ P  +         
Sbjct: 214 TLKLPPNVRIGPLCINRRFSPVKVASCI------DCYSSWFSMFSSTPERS--------- 258

Query: 332 EKNDINSAIGRLAAVAGTSTCHILLSKDPI-FVHGVWGPYRDVLARN---FWTA-EGGQS 386
                      L   AGTSTC++  +  P   + G+WGP+ D+L       W+  E GQS
Sbjct: 259 -----------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQS 307

Query: 387 CTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFY 446
            TG L+ H+ ++HPA     +  +     +F  L + +  L+++++  SV    KH F Y
Sbjct: 308 TTGKLIEHLFESHPAAKPYLEDRNV----LFNRLETEI-NLIEQQSAESVHFKTKHMFNY 362

Query: 447 GDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRI 506
           G+  GNR+P  DP M    IG+S D S  DL + Y+   EF++ Q R I E +   G  I
Sbjct: 363 GELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPI 419

Query: 507 DAIFMSGGQCRNGLLMRLLA 526
           + I ++G Q +N  L+ L++
Sbjct: 420 NDIRVAGSQAKNNRLLSLIS 439

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 689 RILLDTKYQIFLDMAENQRKYRNMVD 714
           R L + KY+I+L+MA+ QR+YR MV+
Sbjct: 505 RALFEIKYKIYLNMAQTQRQYREMVN 530

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/453 (26%), Positives = 205/453 (45%), Gaps = 64/453 (14%)

Query: 84  TQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNN 143
           TQS+ EI   +  C    L + ++D   +   G  ATCS+ +                ++
Sbjct: 49  TQSTDEIMKVIERC----LHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSH 104

Query: 144 DQNIILWMDHRAMKETEEINSTGDKCLK-YVGGQMSVEMDIPKIKWLKNNLEAEIFKDCK 202
            QN+I WMD+ +  E + +N+  +K L+ ++GG+   EM IPKI  L N L++    D +
Sbjct: 105 RQNVIFWMDNSSKTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSS--DDLQ 162

Query: 203 -----FFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELT 257
                  +L  YL ++   +   +F   +    F   G +    GWS +F   I   ++ 
Sbjct: 163 NLSVVAMDLHRYLAYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFY--IDTLKIP 220

Query: 258 TNDFERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAA 317
           +N               ++ G      D    C+ G+   CI      D Y+ W+   + 
Sbjct: 221 SN---------------ITIGPEPPLEDDFEYCK-GIVASCI------DCYSSWLSLCSP 258

Query: 318 KPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVL--A 375
            P  +                    L  V GTSTC++  +     + GVWGP+ D+L  +
Sbjct: 259 TPEES--------------------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNS 298

Query: 376 RNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERS 435
             +   EGGQSCTG L+ H+++THPA    S +A      + E +   + + ++++  RS
Sbjct: 299 NTYAVYEGGQSCTGKLIEHLLQTHPAS---SSIAKDDWPLLLEKIEQEI-SAIEEQTGRS 354

Query: 436 VVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQI 495
           +    KH FFYGD+ GNR+P ADP M    IG++ D S  +L + Y+   EF++ Q + +
Sbjct: 355 IHFKTKHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYM 414

Query: 496 IEAM--LENGHRIDAIFMSGGQCRNGLLMRLLA 526
           I      +   +I  I + G Q +N  L+ L++
Sbjct: 415 ISIFNKAQGQDKITEIRICGSQAKNKRLLSLIS 447

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 681 PNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRV 716
           P+    P  +LL+ KY+I LDMA+ Q  YR M++++
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  154 bits (388), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 137/509 (26%), Positives = 224/509 (44%), Gaps = 79/509 (15%)

Query: 45  VGVDVGTGSTRACIID-QFGKILSLAEKPIKREEV-RSNFITQSSKEIWDAVCHCVKAVL 102
           VGVD+G+ S R  I   +   +L + E+P++      S   TQS+ EI  A+  C    L
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQEC----L 68

Query: 103 QESEVDP--KKVHGIGFDATCSLVVVSATDLKGIAVGPDFS----NNDQNIILWMDHRAM 156
            E  + P  + +   G  ATCS+ V +     G     D S    ++D+N++ WMD  A 
Sbjct: 69  DELGLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVAS 128

