Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2678.254ON67267233390.0
Smik_4.3538.254ON69067229400.0
YDR107C (TMN2)8.254ON67267229280.0
Skud_4.3688.254ON67267229030.0
NDAI0B023708.254ON72266025460.0
Smik_12.1428.254ON66366025260.0
Suva_10.1678.254ON68467925150.0
NCAS0B049708.254ON66666825070.0
YLR083C (EMP70)8.254ON66766624980.0
Skud_12.1518.254ON66466624700.0
KAFR0B026808.254ON66465724100.0
KNAG0G019908.254ON66766723570.0
Kpol_543.358.254ON65867223090.0
ZYRO0C01848g8.254ON64766222850.0
CAGL0B01683g8.254ON69168622760.0
TBLA0E043708.254ON67666422030.0
NCAS0B038908.254ON66366621820.0
SAKL0H17248g8.254ON66065921680.0
TBLA0H014508.254ON67366321530.0
KLLA0F18931g8.254ON66565821510.0
TPHA0A018408.254ON68568921460.0
Kwal_56.235778.254ON68367121320.0
KLTH0G13882g8.254ON68769020820.0
TDEL0F038108.254ON65666520300.0
NDAI0J014208.254ON61962719930.0
AGR097W8.254ON65366718460.0
Ecym_43178.254ON60566514890.0
NCAS0A145207.411ON6706963712e-36
TDEL0C027107.411ON6786933676e-36
YER113C (TMN3)7.411ON7067133677e-36
Skud_5.2667.411ON7077113651e-35
Smik_5.2587.411ON7067173562e-34
NDAI0A015107.411ON6796893508e-34
KLLA0E20835g7.411ON6767033392e-32
CAGL0G03487g7.411ON7047163341e-31
SAKL0F12914g7.411ON7077363303e-31
Suva_5.2347.411ON7067113286e-31
ZYRO0B03784g7.411ON6586863232e-30
KLTH0C06226g7.411ON6947292252e-18
KNAG0C034307.411ON6802562233e-18
Ecym_71437.411ON6767292021e-15
Kwal_27.107467.411ON6902921941e-14
KAFR0K019507.411ON6642691931e-14
TPHA0K007307.411ON7335391735e-12
TBLA0I003307.411ON7135261682e-11
Kpol_1045.287.411ON6816971556e-10
AGL295C7.411ON6572791432e-08
NDAI0D023705.118ON33880751.6
YMR102C2.450ON83477742.6
TPHA0A051805.87ON56455716.3
TBLA0D049901.371ON57746707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.267
         (672 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...  1290   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...  1137   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...  1132   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...  1122   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   985   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   977   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   973   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   970   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   966   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   956   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   932   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   912   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   894   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   884   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   881   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   853   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    845   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   839   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   833   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   833   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   831   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   825   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   806   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   786   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   772   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   715   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   578   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   147   2e-36
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   145   6e-36
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   145   7e-36
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   145   1e-35
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   141   2e-34
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   139   8e-34
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   135   2e-32
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   133   1e-31
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   131   3e-31
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   130   6e-31
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   129   2e-30
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    91   2e-18
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    91   3e-18
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    82   1e-15
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    79   1e-14
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    79   1e-14
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    71   5e-12
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    69   2e-11
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    64   6e-10
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    60   2e-08
NDAI0D02370 Chr4 complement(547014..548030) [1017 bp, 338 aa] {O...    33   1.6  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    33   2.6  
TPHA0A05180 Chr1 (1165194..1166888) [1695 bp, 564 aa] {ON} Anc_5...    32   6.3  
TBLA0D04990 Chr4 (1229559..1231292) [1734 bp, 577 aa] {ON} Anc_1...    32   7.4  

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score = 1290 bits (3339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/672 (94%), Positives = 632/672 (94%)

Query: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60
           MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS
Sbjct: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60

Query: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120
           DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK
Sbjct: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120

Query: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180
           STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG
Sbjct: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180

Query: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240
           GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN
Sbjct: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240

Query: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300
           YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY
Sbjct: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300

Query: 301 LHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLG 360
           LHVYDPQIQWF                     RAVRSDFARYNELNLDNEFHEDAGWKLG
Sbjct: 301 LHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLG 360

Query: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420
           HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG
Sbjct: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420

Query: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480
           FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480

Query: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540
           FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF
Sbjct: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFG                   ITYHSLCLENWSWQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQW 600

Query: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660
           RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI
Sbjct: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660

Query: 661 FIRKIYSRIKVE 672
           FIRKIYSRIKVE
Sbjct: 661 FIRKIYSRIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score = 1137 bits (2940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/672 (80%), Positives = 586/672 (87%)

Query: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60
           M++ IWL LF YI L KAFSLPG+SPTTY  NDEIPLLVNRLTPSIYFQH+DENGKD+SS
Sbjct: 19  MKQSIWLLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISS 78

Query: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120
           DKEH+LYSYDYYN++FHFC+PEHVE+QPESLGS+IFGDRIYNSPFQL+MLE KECVALC+
Sbjct: 79  DKEHYLYSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCE 138

Query: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180
           +TIPGKDAKFIN LIK+GFFQNWLVDGLPAAR V+DSRTKTNYYGTGFELG T VK T+ 
Sbjct: 139 NTIPGKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTID 198

Query: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240
           GK IPSTMEELDSE S TGA LDAR+PKNIKPNLV+T+EL +FVNHF+I+VE+HDRG+ N
Sbjct: 199 GKVIPSTMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDN 258

