Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2688.255ON69569536720.0
YDR108W (TRS85)8.255ON69869732480.0
Skud_4.3698.255ON69869832410.0
Smik_4.3548.255ON69869731840.0
NCAS0B038808.255ON70670523880.0
NDAI0J014108.255ON71669922930.0
ZYRO0C01826g8.255ON69969622850.0
TDEL0F038208.255ON68767822570.0
CAGL0B01705g8.255ON67267022390.0
Kpol_392.118.255ON67567721620.0
KAFR0B055708.255ON66968020730.0
TPHA0B032608.255ON71472020250.0
KLTH0G13860g8.255ON70873018800.0
Kwal_56.235838.255ON70071618670.0
SAKL0H17226g8.255ON71974318330.0
KNAG0H032708.255ON64870916370.0
TBLA0E043808.255ON88964115170.0
AGR096C8.255ON62368312981e-171
Ecym_43168.255ON62368312981e-171
KLLA0F18953g8.255ON64766011551e-149
TPHA0B019004.296ON187346752.5
NDAI0E010108.709ON573104733.6
Smik_15.803.126ON1176101733.8
CAGL0H00594g6.291ON45391716.0
NDAI0D025605.94ON129452716.1
KAFR0A063804.173ON187773726.2
TDEL0D024201.371ON479107716.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.268
         (695 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...  1419   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...  1255   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...  1253   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...  1231   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   924   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   887   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   884   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   874   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   867   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   837   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   803   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   784   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   728   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   723   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   710   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   635   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   588   0.0  
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   504   e-171
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   504   e-171
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   449   e-149
TPHA0B01900 Chr2 complement(421833..427454) [5622 bp, 1873 aa] {...    33   2.5  
NDAI0E01010 Chr5 complement(203904..205625) [1722 bp, 573 aa] {O...    33   3.6  
Smik_15.80 Chr15 (146001..149531) [3531 bp, 1176 aa] {ON} YOL078...    33   3.8  
CAGL0H00594g Chr8 (57283..58644) [1362 bp, 453 aa] {ON} weakly s...    32   6.0  
NDAI0D02560 Chr4 (589972..593856) [3885 bp, 1294 aa] {ON} Anc_5....    32   6.1  
KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa]...    32   6.2  
TDEL0D02420 Chr4 (471383..472822) [1440 bp, 479 aa] {ON} Anc_1.3...    32   6.5  

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score = 1419 bits (3672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/695 (98%), Positives = 684/695 (98%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120
           YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120

Query: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK 180
           QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK
Sbjct: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK 180

Query: 181 KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE 240
           KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE
Sbjct: 181 KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE 240

Query: 241 SFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVEN 300
           SFPIFMNTNEMLPVFLLCYNDESQEEFEKC           FVESILLPLWKDSFVDVEN
Sbjct: 241 SFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVEN 300

Query: 301 SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360
           SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE
Sbjct: 301 SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360

Query: 361 ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW 420
           ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW
Sbjct: 361 ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW 420

Query: 421 SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI 480
           SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI
Sbjct: 421 SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI 480

Query: 481 ERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQ 540
           ERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQ
Sbjct: 481 ERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQ 540

Query: 541 YLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDT 600
           YLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDT
Sbjct: 541 YLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDT 600

Query: 601 DHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNG 660
           DHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNG
Sbjct: 601 DHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNG 660

Query: 661 LILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYIE 695
           LILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYIE
Sbjct: 661 LILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYIE 695

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score = 1255 bits (3248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/697 (86%), Positives = 639/697 (91%), Gaps = 3/697 (0%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           MVFSYEHYMNLLFHLD+S+ETVPPEIAKRI+SNAIAPVITVTSTPLFDKHIQE Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQ---NASPSIESSSKNQNLGVPSALKRGSRSRSN 117
           YMLLRFFGGCVSDRDQANE K  Q E    +AS S +S  KN+NL VP+  K+GSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 118 SLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177
           SLFQRDSTQSQY+RFTRPLGDLIETRD NDMLFNYHSLEVFLDNYLKLVA NTDE VPH+
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180

Query: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS GEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 238 NTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVD 297
           NTE+FPIFMNTNEMLPVFLLCYND+SQEEFEKC           FVESILL LWKDSF+ 
Sbjct: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIY 300

Query: 298 VENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKIS 357
            ENS IQLHQPVMSSLEEILFFL+APTQT LSL LINSIYDMLDYLVYDLMIPFMKRK+S
Sbjct: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 358 FWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKL 417
           FWEETILQPRKSLFNGAKFFKKFMNK PVNGNHQHNSLT+D+QGNEYFASSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420

Query: 418 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 477
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 478 PLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY 537
           PLIERALATYENCSR+QR   KE  S  V EPVRSYETRCMILASELFLSLS+TWTSTPY
Sbjct: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540

Query: 538 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDE 597
           AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPR+KH+VG MKK  K+TEDLR + +
Sbjct: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600

Query: 598 YDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657
           Y TDHFT+EDILSEGLTRRRKAAFFRL+AAKKWAEQKQWRQVSWCLKDIE+TYS+I FLH
Sbjct: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660

Query: 658 GNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYI 694
           GNGLILS LKNQLN KDVDSAP P+EKN T+TS+++I
Sbjct: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFI 697

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1253 bits (3241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/698 (86%), Positives = 642/698 (91%), Gaps = 3/698 (0%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           MVFSYEHYMNLLFHLD+S E VPPEIAKRIVSNAIAPVITVTSTPLFDKHIQE Y+VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKF---EQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSN 117
           YMLLRFFGGCVSDRDQANEGK    E +  + S S+ES SKNQNLGVP+ALK+GSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 118 SLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177
           SLFQRDSTQSQY+RFTRPLGDLIETRDTNDMLFNYHSLEV+LDNYLKLV  NT+E  PHD
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS GEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 238 NTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVD 297
           NTE+FPIFMNTNEMLPVFL+CYNDESQEEFEKC           FVESI LPLWK+SF+D
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 298 VENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKIS 357
            ENS+I+LHQPVMSSLEEILFFL+APTQT LSLPLINSIYD+LDYLVYDLMIPFMKRK+S
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 358 FWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKL 417
           FWEETILQPRKSLFNGAKFFKKFMNK P NG+HQHNSLT+D QGNEYF+SSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 418 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 477
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 478 PLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY 537
           PLIERALATYE CS++QR   KEL+SS V EPVRSYETRCMILASELFLSLSDTWTSTPY
Sbjct: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540

Query: 538 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDE 597
           AIQYLETILDECKLGPCSQIM+WERLSDCYNLRVDPR+KH+VG MKKS K TEDLRN DE
Sbjct: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600