Query: 157 KETEEINSTGDKCLKY-VGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKAT 215
           +  + ++      +K  + G    EM +PK+  L         +  + F+L  Y+ +   
Sbjct: 129 EACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPG---RSLEVFDLHKYIAYDLA 185

Query: 216 GKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFL 275
            +     A+   +      G +    GW +EF  ++                L+     L
Sbjct: 186 RRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV----------------LK-----L 224

Query: 276 SAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKND 335
            A   VG         +G+          ID YA W G  + +P  +             
Sbjct: 225 PATVAVGPASTFKGQRVGVAS-------CIDCYASWFGVCSTQPEQS------------- 264

Query: 336 INSAIGRLAAVAGTSTCHILLSK-DPIFVHGVWGPYRDVL----ARNFWTA-EGGQSCTG 389
                  L  VAGTSTC++  S      + G+WGP+ ++L    AR  W+  E GQS TG
Sbjct: 265 -------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEAR--WSVYEAGQSTTG 315

Query: 390 ALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDY 449
            LL H+ +THPA  + +      +  +F+ L   +  + +  +  S+  LA+H F YG+ 
Sbjct: 316 RLLEHLFETHPAARDYA----GDTGRLFKDLEDRIADM-EADSGCSIHHLARHMFLYGEL 370

Query: 450 HGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLEN-GHRIDA 508
            GNR+P ADP M    +G++ D S  +LA+ Y+   EF++ QTRQI+E         I  
Sbjct: 371 QGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGE 430

Query: 509 IFMSGGQCRNGLLMRLLADCTG-LPIMIP 536
           + ++G Q RN  L+ L++   G +P+ +P
Sbjct: 431 LRVAGSQARNRRLLSLMSLVNGNMPVRVP 459

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 689 RILLDTKYQIFLDMAENQRKYRNMVDRV 716
           R LL+ KY I LDMA+ Q++YR+ +D V
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEIDAV 544

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  150 bits (378), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 221/501 (44%), Gaps = 86/501 (17%)

Query: 45  VGVDVGTGSTRACIIDQFG-KILSLAEKPIKR--EEVRSNF--ITQSSKEIWDAVCHCVK 99
           +G+D+G+ S R  I       +L +  KP+    E  R++    TQ S EI  A+  C  
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWEYTQDSAEILTAIKEC-- 65

Query: 100 AVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKET 159
                +++    V   G  ATCSLV+   +   G         + +N++ WMD  A +ET
Sbjct: 66  --FDMADLQKYDVKSCGVAATCSLVLCERS---GDDTFQHCEGDSRNVVFWMDSMAKEET 120

Query: 160 EEINSTGDK-CLKYVGGQMSVEMDIPKI-KWLKN-------NLEAEIFKDCKF--FNLPD 208
             +N+   +  L ++GG    EM IPK+ ++LK+       N++ E+F   K+  + L  
Sbjct: 121 NSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYKLAQ 180

Query: 209 YLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSL 268
              +      N   ++ +   G L         GWS+ F + I    L  N       ++
Sbjct: 181 EYCWNTERLSNHPNSNGIGHDGELA--------GWSKSFYDKI--VRLPPNVTIGCPKTI 230

Query: 269 RDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSE 328
            ++ + +    C                        ID Y+ W         S +  L++
Sbjct: 231 ENEDSLVIVDSC------------------------IDCYSSWF--------SPLQSLNK 258

Query: 329 NEHEKNDINSAIGRLAAVAGTSTCHIL---LSKDPIFVHGVWGPYRDVLARNFWTAEGGQ 385
           N             L  VAGTSTC+I      K    V G+WGP+ D+L  N    E G 
Sbjct: 259 N------------TLFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGS 306

Query: 386 SCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFF 445
           SC+G L+ H+  +HP+   L+ L+    IS  E   ++ ET    +N  S+   A + F 
Sbjct: 307 SCSGKLIEHLFTSHPSAISLN-LSTGQLISKLEEEINIWET----QNATSIHFEACNNFL 361