Query: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300
           YRVVGVTVNP+SIERSSP +CS   +PL L E+ DN++YFTYSVKF+ASDTVWATRWDKY
Sbjct: 259 YRVVGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKY 318

Query: 301 LHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLG 360
           LH+YDPQIQWF                     RA+ SD +RYNELNLDNEFHED+GWKLG
Sbjct: 319 LHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLG 378

Query: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420
           HGDVFR P KSM+LSVLVGSG+QLFLMIICSIF AALGLVSP SRGSLPTVMFV YALFG
Sbjct: 379 HGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFG 438

Query: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480
           FVGSYTSMGVYKFFHGPYWKANLI+TPILLPG IF+LIVAMNFFLLFAHSSGVIPA TLF
Sbjct: 439 FVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLF 498

Query: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540
           FIIFLWF+VSIPLSFAGS IAHK C WDEHPTKTNQIARQ P QPWYLRTIQATLIAGIF
Sbjct: 499 FIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIF 558

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQW 600
            FGSIAVELYFIYSSLWFNKIFYMFG                   ITYHSLCLENW WQW
Sbjct: 559 CFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQW 618

Query: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660
           RSFIIGGLGCSVYMFIH+ILFTKFKLGGF+T+VLY GYSFIISALCCVVTGAIGFFS M+
Sbjct: 619 RSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCML 678

Query: 661 FIRKIYSRIKVE 672
           FIRKIYS +K+E
Sbjct: 679 FIRKIYSAVKIE 690

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/672 (79%), Positives = 582/672 (86%)

Query: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60
           M++G+WL ++ Y  L K FSLPG+SPTTY + DEIPLLVNRLTPSIYFQH+DE G DVS 
Sbjct: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60

Query: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120
           DKEHFLYSYDYYN +FHFC+PEHVEKQPESLGSVIFGDRIYNSPFQL MLE+KECVALCK
Sbjct: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120

Query: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180
           STIPGKDAKFINTLIK+GFFQNWLVDGLPAAR  YDSRTKTNYYGTGFELGFTDVKQTV 
Sbjct: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180

Query: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240
           GK +PSTMEEL SE S     LDAR PKN+KPNLV+T+EL +FVNHF+I+VE+HDRGN N
Sbjct: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240

Query: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300
           YRVVGV VNP+SIERSSPGACSTTG+PL L EDKDN+VYFTYSVKF+ASDTVWATRWDKY
Sbjct: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300

Query: 301 LHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLG 360
           LH+YDPQIQWF                     RA++SD ARYNELNLDNEFHED+GWKLG
Sbjct: 301 LHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLG 360

Query: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420
           HGDVFR P KSM+LS+LVGSG+QLFLM++CSIFFAA+GLVSP SRGSLPTVMFVLYALFG
Sbjct: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420

Query: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480
           FVGSY SMGVYKFF GPYWKAN+I+TPILLPGAIFLLIV MNFFLLFAHSSGVIPAR+LF
Sbjct: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480

Query: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540
           FII LWF VS+PLSFAGS +AHK+C WDEHPTKTNQIARQ P QPWYLRT QATLIAGIF
Sbjct: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFG                   ITY+SLCLENW WQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQW 600

Query: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660
           RSFIIGGLGCS+Y FIH+ILFTKFKLGG +TVVLY+GYS IISALCCVVTGAIGFFSSM 
Sbjct: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660

Query: 661 FIRKIYSRIKVE 672
           FIRKIYS IKVE
Sbjct: 661 FIRKIYSAIKVE 672

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score = 1122 bits (2903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/672 (79%), Positives = 584/672 (86%)

Query: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60
           M++ IWLAL  YI +AKAFSLPG+SPTTY +NDEIPLLVNRLTPSIYFQH+DENG D+SS
Sbjct: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60

Query: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120
           DKEHFLYSYDYYN++FHFC+PEHVEKQPESLGSVIFGDRIYNSPFQL+MLE+KECVALCK
Sbjct: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120

Query: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180
            TIPG+DA+FIN LI +GFFQNWLVDGLPAAR+VYDSRTKTNYYGTGFELGFTDV QTVG
Sbjct: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180

Query: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240
            +T+P+TMEE D + S  GATL  R PKNI+PN V+T+EL +FVNHF I VE+H+RGN +
Sbjct: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240

Query: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300
           YR+VGVTVNP+SIERSSPG+CS T +PLTL ED+DN+VYFTYSVKF+AS TVWATRWDKY
Sbjct: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300

Query: 301 LHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLG 360
           LH+YDPQIQWF                     RA++SD  RYNELNL+NEFHEDAGWKL 
Sbjct: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360

Query: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420
           HGDVFR PPKSM+LSVLVGSGIQLFLMIICSIFFAA GLVSP SRGSL TVMF+LYALFG
Sbjct: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420

Query: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480
           FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAI LLIVAMN FLLFAHSSGVIPA++LF
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLF 480

Query: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540
           FIIFLWF VSIPLSF GS +AHKRC W+EHPTKTNQIARQ P QPWYLRT QAT++AGIF
Sbjct: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFG                   ITYHSLCLENW WQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQW 600

Query: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660
           RSFIIGGLGCS+YMFIH+ILFTKFKLGGF+TVVLY+GYSFI+S LCCVVTGAIGFFSSMI
Sbjct: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660

Query: 661 FIRKIYSRIKVE 672
           FIRKIY  +KVE
Sbjct: 661 FIRKIYYAVKVE 672

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/660 (71%), Positives = 535/660 (81%), Gaps = 4/660 (0%)