Query: 598 YDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657
           + TDHF EEDILSEGLTRRRKAAFFRL+AAKKWAEQK WRQVSWCLKDIE+TYS+I FLH
Sbjct: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660

Query: 658 GNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYIE 695
            N  ILS LK+QLN KD+DSAP PTEKNPT TSIN+IE
Sbjct: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFIE 698

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1231 bits (3184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/697 (85%), Positives = 638/697 (91%), Gaps = 3/697 (0%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           MVFSYEHYMNLLFHLD+S+ETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAY VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQ---NASPSIESSSKNQNLGVPSALKRGSRSRSN 117
           YMLLRFFGGCVSDRDQANE K  QDE    + + S+ES SK++NL VP+  K+GSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 118 SLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177
           SLFQRDSTQSQY+RFTRPL DLIETRDTNDMLFNYHSLEVFLDNYLKLVA NTDE VPHD
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180

Query: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS GEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 238 NTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVD 297
           NTE+FP+FMNTNEMLPVFLLCYNDESQEEFEKC           FVES+LL LWKDSF++
Sbjct: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIE 300

Query: 298 VENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKIS 357
             NS IQLHQPVMSSLEEILFFL+APTQT LSLPLINSIYDMLDYLVYDLMIPFMKRK+S
Sbjct: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 358 FWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKL 417
           FWEETILQPRKSLFNGAKFFKKFMNK P NGNH HNSLT DNQGNEYFASSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 418 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 477
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQ IVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 478 PLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY 537
           PLIE+ALATYENCS++QR  S++ +SS  +EPVRSYETRCMILASELFLSLSD WTSTPY
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540

Query: 538 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDE 597
           AIQYLETILDECKLGPC QIM+WERLSDCY+LRVDPR+KH+VG MKK +++TEDLR  D 
Sbjct: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600

Query: 598 YDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657
             TDHFT++DILSEGLTR+RKAAFFRL+AA+KWAEQKQWRQVSWCLKDIE+ YSDI FL+
Sbjct: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660

Query: 658 GNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYI 694
           G+GLILS L NQLN KD++SAP+PTEKNPT TS+++I
Sbjct: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFI 697

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/705 (64%), Positives = 538/705 (76%), Gaps = 31/705 (4%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           M FSYEHYMNLLFHLD+ +ETVP EIAKRIVSNAI+PVI VTST   D HI E Y++DSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120
           YMLLRFF GCVSDRDQANE   E+ +++   S  + +      +P    RG RSRSNSLF
Sbjct: 61  YMLLRFFSGCVSDRDQANE--LEKSQKDKISSNNTLTLPTTSPLPKVRTRG-RSRSNSLF 117

Query: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK 180
           QRDSTQSQY+RFT+PLGD+I T++ NDMLF+YHSLE++L NYL L+  NTD+  P++LLK
Sbjct: 118 QRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLK 177

Query: 181 KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE 240
           KSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN +T 
Sbjct: 178 KSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH 237

Query: 241 SFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVEN 300
           +FPIFMNTN+MLPV LLCY+D+  E+FE C           FVE I LPLWKDS+    +
Sbjct: 238 NFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYP--SD 295

Query: 301 SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360
             + LHQPVMSSLEE+++FL  P +  L   LI SIY++LD LVY+LMIPFMKRKI+FW+
Sbjct: 296 PQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWD 355

Query: 361 ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW 420
           ETILQPRKSLF+GAKF KKFM K  +   HQ N LTKD QGNEYF S+SSEFLMRKLADW
Sbjct: 356 ETILQPRKSLFHGAKFLKKFMTKTALT--HQENLLTKDAQGNEYFTSASSEFLMRKLADW 413

Query: 421 SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI 480
           SMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ+IVTVKM+KNDINPLI
Sbjct: 414 SMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLI 473

Query: 481 ERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQ 540
           E+AL+TYENC+ +     K  T   ++ PVRSYETRCMILASELFLSLSDTWTSTPYAI 
Sbjct: 474 EKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAIS 533

Query: 541 YLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGG------------------- 581
           YLETIL ECKLG CSQIM+WERLSDCY LRVDPR+KHK  G                   
Sbjct: 534 YLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGH 593

Query: 582 -MKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVS 640
            M  S    ED+ ND   DTD    +DI+S+G TR+RKAAFFRLMAAKKWAEQK+WRQVS
Sbjct: 594 VMTPSPLTKEDVSNDANNDTD----QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVS 649

Query: 641 WCLKDIENTYSDIDFLHGNGLILSNLKNQLNSKDVDSAPTPTEKN 685
           WCL+ I++TYS I     + LIL  ++N+L + + ++     EKN
Sbjct: 650 WCLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKN 694

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/699 (63%), Positives = 543/699 (77%), Gaps = 37/699 (5%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           MVFSYEHYMNLLFHLDH++E+VPPEIAKRIVSNAIAPVITVTSTP  D HIQE Y++DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANE--GKFEQDEQNAS-PSIESSSKNQNLGVPSALK------RG 111
           YMLLR+FGGCVSDRDQANE  GK E D  + + PS   SS    L VPS  +      R 
Sbjct: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSS----LIVPSGQQQPPLKARR 116

Query: 112 SRSRSNSLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTD 171
            RSRSNSLFQRDSTQSQY+RFT+P+ D++  + +NDMLF+YHSLE++L+ YL+L+A NT+
Sbjct: 117 GRSRSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTN 176

Query: 172 EKVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVN 231
              P++LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV 
Sbjct: 177 NSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVE 236

Query: 232 FKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLW 291
           FKNLN  T +FPIFMNTN+MLP+FLLCY+   QE+FE C           FVES++LPLW
Sbjct: 237 FKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLW 296

Query: 292 KDSF-VDVENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIP 350
            + + +D++   + LHQP+MSSLEE+++FL+ P   KLS+ LINSIY++LD L+YDLM+P
Sbjct: 297 NEQYEIDIK---VDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLP 353

Query: 351 FMKRKISFWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSS 410
           FMKRK+ FWEETILQPR+SLF+GAKF KKFM K   N   Q N LTKD++GNEYFA SS+
Sbjct: 354 FMKRKLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSST 411

Query: 411 EFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVK 470
           E LMRKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQSIVTVK
Sbjct: 412 ELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVK 471

Query: 471 MIKNDINPLIERALATYENCS-RMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLS 529
           MIKNDINPLIERAL TYENC+  + +  + ++ +   +EP+RSYETRCMIL SELFLSLS
Sbjct: 472 MIKNDINPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLS 531

Query: 530 DTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKK----- 584
           DTWTSTPYAI YLETIL ECKLGPCSQI +WERLSDCY LR+DPR+++K+          
Sbjct: 532 DTWTSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTV 591