Query: 446 YGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHR 505
           YGD  GNR+P  DP MR   IG+S D S  DL V Y+   E ++ QT+ +++   E  + 
Sbjct: 362 YGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDN-FEKLNS 420

Query: 506 IDAIFMSGGQCRNGLLMRLLA 526
           I+ +F+ G Q +N  L++L++
Sbjct: 421 INELFICGSQAKNTRLLKLIS 441

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 676 AKVVNPNDKTHPDRI--LLDTKYQIFLDMAENQRKYRNMVDR 715
            K  N +DK    ++  LL TKY I L+MAE Q+++R MV +
Sbjct: 491 VKYTNDSDKIQQTKLYKLLLTKYIIHLEMAEQQQRFRKMVSK 532

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  122 bits (307), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 125/499 (25%), Positives = 212/499 (42%), Gaps = 87/499 (17%)

Query: 45  VGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVR--SNFITQSSKEIWDAVCHCVKAVL 102
           +GVD+G+   R  I D +   L + E   K    R  +  ITQ + +I  AV    +   
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSL-VKETKEKVPYFRHGNGIITQCTSDILTAV----EKAF 60

Query: 103 QESEVDPKKVHGIGFDATCSLVVVSATD--LKGIAVGPDFSNNDQNIILWMDHRAMKETE 160
               +    +  +G  ATCS+VV    D  L    +  D +    +II WM   A++ETE
Sbjct: 61  NTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEETE 120

Query: 161 EINSTGDK-CLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKD--CKFFNLPDYLTFKATGK 217
            +N+  D+  L + GG+   EM IPK+  L      +++KD      +L  +L +K + K
Sbjct: 121 YLNNITDESILCHFGGKFFPEMAIPKLLHLN-----KLYKDDGLTVLDLHIWLLWKISLK 175

Query: 218 ENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSA 277
                   V +      G +    GWS+EF   + L+++       +G +   KKN    
Sbjct: 176 LGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIF------IGNNAVIKKNEQFG 229

Query: 278 GECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDIN 337
             C                        ID YA W    +                     
Sbjct: 230 DSC------------------------IDCYASWFQCWST-------------------- 245

Query: 338 SAIGR-LAAVAGTSTCHILLSKDPI--FVHGVWGPYRDVLAR--------NFWTAEGGQS 386
           + + R L  VAGTSTC  L + D    F+ G+WGP++D+L          N+   E G S
Sbjct: 246 AMLNRTLFVVAGTSTC-FLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGIS 304

Query: 387 CTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFY 446
            TG LL  ++ THPA  +       + ++  E +   ++ L+++ + +S+  + K+ FF+
Sbjct: 305 RTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFFH 356

Query: 447 GDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRI 506
            DY    S     +    I+ +  + +++DLA+ Y+   E ++ Q   +I A  E    I
Sbjct: 357 EDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITI 416

Query: 507 DAIFMSGGQCRNGLLMRLL 525
             + ++G Q +N  L+++L
Sbjct: 417 SKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 114/516 (22%), Positives = 201/516 (38%), Gaps = 92/516 (17%)

Query: 45  VGVDVGTGSTRACII--DQFGKILSLAEKPIKREEVRSNF--ITQSSKEIWDAVCHCVKA 100
           +G+DVG+ S R  I   +    I ++ ++ + + E  S     TQ++  + D++      
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIF----T 60

Query: 101 VLQESEVDPKKVHGIGFDATCSLVVVS----ATDLKGIAVGPDFSNNDQNIILWMDHRAM 156
            L+E  V+   V   G  ATCS+V +     A  L+ + +  + +NN  +II W DH A 
Sbjct: 61  ALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 157 KETEEINS-----------TGDKCLKYVGGQMSV--EMDIPKIKWLKNNLEAEIFKDCKF 203
            E + +N+             +K L  +G +     EM IPK+  L N ++   ++    
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 204 FNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGL-SELTTNDFE 262
             + D   + A     +   + V  Q              ++  +N IG+  EL   D  
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTVHLQ--------------NKPNVNGIGIDGELQGWDLS 226

Query: 263 RLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSA 322
               +L +     S   C+G   V +   +   + C      ID YA W  T A      
Sbjct: 227 FYVWALPET----SFPICIGPSKVINETSIVRPKSC------IDCYASWFSTDACT---- 272