Query: 13  IALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYY 72
           ++L +AF LPGV+PTTY  +DEIPLLVN LTPS+YFQHK+E+GK + SDKE FLYSYDYY
Sbjct: 67  LSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYY 126

Query: 73  NDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFIN 132
            D+FHFC+PEH+EKQPESLGS+IFGDRIYNSPFQ+ ML+DK CV+LCK+TIPGKDAKFIN
Sbjct: 127 YDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFIN 186

Query: 133 TLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELD 192
            LIKNGFFQNWL+DGLPAAR VYDSRTKT +YGTGFELGF DV Q  G  T  +      
Sbjct: 187 KLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQ--GTTTGDNANTVAK 244

Query: 193 SEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLS 252
              +  G  LD RD KN++  +++  EL +F NHF+IQVEYHDRG  NYRVVGV VNP+S
Sbjct: 245 KPTTNEGLELDTRDAKNVQ--MLKNFELPYFANHFDIQVEYHDRGENNYRVVGVIVNPVS 302

Query: 253 IERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFX 312
           I+RS+PG C T+G PL L ED+DNDVYFTYSVKFI S+T+WATRWDKYLH+YDP IQWF 
Sbjct: 303 IKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFS 362

Query: 313 XXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSM 372
                               +A++SDFARYNELNLD++F E+AGWKLGHGDVFRIP +S+
Sbjct: 363 LINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSL 422

Query: 373 VLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYK 432
           +LSVLVGSG+QLFLMIICSIFFAALG +SP+SRGSL TVMF+LYALFGFVGSYTSMGVYK
Sbjct: 423 LLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYK 482

Query: 433 FFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIP 492
           FF GPYWK N+++TPIL+PG IF  IVA+N FLLF HSSGVIPA TLFF+I LWF  SIP
Sbjct: 483 FFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIP 542

Query: 493 LSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFI 552
           L+ AGS IAHK+C WDEHPTKTNQIARQ P QPWYL+T  ATLIAGIF FGSIAVELYFI
Sbjct: 543 LALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFI 602

Query: 553 YSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGLGCSV 612
           YSSLWFNKIFYMFG                   ITYHSLCLENW WQWR FIIGG+GC++
Sbjct: 603 YSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAI 662

Query: 613 YMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672
           Y+FIH+ILFTKFKLGGF T+VLYVGYS IIS L C+VTGAIGF SSM FIRKIYS IKVE
Sbjct: 663 YVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/660 (69%), Positives = 530/660 (80%), Gaps = 9/660 (1%)

Query: 13  IALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYY 72
           ++ AKAF LPGV+PTTY+ NDEIPLLVN LTPS+Y+QHKDE G +VS DKE+FLYSYDYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 73  NDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFIN 132
           N +FHFCKPE VEKQPESLGS+IFGDRIYNSPFQLKMLE+KECV+LCK TIPG DAKFIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 133 TLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELD 192
            LIKNGFFQNWL+DGLPAARNV D RTKT++YG GFELGF +V Q    +  P+T     
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNT----- 187

Query: 193 SEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLS 252
           +E +  G  LD RD  N    +VQT E  +F NH++I++EYHDRG GNYRVVGV VNP+S
Sbjct: 188 AETTNQGVELDTRDGHN----MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVS 243

Query: 253 IERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFX 312
           I+RS P  C T G PL L E+ DN+VYFTYSVKF+ S+T WATRWDKYLHVYDP IQWF 
Sbjct: 244 IKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFS 303

Query: 313 XXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSM 372
                               RA++SDFARYNELNLD++F ED+GWKL HGDVFR P +S+
Sbjct: 304 LINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSL 363

Query: 373 VLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYK 432
            LS+LVGSG+QLF M+ CSIFFAALG +SP+SRGSL TVMF+LYALFGFVGSYTSMG+YK
Sbjct: 364 TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYK 423

Query: 433 FFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIP 492
           FF GPYWKANLI+TP+L+PG I ++I+A+NFFL+F HSSGVIPA TLFF++FLWF  SIP
Sbjct: 424 FFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIP 483

Query: 493 LSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFI 552
           LSFAGS +A K+C WDEHPTKTNQIARQ P QPWYL+T+ ATLIAG+F FGSIAVELYFI
Sbjct: 484 LSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFI 543

Query: 553 YSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGLGCSV 612
           Y+SLWFNKIFYMFG                   ITYHSLCLENW WQWR FI+GG GC++
Sbjct: 544 YTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCAL 603

Query: 613 YMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672
           Y+FIH+ILFTKFKLGGF T+VLYVGYS +IS LCC+VTG+IGF SSM FIRKIYS IKV+
Sbjct: 604 YVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/679 (67%), Positives = 537/679 (79%), Gaps = 18/679 (2%)

Query: 9   LFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYS 68
           L+  ++ A+AF LPGV+PTTY+ NDEIPLLVN LTPS+Y+QH+DE+G +VS DKEHFLYS
Sbjct: 9   LYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYS 68

Query: 69  YDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDA 128
           YDYY DKFHFCKPEHVEKQPESLGS+IFGDRIYNSPF+L ML++KECV+LCK+ IPG DA
Sbjct: 69  YDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDA 128

Query: 129 KFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKT----- 183
           KFIN LIKNGFFQNWL+DGLPAAR V+D RTKT++YG GF LGF +V Q V  +T     
Sbjct: 129 KFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188

Query: 184 IPSTMEELDSEDSKT----------GATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEY 233
                E+  + D KT          G  LDARD      N+V+T E  +F NHF+I++EY
Sbjct: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK---NMVKTREFPYFANHFDIKIEY 245