Query: 585 ------------SVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAE 632
                       S    + ++ + + ++   + ++ILS+G TRRRK+AFFRL+AAKKWAE
Sbjct: 592 TTTTADKVVATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAE 651

Query: 633 QKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLN 671
           QKQWRQV+WCLKD+E+ Y   D    + LI++ L+N L+
Sbjct: 652 QKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/696 (63%), Positives = 535/696 (76%), Gaps = 41/696 (5%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           M  SYE+YMNLLFHLDH +ETVPP+IA+RIVSNA++PVITV+STP  D+HI++ Y +DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGK----FEQDEQNASPS------IESSSKNQNLGVPSALKR 110
           YM LRFFG CVSDRDQANE +     E+ E  A P       IE+S K+ +L VPS    
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKS-SLKVPSTSSD 119

Query: 111 GS-------------RSRSNSLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEV 157
                          R RSNSLFQRD TQSQYVRFTRP+ DLIE+ D+NDMLF+YHSLEV
Sbjct: 120 TKNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEV 179

Query: 158 FLDNYLKLVAGNTDEKVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS 217
           FL+N L+LV   TD+  P +LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS
Sbjct: 180 FLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDIS 239

Query: 218 YGEVYEDARDLLVNFKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXX 277
            G+ YE+ARDLL+ FKNLNH  E+FPIFM+T ++LPVFLLCYNDES++E   C       
Sbjct: 240 AGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQL 299

Query: 278 XXXXFVESILLPLWKDSFVDVENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIY 337
               FVES+LLPLWK S+ D  +  ++LHQP+MSSLEE+L+FL++PT T+L L LIN  Y
Sbjct: 300 KKQLFVESLLLPLWKRSYSD--HGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTY 357

Query: 338 DMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGAKFFKKFMNKAPVNG--NHQHNSL 395
           ++L+ LV DLM+PFMKRKISFWEETILQPRKSLF+GA FFKK M+K   NG  NHQ  SL
Sbjct: 358 NILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNS-NGSNNHQPISL 416

Query: 396 TKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWC 455
            KD  GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWC
Sbjct: 417 GKDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWC 476

Query: 456 AVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYET 515
           AVS+LMGAQ+IVTVKMIKNDI+PLI+RAL TYENC+  +    +EL       PVRSYET
Sbjct: 477 AVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYV-----PVRSYET 531

Query: 516 RCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRV 575
           RCM LASELFLSLSDTWTSTPYA+  LETIL EC+LGPCS+IM+WERLSDCY  R+DPR+
Sbjct: 532 RCMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRI 591

Query: 576 KHKVGGMKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQ 635
           +HK    + +   T++L  D+E      + E+I++ GLTR+RKAAFFRL+AA KW EQKQ
Sbjct: 592 RHKTSA-QGAKAMTDELAPDEE------SNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQ 644

Query: 636 WRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLN 671
           W+Q  WCLK+IE  Y+ +DF++   LIL+ LK Q+N
Sbjct: 645 WKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/678 (62%), Positives = 526/678 (77%), Gaps = 16/678 (2%)

Query: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62
            SYE+YMNLL HLDH  + VP +IAKRIVSNAI+PVI VTSTP  D+HIQE + +DSLYM
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQR 122
           LLRFFG CV DRDQA+E          SPS +  ++  +    +     SR RSNSLFQR
Sbjct: 64  LLRFFGDCVGDRDQAHECT-----SAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQR 118

Query: 123 DSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKKS 182
           D+TQSQY+RFTRPL DL+E+ DTNDMLF+YH+LE FL+N L L+  +T++K PH LLKKS
Sbjct: 119 DATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKS 178

Query: 183 IYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTESF 242
           +YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH T++F
Sbjct: 179 LYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNF 238

Query: 243 PIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVENSN 302
           P+F+NTN++LPVFLLCYN +S+E++E C           FVE ILLPLWKD++     + 
Sbjct: 239 PVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTA--TQ 296

Query: 303 IQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEET 362
           + LHQP+M+SL+E+L+FLR P++ +LSL LINSIYD+L+ L+  LMIPFM+RKISFWEET
Sbjct: 297 VILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEET 356

Query: 363 ILQPRKSLFNGAKFFKKFMNKAPVNGN-HQHNSLTKDNQGNEYFASSSSEFLMRKLADWS 421
           ILQPR+SLF+G+KF K+FM+K     N HQ  S+ KD  G EYF SSS+EFLMRKLADWS
Sbjct: 357 ILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWS 416

Query: 422 MMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIE 481
           MMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ+IVT KM+K DI+PLI+
Sbjct: 417 MMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQ 476

Query: 482 RALATYENCS--RMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAI 539
           RA+ TYENC+    Q   SK+   S  + PVRSYETRCM LASELFLSLSDTWTSTPYA+
Sbjct: 477 RAVETYENCALYDTQLSGSKK---SNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYAL 533

Query: 540 QYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYD 599
           + LETIL EC+LGPCSQIM+WERLS+CY  R+D R++HKV     ++ N E + N+D+ +
Sbjct: 534 RNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVND--GAMSNEEKVENEDDSE 591

Query: 600 TDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGN 659
            +H T  DI++ GLTR RKAAFF+L+AA KWAEQKQWRQ SWCLKD E+ Y+ I+F++  
Sbjct: 592 KEH-THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRK 650

Query: 660 GLILSNLKNQLNSKDVDS 677
            L L+ LK  L + ++DS
Sbjct: 651 DLALAKLKETLKNVEIDS 668

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/670 (62%), Positives = 512/670 (76%), Gaps = 5/670 (0%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           MVFSYEHYMNL++HLD + ETVP +IAKR+VSNA+APVITVTST L D+HI+E Y +DSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120
           YMLLRFFGGCVSDRDQANE K   D    +     + K+   G+    +   RS SNSL+
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120

Query: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK 180
           QRD+TQSQYVRFT+PL DLI T+D NDMLF+YHSLEV+L  YL +V       +PH LLK
Sbjct: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLK 180

Query: 181 KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE 240
            SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+N  
Sbjct: 181 TSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP 240

Query: 241 SFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVEN 300
           SFP F+NTN++LPVFLLCYN +++ EFE+C           FVESI+LPLW   F D  N
Sbjct: 241 SFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTD--N 298

Query: 301 SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360
             + LHQPVMSS+EEI+FFL+ P   KL L L+N IYD +D +VYDLM PFMKRK++FWE
Sbjct: 299 LVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWE 358

Query: 361 ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW 420
           ETIL PRKSLF+GAKFFKKFMNK+      Q NSL K+N G+ Y +S+S EFLMRKLADW
Sbjct: 359 ETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADW 417

Query: 421 SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI 480
           SMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ+IVT KM+KN+INP I
Sbjct: 418 SMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAI 477