Query: 323 IPGLSENEHEKNDINSAIGRLAAVAGTSTCHIL-LSKDPIFVHG--------VWGPYRDV 373
                     K+D       L   AGTSTC +  + +  +   G         WGP+ +V
Sbjct: 273 ----------KDD------TLFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWGPFTNV 316

Query: 374 LARNFWTA-EGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETL-VQKR 431
           L ++  ++ E G S TG LL  +   H            AS S+ E +N +   + + +R
Sbjct: 317 LDKDKKSSFEIGFSETGILLEKLFNKHQI---------TASWSVAESINYVENQIAIYER 367

Query: 432 NERSVVSLAKHFFFYGDYHGNRSPIA--DPNMRACIIGQSMDNSVEDLAVTYLGACEFIS 489
            +   + L    + +  Y     P     P+         + +S   L   Y+   E+++
Sbjct: 368 KKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAILEYLA 427

Query: 490 QQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLL 525
            Q   +I    +    I+ + +SG Q +N  L+ L+
Sbjct: 428 YQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 445 FYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAM----L 500
           F   ++G  +P  DP+ RA I+G S   +   +A     A E +  Q R I++AM    +
Sbjct: 612 FVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMSGDKI 668

Query: 501 ENGHR---IDAIFMSGGQCRNGLLMRLLADCTGLPIMIPR 537
           E+G+    +  + + GG  ++  +M++ AD  G  I + R
Sbjct: 669 EDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRR 708

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 12/102 (11%)

Query: 445 FYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGH 504
           F   ++G  +P  DP+ RA I+G S   +   +A     A E +  Q R I++AM  +  
Sbjct: 505 FVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMGSDEV 561

Query: 505 RIDAIF---------MSGGQCRNGLLMRLLADCTGLPIMIPR 537
             D+ +         + GG  ++  +M++ AD  G  I + R
Sbjct: 562 YGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRR 603

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query: 445 FYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAM----- 499
           F   + G  +P  DPN RA I+G S   +   +A     A E +  Q R I++AM     
Sbjct: 468 FVPAFSGLFAPYWDPNARASIMGMSQYTTAAHIA---RAAVEGVCFQARAILKAMSSDVL 524

Query: 500 -----LENGHR---IDAIFMSGGQCRNGLLMRLLADCTGLPIMIPR 537
                 E+ +    +  + + GG  R+  +M++ A+  G  + + R
Sbjct: 525 QESGDFEDTYEKSALSTLAVDGGMSRSDEVMQIQANILGPCVKVRR 570

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
           (PDR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
           FULL
          Length = 924

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 400 PAFTELSQLADAASISIFEYLNSMLETLVQKRNE-RSVVSLAKHFFFYGDYH 450
           P   +L ++ +A SI  FEYLN  + T V   +   S++ L KH ++ G+YH
Sbjct: 382 PFVKDLIRIKEAISILSFEYLNLTMHTPVGDLDFFESLLILIKHQYWIGEYH 433

>SAKL0H12936g Chr8 (1107451..1111404) [3954 bp, 1317 aa] {ON} weakly
           similar to uniprot|P14737 Saccharomyces cerevisiae
           YDR217C RAD9 DNA damage-dependent checkpoint protein
           required for cell-cycle arrest in G1/S intra-S and G2/M
           transmits checkpoint signal by activating Rad53p and
           Chk1p hyperphosphorylated by Mec1p and Tel1p potential
           Cdc28p substrate
          Length = 1317

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 3   VYKYKELQNKMPLKNASYSGQLPSQNKLLPQTSLQDSQEKFH 44
           ++ Y +     PLK+   +GQ P+ N+LLP T+  D Q+  H
Sbjct: 227 LHAYNDFVENTPLKSNVLNGQGPNGNRLLPSTATTDGQDIQH 268

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,107,264
Number of extensions: 3228306
Number of successful extensions: 9077
Number of sequences better than 10.0: 46
Number of HSP's gapped: 9250
Number of HSP's successfully gapped: 75
Length of query: 725
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 608
Effective length of database: 40,065,477
Effective search space: 24359810016
Effective search space used: 24359810016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)