Query: 234 HDRGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVW 293
           HDRG GNYRVVGV VNPLSI+RSSPG C T G PL L E  DN+VYFTYSVKF  S T W
Sbjct: 246 HDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSW 305

Query: 294 ATRWDKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHE 353
           ATRWDKYLHVYDP IQWF                     RA++SDFARYNELNLD++F E
Sbjct: 306 ATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQE 365

Query: 354 DAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMF 413
           D+GWKL HGDVFR P +S++LS+LVGSG+Q+FLM+ CSIFFAALG +SP+SRGSL TVMF
Sbjct: 366 DSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMF 425

Query: 414 VLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGV 473
           +LYALFGFVGSYTSMG+YKFF GPYWKAN+I+TP+L+PGAI L+I+A+NFFL+F HSSGV
Sbjct: 426 ILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGV 485

Query: 474 IPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQA 533
           IPA TLFF++FLWF  SIPLSFAGS +A K+C WDEHPTKTNQIARQ P QPWYL+T+ A
Sbjct: 486 IPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPA 545

Query: 534 TLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCL 593
           TLIAGIF FGSIAVELYFIY+SLWFNKIFYMFG                   ITYHSLCL
Sbjct: 546 TLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCL 605

Query: 594 ENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAI 653
           ENW WQWR F +GG+GC++Y+FIH+ILFTKFKLGGF T+VLY+GYS +IS LCC+VTG+I
Sbjct: 606 ENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSI 665

Query: 654 GFFSSMIFIRKIYSRIKVE 672
           GF SSM FIRKIYS IKV+
Sbjct: 666 GFISSMFFIRKIYSSIKVD 684

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/668 (68%), Positives = 538/668 (80%), Gaps = 9/668 (1%)

Query: 7   LALFL--YIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEH 64
           L LF   +++L +AF LPGV+PTTY   DEIPLLVN LTPS+YFQ  D NGK  S +KEH
Sbjct: 6   LVLFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEH 63

Query: 65  FLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIP 124
           FLYS+DYY D+ HFCKPEH+EKQPESLGS+IFGDRIYNSPF+LKMLE+K CV+LCKSTIP
Sbjct: 64  FLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIP 123

Query: 125 GKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTI 184
           GKDAKFIN LIKNGFFQNWL+DGLPAA  VYD +TK+ +YGTGFELGF +  Q + G+  
Sbjct: 124 GKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQA- 182

Query: 185 PSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVV 244
           P+T +    + +  G  L+ R+ KN++  +V+ IE+ +FVNH++IQVEYHDRG G YRVV
Sbjct: 183 PATTKP--KQTTNEGLELETREAKNVQ--MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVV 238

Query: 245 GVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVY 304
           GV VNP+SI+RS+PG C TTG+PL L ED DNDVYFTYSVKF+ S+TVWATRWDKYLH Y
Sbjct: 239 GVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTY 298

Query: 305 DPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDV 364
           DP IQWF                     +A++SDFARYNE NL+++F EDAGWKLGHGDV
Sbjct: 299 DPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDV 358

Query: 365 FRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGS 424
           FRIP KSM+LSVLVGSG+QLFLMI CSIFFAALG +SP+SRGSL TVMF+LYALFGFVGS
Sbjct: 359 FRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGS 418

Query: 425 YTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIF 484
           YTSM VYKFF GPYWK N+++TP ++PG IFL IV +NFFL+FAHSSGV+PA TLFF+I 
Sbjct: 419 YTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMIL 478

Query: 485 LWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGS 544
           LWF  SIPL+FAGS IAHK+C WDEHPTKTNQIARQ P QPWYL+T  AT+IAGIF FGS
Sbjct: 479 LWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGS 538

Query: 545 IAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFI 604
           IAVELYFIY+SLWFNKIFYMFG                   ITYHSLCLENW WQWR FI
Sbjct: 539 IAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFI 598

Query: 605 IGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRK 664
           +GG+GC++Y+F+H+ILFTKFKLGGF T+VLYVGYS +IS L CVVTGAIGF SS+IF+RK
Sbjct: 599 VGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRK 658

Query: 665 IYSRIKVE 672
           IYS IKV+
Sbjct: 659 IYSAIKVD 666

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/666 (68%), Positives = 529/666 (79%), Gaps = 9/666 (1%)

Query: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66
           L L+ +++  KAF LPGV+PTTYR ND IPLLVN LTPS+ +QHKDE+G +VS DKE+FL
Sbjct: 11  LLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFL 70

Query: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126
           YSYDYY ++FHFC+PE VEKQPESLGSVIFGDRIYNSPFQL ML++KEC +LCK+ IPG 
Sbjct: 71  YSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGD 130

Query: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPS 186
           DAKFIN LIKNGFFQNWL+DGLPAAR VYD RTKT++YG GF LGF  V Q    +  P 
Sbjct: 131 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPK 190

Query: 187 TMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGV 246
             E  D +       L+ R+ +N    +V+T EL +F NHF+I +EYHDRG GNYRVVGV
Sbjct: 191 GAETTDKD-----VELETRNDRN----MVKTYELPYFANHFDIMIEYHDRGEGNYRVVGV 241

Query: 247 TVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDP 306
            V P+SI+RSSPG C TTG PL L E  DN+VYFTYSVKF  S T WATRWDKYLHVYDP
Sbjct: 242 IVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDP 301

Query: 307 QIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFR 366
            IQWF                     RA++SDFARYNELNLD++F ED+GWKL HGDVFR
Sbjct: 302 SIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFR 361