Query: 481 ERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQ 540
           ERAL  YE C+     + K   S  +  PVRSYETRCM LASELFLSLSDTWTSTP+AI 
Sbjct: 478 ERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIA 537

Query: 541 YLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDT 600
           YLETIL+ECKLGP S+IM+WERLSDCY +R+DPR+KH++G ++   K  E++  DD  + 
Sbjct: 538 YLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDPKNA 595

Query: 601 DHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNG 660
           D FT EDILS+GLTR RKAA F+L+AA+KW EQKQWR++SWCL D+E+TYSD+   +   
Sbjct: 596 DVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKEN 655

Query: 661 LILSNLKNQL 670
           L+ + L+N+L
Sbjct: 656 LLYTRLRNEL 665

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/677 (60%), Positives = 521/677 (76%), Gaps = 24/677 (3%)

Query: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST   D+H+Q++Y++DSLY+
Sbjct: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65

Query: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPS------IESSSKNQNLGVPSALKRGSRSRS 116
           L+R+FGGC+SDRDQANE   + + +N +        IE    +  L +P + +R SRSRS
Sbjct: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKS-ERYSRSRS 124

Query: 117 NSLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPH 176
           NSLFQRDSTQS Y+RFT+P+ DLI +RD++DMLF+YHSLEV+L+  L L+  NT+++  H
Sbjct: 125 NSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDH 184

Query: 177 DLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLN 236
             LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN N
Sbjct: 185 KALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQN 244

Query: 237 HNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFV 296
           +  E FP FM+TN++L VFLLCY+ +S+E+ E C           F ES++LPLW  S  
Sbjct: 245 NAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHS 304

Query: 297 DVENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKI 356
             E+  ++LHQP MSSL+E+L+F   P+  +L L LIN+IYD+++ LV DLMIPFM+RKI
Sbjct: 305 --EDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKI 362

Query: 357 SFWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRK 416
           SFWEETILQPRKSLF+G K F+KFMN++     +Q+N++ KD++GNEYF SSS EFL+RK
Sbjct: 363 SFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRK 422

Query: 417 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDI 476
           LADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ+IVT KMIKND+
Sbjct: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482

Query: 477 NPLIERALATYENCSRMQRRN--SKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTS 534
           NPLIER+L TYE CS + + +  + EL S    EPVRSYETRCM+L SELFLSL+DTWTS
Sbjct: 483 NPLIERSLDTYEQCSILAQNSLENDELLS----EPVRSYETRCMLLTSELFLSLNDTWTS 538

Query: 535 TPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRN 594
           TPYA+  LETIL ECKLG CSQIM+WERLSDCYN+R DPR++H+V    ++V   E+   
Sbjct: 539 TPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRV----ETVTKIENNEG 594

Query: 595 DDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDID 654
             +  TD     DI+S+GL R+RKAAFFRL+AAKKWAEQKQWRQVSWCL+D+E  Y D+ 
Sbjct: 595 GQQLQTD-----DIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLS 649

Query: 655 FLHGNGLILSNLKNQLN 671
           F     LI   LK++LN
Sbjct: 650 FSKRPELIYQKLKDELN 666

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/680 (60%), Positives = 515/680 (75%), Gaps = 20/680 (2%)

Query: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62
           FSYEHYMNLLFHL+ S E +P EIA+RIVS+AIAPVITVTSTP  DKHIQ+ YS+DSLYM
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQR 122
           LLRFFGGCVSDRDQA+E K             +++ + +  + +     +RSRSNSLFQR
Sbjct: 64  LLRFFGGCVSDRDQASESK-------------ANAPHSSSSLTTTKTTRARSRSNSLFQR 110

Query: 123 DSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKKS 182
           DSTQSQY+RFTRPL DL+E  D NDMLF++HSLE +L  YL+LV   T +   H LLKKS
Sbjct: 111 DSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKS 170

Query: 183 IYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTESF 242
           +YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+  + YEDA+ LL+ FKNL++  + F
Sbjct: 171 LYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKF 230

Query: 243 PIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVENSN 302
           PI++NT +MLPVFLLCYN +S EE ++C           FVESI LPLWK+S+       
Sbjct: 231 PIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQ--TEPF 288

Query: 303 IQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEET 362
           I+LHQPVMSSL+E+++FL++  Q  L + L N+ YDML+ LVY L+IPFM+RKI+FWEET
Sbjct: 289 IKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEET 348

Query: 363 ILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWSM 422
           +LQP+KS+F+G+KF KK M++A  + + Q N LTKD+ GNEYFASSS E L+RKLADWS+
Sbjct: 349 VLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSI 408

Query: 423 MLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIER 482
           MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ+IVTVKM+KNDI+PLI+R
Sbjct: 409 MLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDR 468

Query: 483 ALATYENCSRMQRRNSKEL---TSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAI 539
           AL  Y+ C+     ++K++     S  LEPV SYETRC+IL+SELFLSLSDTWTSTPYAI
Sbjct: 469 ALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPYAI 528

Query: 540 QYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEY- 598
            YLE+IL+E +LGPCS+IM+WERLSDCY+LRVDPR+K KV  ++K     E   N+    
Sbjct: 529 NYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRIL 588

Query: 599 -DTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657
              D     +I+S+GLTR+RKAAFFRL+AAK WAEQ QW+QV WCL +I + YS +  ++
Sbjct: 589 NSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVN 648

Query: 658 GNGLILSNLKNQLNSKDVDS 677
            + LIL+ L+ + N    DS
Sbjct: 649 RDDLILTRLREEYNIAVSDS 668

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/720 (55%), Positives = 495/720 (68%), Gaps = 54/720 (7%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YMLLRFFGGCVSDRDQANEG-KFEQDEQNA------------------------------ 89
           Y LLR+FGGC+SDRDQ+NE  K  +DEQ +                              
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 90  ---------SPSIESS-----SKNQNLGVPSALKRGSRSRSNSLFQRDSTQSQYVRFTRP 135
                     P++ ++     +K  NL   S+    +RSRSNSLFQRDSTQSQ++RFTRP
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 136 LGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKKSIYHSFFSLAISST 195
           + DL+ +  T DMLF+YH+LE+FL + LK+V   T + + H  L+KS+YH FFS AISST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 196 NNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTESFPIFMNTNEMLPVF 255
           N LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    +FPIFM+TN++LPVF
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 256 LLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVENSNIQLHQPVMSSLEE 315
           +LCYN  S EE EK            F E I +PLW   + D  +  ++LHQP MSSL+E
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSD--DITVKLHQPAMSSLDE 358

Query: 316 ILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGAK 375
           +L+  +     KL L LIN IYD L+ L  DLMIPFM+RKI+FWEETILQP+KSLF G K
Sbjct: 359 MLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTK 418