Query: 367 IPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYT 426
            P +S+ LS+LVGSG+QLFLM+ CSIFFAALG +SP+SRGSL TVMF+LYALFGFVGSYT
Sbjct: 362 SPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 421

Query: 427 SMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLW 486
           SMG+YKFF+GPYWKANLI+TP+L+PGAI L+I+A+NFFL+F HSSGVIPA TLFF++FLW
Sbjct: 422 SMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLW 481

Query: 487 FSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIA 546
           F  SIPLSFAGS IA KRC WDEHPTKTNQIARQ P QPWYL+TI ATLIAGIF FGSIA
Sbjct: 482 FLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 541

Query: 547 VELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIG 606
           VELYFIY+SLWFNKIFYMFG                   ITYHSLCLENW WQWR FIIG
Sbjct: 542 VELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIG 601

Query: 607 GLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           G GC++Y+FIH+ILFTKFKLGGF T+VLYVGYS +IS LCC+VTG+IGF SSM+F+RKIY
Sbjct: 602 GAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIY 661

Query: 667 SRIKVE 672
           S IKV+
Sbjct: 662 SSIKVD 667

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/666 (68%), Positives = 528/666 (79%), Gaps = 8/666 (1%)

Query: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66
           L L+ +++  KAF LPGV+PTTY+ NDEIPLLVN LTPS+Y+QH+DE G  VS DKE+FL
Sbjct: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66

Query: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126
           YSYDYY D+FHFC+P+HVEKQPESLGSVIFGDRIYNSPF+L ML++KECV LC +TIPG 
Sbjct: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126

Query: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPS 186
           DAKFIN LIKNGFFQNWL+DGLPAAR VYD RTKTN+YG GFELG  +V Q    KT P 
Sbjct: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186

Query: 187 TMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGV 246
                 +E +  G  L  R       ++V+T E  +F NHF+I +EYHDRG G+YRVVGV
Sbjct: 187 -----QAETTNEGLELGTRAEDY---SIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGV 238

Query: 247 TVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDP 306
            VNPLSI+RS  G C T   PL L E++DN+V FTYSVKF  S T WATRWDKYLHVYDP
Sbjct: 239 IVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDP 298

Query: 307 QIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFR 366
            IQWF                     RA++SDFARYNELNL+++F ED+GWKL HGDVFR
Sbjct: 299 SIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358

Query: 367 IPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYT 426
            P  S++LS+LVGSG+QLFLM+ CSIFFAALG +SP+SRGSL TVMF+LYALFGFVGSYT
Sbjct: 359 PPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 418

Query: 427 SMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLW 486
           SMG+YKFF+GPYWKANL++TP+L+PGAI L+IVA+NFFL+  HSSGVIPARTLFF++FLW
Sbjct: 419 SMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLW 478

Query: 487 FSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIA 546
           F  SIPLSF GS IA K+C WDEHPTKTNQIARQ P QPWYL+TI ATLIAGIF FGSIA
Sbjct: 479 FLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 538

Query: 547 VELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIG 606
           VELYFIY+SLWFNKIFYMFG                   ITYHSLCLENW WQWR FI+G
Sbjct: 539 VELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVG 598

Query: 607 GLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           G+GC++Y+FIH+ILFTKFKLGGFVT+VLYVGYS++IS LCC+VTG+IGF SSM F+R+IY
Sbjct: 599 GVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658

Query: 667 SRIKVE 672
           S IKV+
Sbjct: 659 SSIKVD 664

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/657 (67%), Positives = 533/657 (81%), Gaps = 7/657 (1%)

Query: 16  AKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDK 75
            +AF LPGV+PTTY   DEIPLLVN L+PS+Y+QHK++ GKDVSSDK  +LYSYDYY D+
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 76  FHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLI 135
           FHFC+PE +EKQPESLGS++FGDRIYNSPFQL MLE+K+C +LCKSTIPG DAKFIN LI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 136 KNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSED 195
           KNGFFQNWL+DGLPAA   +D+RT T++YG+GFELG  DV Q V       T        
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD-----ETEARTKVAA 189

Query: 196 SKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIER 255
           +  GA LDARD KN+K   ++ +EL +FVNH++I++EYHDRGNG+YRVVGV VNP+SI+R
Sbjct: 190 ANQGAELDARDAKNVKT--IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR 247

Query: 256 SSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFXXXX 315
           SSPG+C +TG+PLTL ED+DNDVYFTYSV F+ S+T WATRWDKYLHVYDP IQWF    
Sbjct: 248 SSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVN 307

Query: 316 XXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLS 375
                            +A+++DFARYNE NLD+EF EDAGWKL HGDVFRIP KSM+LS
Sbjct: 308 FSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLS 367

Query: 376 VLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKFFH 435
           VLVGSG+QLF+MI  +IFFAALG +SP+SRG L TVMF+LYALFGFVGSYTSMGVYKFF 
Sbjct: 368 VLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFR 427

Query: 436 GPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSF 495
           GPYWKAN+++TPIL+PG+IF+ I+AMNFFL++ HSSGVIPA+TLFF++ LWF  SIP +F
Sbjct: 428 GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAF 487

Query: 496 AGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSS 555
           AGS +A+K+C W+EHPTKT QIARQ P QPWYL+TI AT IAGIF FGSIAVE+YFIY+S
Sbjct: 488 AGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTS 547

Query: 556 LWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGLGCSVYMF 615
           LW+NKIFYMFG                   ITYHSLCLENW+WQWRSFI+GG+GC++Y+F
Sbjct: 548 LWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVF 607