Query: 376 FFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYE 435
            F+KFM +  +    Q N   KDNQGNEYFAS+S+ FL+RKLADWSMM+SDFKTAY+T+E
Sbjct: 419 LFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFE 478

Query: 436 SLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRMQR 495
           SL++D++ +PKYLASC+EWCAV +LMGAQ+IVT KMIKND+NPLIER+L  Y NC+ +  
Sbjct: 479 SLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALL-L 537

Query: 496 RNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCS 555
            +  E   S   EPVRSYETRCM++ SELFLSLSDTWTSTPYA+  LETIL ECKLG CS
Sbjct: 538 NSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACS 597

Query: 556 QIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTR 615
           QIM+WERLSDCYNLR DPRVKHK+    +S  +T  +    E +        I+ +GLTR
Sbjct: 598 QIMIWERLSDCYNLRTDPRVKHKL----RSNISTSSVSEVSEEEIKKQDVSSIVLKGLTR 653

Query: 616 RRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQL--NSK 673
           +RKA+FFRL+AAKKWAEQ QWRQVSWCL DI   Y D  F     LI   LK  L  NSK
Sbjct: 654 QRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLENSK 713

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/730 (51%), Positives = 486/730 (66%), Gaps = 73/730 (10%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           M  S+  YMNL FHLD + E VP EI+++IVS+A++PV+TVTST   D+HIQE+Y VDSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIES-SSKNQNLGVPSALKRGSRSRSNSL 119
           YMLLR+FG CVSDRDQA  G          P + + S KN+N           R+RSNSL
Sbjct: 61  YMLLRYFGDCVSDRDQAEAG----------PELGTESGKNRN-----------RARSNSL 99

Query: 120 FQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLL 179
           FQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEVFL+ YL LV  NT    PH LL
Sbjct: 100 FQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLL 157

Query: 180 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNT 239
           + SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++ T
Sbjct: 158 QHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTT 217

Query: 240 ESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVE 299
             FP F+N N++LPVFLLCY ++S+E+FE C           FVES+LLP W  +     
Sbjct: 218 PHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGA 277

Query: 300 NSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFW 359
           + +  LHQP+MSSLEE ++ +   +   L L LIN IYD L  L+ +LMIPFMKRKISFW
Sbjct: 278 SPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFW 337

Query: 360 EETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLAD 419
           +E+ILQPRKS+F  +KFF+K ++K P       +S T   QG  YFA++S+EF++RKLAD
Sbjct: 338 DESILQPRKSIFPNSKFFRKLISKTPAPPP-ASDSATHSQQGVAYFAATSNEFILRKLAD 396

Query: 420 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 479
           WS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQSIVTVKMIKNDI+PL
Sbjct: 397 WSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPL 456

Query: 480 IERALATYENCSRMQRRNSKELTSSGVLEPVRS--------------------------- 512
           I RAL +YE  +R  +  + +L SS + +                               
Sbjct: 457 INRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSA 516

Query: 513 -------YETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSD 565
                  YETRCM+LA+ELFLSLSDTWT+TPYAI+YLETILDEC LG  S+I++WERL+ 
Sbjct: 517 PSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAY 576

Query: 566 CYNLRVDPRVKHKV----GGMKKSVKNTEDLRNDDEYDT-----DHFTEEDILSE-GLTR 615
           CY LRVDPRVK K+    G   ++ K  E+    DE D      DH   ++ ++  GL R
Sbjct: 577 CYALRVDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLGLAR 636

Query: 616 RRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLNSKDV 675
           RRK+  FRL+A KKW E KQWRQ  W LKDIE  YS++DF + + LIL  L+ +++  + 
Sbjct: 637 RRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHE- 695

Query: 676 DSAPTPTEKN 685
              P P + N
Sbjct: 696 ---PLPQKLN 702

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/716 (52%), Positives = 475/716 (66%), Gaps = 69/716 (9%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           M  SYE YMNL+ HLD + E VP EI+++IVSNA++PV+TVTS+   DKHIQE+Y +DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120
           YMLLR+FG C+SDRDQA+     + E    P+                K  +RSRS SLF
Sbjct: 61  YMLLRYFGDCISDRDQADS----EQESGVEPN----------------KSRARSRSGSLF 100

Query: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK 180
           QR +  SQ++RFTRPL D+I TR+T D+LF+YHSLEVFL  YL+LV   T    PH LL+
Sbjct: 101 QRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQ 158

Query: 181 KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE 240
            SIYH FF+ AISST +LSPYE FNHP+ SL+ALDIS  E YEDARDLLV FKN+++ T 
Sbjct: 159 HSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTP 218

Query: 241 SFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVEN 300
            FP F+N N++LPVFLLCY + S+E+FE C           FVES+LLP W  +F   + 
Sbjct: 219 HFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDT 278

Query: 301 SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360
               LHQP+MSSLEE +F +   +   L LP I  IYD L  LV +LMIPFMKRKISFWE
Sbjct: 279 PTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWE 338

Query: 361 ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW 420
           E+ILQPR+S+F  +KFF+K ++KAP    + ++S T   QG  YFA++S+E L+RKLADW
Sbjct: 339 ESILQPRRSIFPNSKFFRKLISKAPTPSTN-NDSATHSEQGLAYFAATSNELLLRKLADW 397

Query: 421 SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI 480
           S MLSDFKTAYSTYE L  D +  P+YLA C+EWCA+S+LMGAQSIVTVKMIKNDI+PLI
Sbjct: 398 SFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLI 457

Query: 481 ERALATYENC------------SRMQRR-------------NSKELTSSGVL-------- 507
            RAL +YE C            S++Q R             NS +   SG          
Sbjct: 458 TRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFEISSTP 517

Query: 508 -EPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDC 566
            +  +SYETRCM+LA+ELFLSLSDTWT+TPYAI+YLETILD+C +G  S+I++WERL+ C
Sbjct: 518 SQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYC 577

Query: 567 YNLRVDPRVKHKVGGMK-KSVKNTEDLRNDDE-YDTDHFTEED----------ILSEGLT 614
           Y LRVDPRVK ++   + +S    E L  + E  D D   E            I S GLT
Sbjct: 578 YALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSCIASSGLT 637

Query: 615 RRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQL 670
           R+RKA  FRL+A KKW E KQWRQ  W  +D+E  YS + F +   LIL  L+ ++
Sbjct: 638 RKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEKRI 693

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/743 (51%), Positives = 485/743 (65%), Gaps = 99/743 (13%)

Query: 1   MVFSYEHYMNLLFHLDHSRE--TVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVD 58
           M  SYE+YMNLL+H+DHS E  TV  E+AK+IVSNA++PV+ VTST L D H+QEAY + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNS 118
           S+YMLLRFFG CV+DRDQ NE              E++ K              R RSNS
Sbjct: 61  SMYMLLRFFGDCVTDRDQENE-------------TETNFKG-------------RPRSNS 94