Query: 616 IHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672
           IH+ILFTKFKLGGF TVVLY+GYS IIS LCC+VTG+IGF SSM F+RKI+S IKV+
Sbjct: 608 IHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/667 (66%), Positives = 524/667 (78%), Gaps = 10/667 (1%)

Query: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66
           LAL        AF LPGV+PTTY+ANDEIPLLVN L+PS+Y+QH+ E+G+++  DK  +L
Sbjct: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYL 69

Query: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126
           YSYDYY D+FHFC+PE + K+PESLGS+IFGDRIYNSP+Q+KMLE+K CV LC + IPGK
Sbjct: 70  YSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129

Query: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG-GKTIP 185
           DA+FIN LIKNGFFQNWL+DGLPAAR V+D  T +++YG GFELG  +V Q V   KT P
Sbjct: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHP 189

Query: 186 STMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVG 245
                   ED    A L  RD KN++  +++ +EL +F NH +I VEYHDRG GN RVVG
Sbjct: 190 K-------EDDSGSAKLSTRDAKNVQ--MLKNVELPYFANHHDITVEYHDRGEGNLRVVG 240

Query: 246 VTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYD 305
           VTV+P+SI+RSSPG C T+G+PL L E  DN+VYFTYSV+F+ASDTVWATRWDKYLH YD
Sbjct: 241 VTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYD 300

Query: 306 PQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVF 365
           P IQWF                     +A+RSDFARYNELNLDNEF ED+GWKL HGDVF
Sbjct: 301 PTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVF 360

Query: 366 RIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSY 425
           RIP KSM+LS+LVGSGIQLFLMI  SIFFAALG +SP+SRGSL TVMF+LYALFGFVGSY
Sbjct: 361 RIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSY 420

Query: 426 TSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFL 485
           TSMGVYKFF GPYWKAN+I+TP+L+PG + L IV +N FLL AHSSG IPA+TLFFI+ L
Sbjct: 421 TSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLL 480

Query: 486 WFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSI 545
           WF +S+P + AGS IAHK+C WDEHPTKTNQ+ARQ P QPWYL+T+ AT IAGIF FGSI
Sbjct: 481 WFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSI 540

Query: 546 AVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFII 605
           AVELYFIY+SLW+NKIFYMFG                   ITYHSL LENW WQWRSFI+
Sbjct: 541 AVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIV 600

Query: 606 GGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKI 665
           GG+GC++YMF+H+ILFTK KLGGFVT+VLYVGYS +IS LCC+VTG+IGF SSM F+R+I
Sbjct: 601 GGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRI 660

Query: 666 YSRIKVE 672
           YS IKVE
Sbjct: 661 YSSIKVE 667

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/672 (63%), Positives = 513/672 (76%), Gaps = 15/672 (2%)

Query: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60
           M K I+  L +Y+AL  AF LPGV+PTTY   DEIPLLVN LTPS+ FQHKD+ G D+  
Sbjct: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61

Query: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120
           +KEHFLYS+DYY  K HFCKPEHVEKQPESLGS++FGDRIYNSPF +KMLE++EC +LCK
Sbjct: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121

Query: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180
            TIP  DAKFIN LIKNGFFQNWL+DGLPAAR ++D +TK+++YGTGF LG   V+Q VG
Sbjct: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181

Query: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240
           G              SK      AR+ KN+  N+V  +E+    NH++I VEYHDRG GN
Sbjct: 182 GLA-----------SSKLNLENPAREAKNVN-NMVHNVEIPFLFNHYDINVEYHDRGEGN 229

Query: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300
           YRVVGVTV+P S   S+   C+     L L+E +DN+V F+YSV+FI S+TVWATRWDKY
Sbjct: 230 YRVVGVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKY 286

Query: 301 LHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLG 360
           LHVYDP IQWF                     RA++SDFARY E NLD+ F +D+GWKLG
Sbjct: 287 LHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLG 346

Query: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420
           HGDVFRIP KSM+LS+LVGSG QLFLM+  SIFFAA+G++SP+SRGSLP+ MF+LYALFG
Sbjct: 347 HGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFG 406

Query: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480
           F GSY SMGVYKFF+GPYWKAN+I+TPIL+PG +F+ IV +NFFLLF+ SSG IP   L 
Sbjct: 407 FCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALI 466

Query: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540
           F+I LWF +SIPLS AGS IA+K+C W EHPTKTN+IARQ P QPWYL+T+ ATLIAG+F
Sbjct: 467 FVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLF 526

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQW 600
            FGSIAVELYFIYSSLWFNKIFYMFG                   ITY+SL LENW WQW
Sbjct: 527 PFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQW 586

Query: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660
           RSFI+GG+GC+ Y+F+H+I+FTKFKLGGF T+VLYVGYS IISALC VVTGAIGF SSM+
Sbjct: 587 RSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSML 646

Query: 661 FIRKIYSRIKVE 672
           F++KIYS +KV+
Sbjct: 647 FVKKIYSSVKVD 658

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/662 (65%), Positives = 507/662 (76%), Gaps = 25/662 (3%)

Query: 11  LYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYD 70
           L  +L KAF LPGV+PTTY +NDEI LLVN LTPS+ FQH+DE+G  V  DKEH+LYSYD
Sbjct: 11  LLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYD 70

Query: 71  YYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKF 130
           YY  KFHFCKPE+V +QP SLGSVIFGDRI+NSPF+L MLE+KECV LC S IPG+DAKF
Sbjct: 71  YYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKF 130

Query: 131 INTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEE 190
           +N LIKNGF QNWL+DGLPA R ++DSRT +N+YGTGF+LGF DV +             
Sbjct: 131 VNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS---------- 180