Query: 119 LFQRDSTQSQYVRFTRPLGDLIETRDTN-DMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177
           LFQR+S  S +VRFTRPL DL++ R ++  MLF+YHSLE+FLD YL+LV        PH 
Sbjct: 95  LFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHR 152

Query: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237
           LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN+N 
Sbjct: 153 LLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNS 212

Query: 238 NTES---FPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDS 294
            T+S   FP F+N N++LPVFLLCYND S E+FE C           FVESILLPLW+DS
Sbjct: 213 ATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDS 272

Query: 295 F-VDVENSNIQLHQPVMSSLEEILFFL--RAPTQTKLS--------------LPLINSIY 337
              D E     LH P+MSSLEE+L+FL   AP +  +S              L L+ +IY
Sbjct: 273 EDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIY 332

Query: 338 DMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGAKFFKKFMNK-APVNGNHQHNSLT 396
           D L+ L+ +LMIPFMKRKISFWEETILQPRKS+F  AKF ++F++K AP       NS +
Sbjct: 333 DRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKS 392

Query: 397 KDN-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWC 455
               Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C+EWC
Sbjct: 393 DGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWC 452

Query: 456 AVSLLMGAQSIVTVKMIKNDINPLIERALATYENC-SRMQRRNSKELTSSGVLEPVRSYE 514
           AVS+LMGAQSIVTVKMIKNDI+PLI ++L  YE C S++   +  E  S    +P +SYE
Sbjct: 453 AVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYE 512

Query: 515 TRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPR 574
           TRCM+L++ELFLSLSDTWT+TPYAI+YLETIL  C LGP SQ+++WE+L+ CY LRVDPR
Sbjct: 513 TRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPR 572

Query: 575 VKH------KVGGMKKSVKNTEDLRNDDEYDTDHFTEE---------------------- 606
           V H       +   ++ V +  + R    +   HF+ E                      
Sbjct: 573 VSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSN 632

Query: 607 -----------------DILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENT 649
                            DI   GLTRRRKAAFFRL+AA KW EQKQW+Q SW L+D++  
Sbjct: 633 REKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTV 692

Query: 650 YSDIDFLHGNGLILSNLKNQLNS 672
           YS + F +  GLIL  L  ++ +
Sbjct: 693 YSGLVFSYRKGLILERLVGEIEA 715

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/709 (47%), Positives = 449/709 (63%), Gaps = 101/709 (14%)

Query: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
           M FSYEHYMNLL HL+ + ETVPP+IA+RIVS+A+APVITVTS+   D HI E+Y V S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120
           Y+L R FGGC+SDRDQ  E     D                    S+    +R RSNSLF
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTLDD--------------------SSTGGRTRKRSNSLF 100

Query: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYL----KLVAGNTDE---- 172
           QRD+TQSQ++RF +PL DL+ +      LF+  SLE +L +YL    KL A + ++    
Sbjct: 101 QRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQL 160

Query: 173 --------------KVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISY 218
                          +PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D+S 
Sbjct: 161 PDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSR 220

Query: 219 GEVYEDARDLLVNFKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXX 278
           G+ YE  RDL+  FKNLN   E FP+F+N N++LP+ +LCY+   + +   C        
Sbjct: 221 GQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIK 280

Query: 279 XXXFVESILLPLWKDSFVDVENSNIQLHQPVMSSLEEILFFLRAPT-----------QTK 327
              FV+SI L LW +   D E+  + LH+P+MSSL+EI+ F  + +            ++
Sbjct: 281 KCLFVDSIPLALWDE---DPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSR 337

Query: 328 LSLPL--INSIYDMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGAK-FFKKFMNKA 384
            +LPL  I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+ K 
Sbjct: 338 AALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGK- 396

Query: 385 PVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAF 444
                    +  +D    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL   
Sbjct: 397 --------TTTQRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNS 448

Query: 445 PKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRMQRRNSKELTSS 504
           P YLASC+EWCAVSLL+GAQ+IVTVKMIK +I PLIERA+ATY    R Q R+       
Sbjct: 449 PNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATY----RQQGRS------- 497

Query: 505 GVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDEC-KLGPCSQIMVWERL 563
                  SYETRCMIL++ELFL+L DTWTSTPYAI+YLETIL +C +LG CSQ+M+WERL
Sbjct: 498 -------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERL 550

Query: 564 SDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFR 623
           SDCY  R DPRV   +     +   +    N            +IL++G TR+RKAAFFR
Sbjct: 551 SDCYQSRTDPRVASALS--TNTSPGSAQPGN------------EILAQGFTRKRKAAFFR 596

Query: 624 LMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLNS 672
           L+AAKKWAEQ QWRQV WCL DI++ Y+        GL++  L  ++ S
Sbjct: 597 LIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQS 645

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/641 (49%), Positives = 421/641 (65%), Gaps = 84/641 (13%)

Query: 109 KRGSRSRSNSLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAG 168
           ++ +R RSNSLFQRDSTQSQY+RFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 169 NTDEKVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDL 228
           NT   +PH+ LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 229 LVNFKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILL 288
           L+ FKN++  T +FP+++N N++LPVFLLCY+  S E+ +             F ESILL
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 289 PLWKDSFVDVENSNIQLHQPVMSSLEEILFFLR-------APTQTKLSLPLINSIYDMLD 341
           PLW D   +  +  ++LH+P+MSS++E L+FL+         T  KL L L+  IY+M+ 
Sbjct: 361 PLWNDKIYN-NDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419

Query: 342 YLVYDLMIPFMKRKISFWEETILQPRKSLFNGAKFFKKFMNK---------------APV 386
            L  +L+IPFM+RKI FW+ETILQPRKS+F   K FK FMN+               +  
Sbjct: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNS 478

Query: 387 NGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 446
              H H+ LTKD+ G+EYF++ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 479 ISKHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538

Query: 447 YLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENC------SRMQRRN--- 497
           Y+ASC+EW AVS+LMGAQ+IVT KM+KND++PLIE AL +YE        SR+   N   
Sbjct: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINS 598

Query: 498 -----------SKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETIL 546
                        E++       +RSYE RCM+L SELFLSLSDTWTSTPYA++YLETIL
Sbjct: 599 LNSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETIL 658

Query: 547 DECKLGPCSQIMVWERLSDCYNLRVDPRVKHK--VGGMKKSVKNT-------------ED 591
            + KLGPCSQ ++WERLS CY+LRVDPR+K K  +  + K  K T             E 
Sbjct: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718

Query: 592 LRND---------------------DEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKW 630
            RND                     +EYD  +    DILS+G TR+RKAAFF+L+AAKKW
Sbjct: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGY----DILSDGFTRKRKAAFFKLIAAKKW 774

Query: 631 AEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLN 671
           +EQKQWRQ+ WCLKDIEN Y ++ F     LIL  LK+QLN
Sbjct: 775 SEQKQWRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLN 815

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 70/79 (88%)

Query: 1  MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60
          M FSYE+YMNLLFHLD + E +P +IAKRIV N+IAP+I+VT+TP  DKH+Q++Y++DSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMLLRFFGGCVSDRDQANE 79
          YMLLR+FGGC+SDRDQ +E
Sbjct: 61 YMLLRYFGGCISDRDQYHE 79

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  504 bits (1298), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/683 (42%), Positives = 407/683 (59%), Gaps = 97/683 (14%)

Query: 2   VFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLY 61
           + SYE YMNL+ + +H  + VP EI++R++ NA++P ++V ST   + H+ E +S  SLY
Sbjct: 1   MLSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQ 121
           MLLR+F   V +R           E+  S S                  G R R  S++Q
Sbjct: 61  MLLRYFADYVRERG----------EEVGSVS------------------GQR-RPGSVYQ 91

Query: 122 RDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKK 181
           R +  S+YVRF RPL ++IET +   +  ++  LE  L  +L+ +   T  + P +LLK 
Sbjct: 92  RQT--SRYVRFQRPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSELLKH 147

Query: 182 SIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTES 241
           SI+H F ++   S+  LSPY T NHPI++L+ALD++ GE Y  AR+LLV FKNL   +  
Sbjct: 148 SIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSSK 205

Query: 242 FPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVENS 301
           FP ++NTN++LPVF+LC+++ S E++E             FVES+ LP+    F + E+ 
Sbjct: 206 FPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPI----FTNYESD 261

Query: 302 NIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEE 361
            + LH P+ +SL+E ++    P   +L   L++ IY+ ++ +V DLMIPFM RKISFW+E
Sbjct: 262 PVVLHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWDE 321

Query: 362 TILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWS 421
           TILQPRKS+F+G KF K+FMNK     +    +L+  + G  YF +SS+EFL+RKLADWS
Sbjct: 322 TILQPRKSIFHGNKFLKRFMNK---TNSSAAGTLSTSSDG--YFLASSNEFLLRKLADWS 376

Query: 422 MMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIE 481
            MLSD+KTAYS Y  L+ D + +P+YL+SC E+ A+SLLMGA SIVT KMIKNDI+PLI 
Sbjct: 377 FMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIM 436

Query: 482 RALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQY 541
           + + +              L   G        + RC++  +ELFLSLSDTWTS P+AI+Y
Sbjct: 437 KYMDS----------TVASLNYLG--------KFRCLVYMAELFLSLSDTWTSAPFAIKY 478

Query: 542 LETIL--DECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYD 599
           LE IL  ++ KLGP S+ M+WER+S  Y LR+DPR+                   DDEY 
Sbjct: 479 LELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRI-----------------HTDDEYL 521

Query: 600 TDHF----TEED------------ILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCL 643
           +D+F    TE+D            I S GLTR RK A FRL+AAKKW E    RQ +W L
Sbjct: 522 SDNFMELTTEDDFCMNPNKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSL 581

Query: 644 KDIENTYSDIDFLHGNGLILSNL 666
           K     Y ++ F + +G +LS L
Sbjct: 582 KGCNKVYRNLGFANADGTLLSRL 604

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  504 bits (1298), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 290/683 (42%), Positives = 403/683 (59%), Gaps = 84/683 (12%)

Query: 2   VFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLY 61
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST   ++H++E + + SLY
Sbjct: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQ 121
            LLR+FG  + DRDQ ++              + S+K Q            R R NSLFQ
Sbjct: 61  KLLRYFGDYIQDRDQLDD--------------KISAKLQ--------PNNRRQRQNSLFQ 98

Query: 122 RDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKK 181
           R+S  S+Y+RF  PL D+I   D + + FN   LE  L  +LK +  +T    P +LLK 
Sbjct: 99  RNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCELLKH 154

Query: 182 SIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTES 241
           SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL +    
Sbjct: 155 SIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSK 212

Query: 242 FPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVENS 301
           FP F+NTN++LPVF+LC++  S +++E             FVES+ LP+    F +  + 
Sbjct: 213 FPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPI----FTNFRDR 268

Query: 302 NIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEE 361
           +I LH P+ +SL+E L+    P   KL   L+  IYD ++ +V DLMIPFM RKISFW+E
Sbjct: 269 SIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDE 328

Query: 362 TILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWS 421
           TILQPRKS+F+  K  K+F++K+         S+     G  +F +SS+EFL+RKLADW 
Sbjct: 329 TILQPRKSIFHSNKLLKRFISKS---SGSPTASMPTSPDG--HFLASSNEFLLRKLADWC 383

Query: 422 MMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIE 481
            MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA SIVT KMIKNDI+PLI 
Sbjct: 384 FMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIM 443

Query: 482 RALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQY 541
           + L                     V   +   + RCMI  +ELFLSLSDTWTS P+AI+Y
Sbjct: 444 KYL------------------DYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAPFAIKY 485

Query: 542 LETIL--DECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYD 599
           LE IL  +  KLGP  + ++WER+S  Y LR+DPR+                  +D   D
Sbjct: 486 LEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAD---------------DDSTSD 530

Query: 600 TDHFTEED------------ILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIE 647
            DH  EE+            I ++G TR RK A F+L+AAKKW +  Q RQ +W LK   
Sbjct: 531 CDHDLEEELYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCN 590

Query: 648 NTYSDIDFLHGNGLILSNLKNQL 670
             Y D+ F +  G +LS L + +
Sbjct: 591 RVYRDLPFANAEGTLLSRLADAV 613

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  449 bits (1155), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 258/660 (39%), Positives = 390/660 (59%), Gaps = 64/660 (9%)

Query: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62
           FSYE YMNL+ + +H    +P EI+K+++ N ++P I V S    D H+++ Y++DS+ M
Sbjct: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64

Query: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQR 122
           L R+FG  + DRDQ                I S++   +L  P ++  G R RS+SLFQR
Sbjct: 65  LFRYFGDYIQDRDQ----------------IPSTT---DLKDPGSVSSG-RHRSDSLFQR 104

Query: 123 DSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEK-VPHDLLKK 181
            +  S+ VRFTR L DLI   D+ D +     ++ FL  YL+ +    +E   P  LLK 
Sbjct: 105 QA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKH 161

Query: 182 SIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTES 241
           SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+  E+
Sbjct: 162 SIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLEN 219