Query: 191 LDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNP 250
            DS D +                +++T+E+ +  NH++I +EYHDRGN NYRVVGVTV+P
Sbjct: 181 -DSNDEEK--------------KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDP 225

Query: 251 LSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQW 310
           +SI+RSS  +C      LTL E ++N+V+FTYSVKFI SDTVWATRWDKYLHVYDP IQW
Sbjct: 226 VSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQW 285

Query: 311 FXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPK 370
           F                     RA+++D +RYNE NLDNEFHED+GWKL HGDVFRIPP+
Sbjct: 286 FSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPR 345

Query: 371 SMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGV 430
           S++LS+LVGSG+QLFLMI CSI FAALG +SP+SRGSLPTVMF+LYALFGFVGSYTSM +
Sbjct: 346 SLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAI 405

Query: 431 YKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVS 490
           YKFF GP WK NL++TP+L+PG IF+ I+ +NFFL+F  SSG IPA TLF II LWF  S
Sbjct: 406 YKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFS 465

Query: 491 IPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELY 550
           IPLSFAGS IAHKRC+ D HPTKTNQIARQ P QPWYL+TI  +LIAG+F F SIAVELY
Sbjct: 466 IPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELY 525

Query: 551 FIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGLGC 610
           FIY+SLWFNKIFYMFG                    TYHSLCLENW WQWRSFIIGG GC
Sbjct: 526 FIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGC 585

Query: 611 SVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIK 670
           ++Y+FIH+ILFTKFKLGGF TVVLY+GYS +IS LCC+VTG+IGF SSM FIRKIYS +K
Sbjct: 586 AIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVK 645

Query: 671 VE 672
           V+
Sbjct: 646 VD 647

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/686 (60%), Positives = 507/686 (73%), Gaps = 20/686 (2%)

Query: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66
           L L L++A    F LPG +P TY+  D IPLLVN LTPS+ FQH D++G ++  DK   L
Sbjct: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65

Query: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126
           Y YDYYN+K HFC+PE +EKQPESLGSVIFG++IYNSPF +KMLED ECV LC +TIPGK
Sbjct: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125

Query: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPS 186
           DAKFIN LIKNGF QNWL+DGLPAAR ++DSRT T +YG GFELGF +V+Q VGGK +  
Sbjct: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185

Query: 187 TMEELD--SEDSKT-----------------GATLDARDPKNIKPNLVQTIELTHFVNHF 227
           + +EL     D+K                   + L+ R+ KN+  N+V  +E+  F NHF
Sbjct: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245

Query: 228 NIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACSTTGE-PLTLVEDKDNDVYFTYSVKF 286
           +I+VEYHDRGNG++RVVGV VNP+S++     +C+   +  L L E+KDN+V FTYSVKF
Sbjct: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305

Query: 287 IASDTVWATRWDKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELN 346
             SDT WATRWDKYLH+YDP+IQWF                     RA++SD +RYNE N
Sbjct: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365

Query: 347 LDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRG 406
           L +EF ED+GWKL HGDVFR P  SM+LSVLVGSGIQLFLMI  SI  +ALG++SP+SRG
Sbjct: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRG 425

Query: 407 SLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLL 466
           SLPT MF+ YA+FGFVGSYTSMG+YKFF GPYWKAN+I+TP+LLPG IFL ++ MN  L 
Sbjct: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485

Query: 467 FAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPW 526
           F  SS VIP  TL F++FLW   SIPL+FAGS I++K+C WDEHPTKTN+I RQ P QPW
Sbjct: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545

Query: 527 YLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXI 586
           +L+T+ ATLI G+ SFGSIAVELYFIYSSLWFNKIFYMFG                   I
Sbjct: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605

Query: 587 TYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALC 646
           TY +LC ENW+WQWRSF IGGLGCS+Y+FIH+ILFT+FKLGGF T+VLYVGYSF+IS L 
Sbjct: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665

Query: 647 CVVTGAIGFFSSMIFIRKIYSRIKVE 672
           C+VTGAIGF  SM F+R+I++ IKV+
Sbjct: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/664 (60%), Positives = 496/664 (74%), Gaps = 6/664 (0%)

Query: 13  IALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYY 72
           +++   F LPGV+PTTY   D IPLLVN LTPS++F+HKD +G ++SSDKE+FLYSYDYY
Sbjct: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74

Query: 73  NDKFHFCKP--EHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKF 130
             K HFCKP    ++KQPESLGS++FGDRIYNSPF+LKML D+ C  LC + IPG DAKF
Sbjct: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134

Query: 131 INTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEE 190
           IN LIK+GF QNWL+DGLPAAR +YD  TK+++YG+GFELG  ++ Q V      +T ++
Sbjct: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194

Query: 191 LDSEDSKTGATLDARDPKNIKPN--LVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTV 248
              ED  +   LD       + N  LV ++E T+F NHF+I +EYHDRGN  YR+VGVTV
Sbjct: 195 PIVEDVLS-QELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253

Query: 249 NPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQI 308
           NP+S++R S   C T    L L E  D DV FTYSV F  SDTVWATRWDKYLH+YDP I
Sbjct: 254 NPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTI 312

Query: 309 QWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIP 368
           QWF                     +A+++DF RYNE NL++ F ED+GWKL HGDVFRIP
Sbjct: 313 QWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372

Query: 369 PKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSM 428
            KSM+LS+ VGSG QLF MI   +  AALG +SP++RGSLPT+MF+LYA+FGFVGSYTSM
Sbjct: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432