Query: 242 FPIFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESILLPLWKDSFVDVENS 301
           FP F+N N++LPVF+LCY++ S+E++E             FVES+ + L    F   +N 
Sbjct: 220 FPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISL----FTPHDNQ 275

Query: 302 -NIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360
            +  LH P+  SL E +F +  PT   +   L+  IYD + ++V ++MIPFM RK+ FW+
Sbjct: 276 KSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWD 335

Query: 361 ETILQPRKSLFNGAKFFKKFMN-KAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLAD 419
           ET+LQPRKS+F   KFF++F++ K+     H+ N      +G+  F +SS EFL+RKLAD
Sbjct: 336 ETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLAD 395

Query: 420 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 479
           WS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ+I+T K IK +++PL
Sbjct: 396 WSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPL 455

Query: 480 IERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAI 539
           + RA+  Y        +   E  S  V+         C++  S+L LSLSDTW S+P A+
Sbjct: 456 MTRAIEQY--------KKQDEKHSLRVI--------HCILTFSDLLLSLSDTWVSSPLAV 499

Query: 540 QYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRV---------KHKVGGMKKSVKNTE 590
            YL  I     LGP + +++ ER++  Y + +D RV         +       ++ +N++
Sbjct: 500 NYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSK 559

Query: 591 DLRNDDEYDTDH-------FTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCL 643
              N  E D  H         + ++ SEGLTR RK + ++L+AAKKW E  +  Q  WC+
Sbjct: 560 KGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCI 619

>TPHA0B01900 Chr2 complement(421833..427454) [5622 bp, 1873 aa] {ON}
            Anc_4.296 YLR422W
          Length = 1873

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 607  DILSEGLTRRRKAAFFRLMAA--KKWAEQKQWRQVSWCLKDIENTY 650
            D+LS  L  +R   F++L++    ++ E+K + Q + CL+ + NTY
Sbjct: 1436 DVLSYLLDAKRPLQFYKLLSELFNQYIERKDFVQAALCLEHVANTY 1481

>NDAI0E01010 Chr5 complement(203904..205625) [1722 bp, 573 aa] {ON}
           Anc_8.709 YOR260W
          Length = 573

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 44/104 (42%), Gaps = 21/104 (20%)

Query: 503 SSGVLEPVRSYE----TRCMILASELF--LSLSDTWTSTPYAIQYLETILDECKLGPCSQ 556
           SS V     SYE     +C I  S LF  + L D            + IL+ C +GP  +
Sbjct: 435 SSSVKLSTMSYEGIIGAKCRIAGSILFHGVQLDD------------DVILENCIIGPNVK 482

Query: 557 IMVWERLSDCY---NLRVDPRVKHKVGGMKKSVKNTEDLRNDDE 597
           I    +LS+CY   N  V+P+   K   + K     ED+  D +
Sbjct: 483 IGKKAKLSNCYVEGNYIVEPKGNFKGETLSKVALEEEDIAIDSD 526

>Smik_15.80 Chr15 (146001..149531) [3531 bp, 1176 aa] {ON} YOL078W
           (REAL)
          Length = 1176

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 9   MNLLFHLDHSRETV-----PPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYML 63
           MN   H    R+T      P   A      +++  +T T +PLF  H + + +V S +M 
Sbjct: 522 MNSSRHPKERRDTAISAKEPTSFASSNRKLSVSSNLTSTRSPLFRGHGRTSSTVSSEHMK 581

Query: 64  LRFFGGCVSDRDQANEGKFEQD--EQNASPSIESSSKNQNL 102
           +  F   VS R + +    +QD  + N S +   SSK  N+
Sbjct: 582 VPKFSDGVSHRARKSTLSLKQDHTQSNVSSNAHKSSKEGNI 622

>CAGL0H00594g Chr8 (57283..58644) [1362 bp, 453 aa] {ON} weakly
           similar to uniprot|Q12365 Saccharomyces cerevisiae
           YPL255w BBP1 cell division control protein
          Length = 453

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 342 YLVYDLMIPFMKRKISFWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQ- 400
           Y  YDL+ P       + EE  LQ   +   G+   K  MN APV    Q+N   + ++ 
Sbjct: 83  YKRYDLLPPISSDDEDYSEEDKLQYGANSNRGSPMVKGLMNPAPVVPKQQNNGYGEFDRR 142

Query: 401 -GNEYFASSSSEFLMRKLADWSMMLSDFKTA 430
             N  F   +  F  RK +  S ++++++++
Sbjct: 143 STNPLFTDPTDTFARRKTS--SSLMNNYRSS 171

>NDAI0D02560 Chr4 (589972..593856) [3885 bp, 1294 aa] {ON} Anc_5.94
           YHR154W
          Length = 1294

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 343 LVYDLMIPFMKRKISFWEETILQPRKSL----FNGAKFFKKFMNKAPVNGNH 390
           + YDLMIP +     +W E +L    +L     N  K F KF N +P +GN 
Sbjct: 102 VTYDLMIPVVS---IYWLEQVLARSSALDNANTNNTKLFLKFNNFSPSDGNQ 150

>KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa] {ON}
            Anc_4.173 YLR342W
          Length = 1877

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 153  HSLEVFLDNYLKLVAGNTDEKVPHDLLKKSIYHSFFSLAISSTNNLSP---YE--TFNHP 207
            H+L  +   YL+L+  N D  +   L  +SI   F  L +  TN  +P   YE  T NHP
Sbjct: 1089 HALIFYRGEYLQLIDANQDNYLEECLKIRSILAEFEELNVEQTNPYAPELKYEEQTANHP 1148

Query: 208  ILSLIALDISYGE 220
            +  + A +  + E
Sbjct: 1149 VAIVGAREYIFSE 1161

>TDEL0D02420 Chr4 (471383..472822) [1440 bp, 479 aa] {ON} Anc_1.371
           YFR012W
          Length = 479

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 47/107 (43%), Gaps = 9/107 (8%)

Query: 119 LFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDL 178
           +F+       Y   + P G L E    ND   NY S +   ++ +K+ +G TD+   HDL
Sbjct: 211 VFESPKDAGFYKEVSNPSGSLSEKPLMNDPYTNYESKKE--ESVVKISSGTTDQSTSHDL 268

Query: 179 ---LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVY 222
               ++S  H+ FS AI+  NN     T   P +SL      Y   Y
Sbjct: 269 NDFEQESNSHTAFS-AINDNNN---NPTLTRPGVSLSMASSEYSSNY 311

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,378,671
Number of extensions: 3622628
Number of successful extensions: 13857
Number of sequences better than 10.0: 52
Number of HSP's gapped: 14229
Number of HSP's successfully gapped: 55
Length of query: 695
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 578
Effective length of database: 40,065,477
Effective search space: 23157845706
Effective search space used: 23157845706
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)