Query: 429 GVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFS 488
           GVY+FF+GPYWKAN+I+TP+++PG IF+ I++MN FL+F HSS V+P  TL  ++ LW  
Sbjct: 433 GVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIV 492

Query: 489 VSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVE 548
           +S+PLSFAGS I+ KRC W +HPTKTN++ RQ P QPWYL+T+ ATLI GIF FGSIAVE
Sbjct: 493 LSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVE 552

Query: 549 LYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGL 608
           LYFIYSSLWFNKIFYMFG                   +TYHSLCLENW WQWRSFIIGG+
Sbjct: 553 LYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGI 612

Query: 609 GCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSR 668
           GCS+Y+FIH+ILFT+FKLGGF+T+VLYVGYS +I+ LC +VTGAIGF S+M F++KIYS 
Sbjct: 613 GCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672

Query: 669 IKVE 672
           IKVE
Sbjct: 673 IKVE 676

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/666 (56%), Positives = 502/666 (75%), Gaps = 8/666 (1%)

Query: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66
           L+L   +++ +AF+LPG+ P TY+  D+IPLLVN LTPS++F HK+E GKD+S+ K++ +
Sbjct: 6   LSLLFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVV 65

Query: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126
           +SYDYY +KFHFC+P H+EK   S+GS++FGDRIYNSPFQL MLE+K CV LC+S IPGK
Sbjct: 66  HSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGK 125

Query: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPS 186
           DA+FIN LIKNG++QNW +DGLPAAR VYD RTK+++YG GFELG  +++QT G K +P 
Sbjct: 126 DAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPD 185

Query: 187 TMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGV 246
           ++ ++        + L  RD KN+  NL++ +E+ +FVNHF+I +EYH+RGNGNYRVVG 
Sbjct: 186 SVHDI--------SDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGA 237

Query: 247 TVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDP 306
           TVNP+SI R S G C+ TG+ LTL E++DN+V+ TYSV F+ S T W TRWDKYLHVYDP
Sbjct: 238 TVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDP 297

Query: 307 QIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFR 366
           +IQWF                     +A++SDFARYN +NLD++  E++GWKL HG VFR
Sbjct: 298 KIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFR 357

Query: 367 IPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYT 426
           IP   M+LS+LVGSG QLFL+I+C++F AA+ ++SP  RG+LPT M +LY LFGF+ SY 
Sbjct: 358 IPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYV 417

Query: 427 SMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLW 486
           SMGVYKFF GPYWK N+++TPIL+PG I +  +A+N FL+F+ SS V+PA+T+  +I LW
Sbjct: 418 SMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLW 477

Query: 487 FSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIA 546
           F+VSIPLS AGS +A K+C WDEHPT TNQIA+  P Q WYL+TI A+LI G+FSFGSI+
Sbjct: 478 FAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSIS 537

Query: 547 VELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIG 606
           V+LYFIY+SLWFN IFYM+G                    TYHSLC ENW WQWR F IG
Sbjct: 538 VQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIG 597

Query: 607 GLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           GLGCS+Y+ +H++ F + KLGGF  ++LY+GYS +++AL  +VTG++GF SSM FI++I+
Sbjct: 598 GLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIF 657

Query: 667 SRIKVE 672
           S +KV+
Sbjct: 658 SSVKVD 663

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/659 (61%), Positives = 485/659 (73%), Gaps = 11/659 (1%)

Query: 15  LAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYND 74
           +A AF LPGV+PTTY   DEIPLLVN LTPS YFQH D+ G  +S DKE FLYSYDYY D
Sbjct: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71

Query: 75  KFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTL 134
           KFHFC+PE++ KQPESLGS+IFGDRIYNSPF+L MLE+K CV LCKS IP  DAKFIN L
Sbjct: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131

Query: 135 IKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSE 194
           I+NGFF NWLVDGLPAAR ++D RT + +YG GFELGF DV  T+         E+ D++
Sbjct: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTI---------EDPDTK 182

Query: 195 DSKTGATLDARDP-KNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI 253
                  ++  D  K +K    +  EL++F+NHF+I++EYHDRG  NYRVVGV+V P SI
Sbjct: 183 KVSESDYIEIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASI 242

Query: 254 ERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFXX 313
           +R S  +C T GEPL L ED DN V+FTYSV F+ S T+WATRWDKYLHVYDPQIQWF  
Sbjct: 243 KRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSL 302

Query: 314 XXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMV 373
                              RA+++D +RYNELNLD+EF E+ GWKL HGDVFR P ++M+
Sbjct: 303 ISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTML 362

Query: 374 LSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKF 433
           LSVLVGSG QLFLM   +I FA LGL+SP+SRGSL TVMF+LYALFG  GSYTSM VYKF
Sbjct: 363 LSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKF 422

Query: 434 FHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPL 493
           F+G  WK N+I+TPIL+P  IF+ ++ +N FL+F HSSG IP  T+  I+ LWF  SIPL
Sbjct: 423 FNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPL 482

Query: 494 SFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIY 553
           S AGS I+ K+ +WD  PT TNQIARQ P QPWYL+T+ A+LIAG F FGSI VELYFIY
Sbjct: 483 SVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIY 541

Query: 554 SSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGLGCSVY 613
           SSLWFNKIFYMFG                   +TY+SLC+ENW WQWR F IGG GC+ Y
Sbjct: 542 SSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFY 601

Query: 614 MFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672
           +F+HAILFTKFKLGG  TVVLY+GYS +IS LCC++TGA+GF SS+ F+RKIY  IKV+
Sbjct: 602 VFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/663 (58%), Positives = 490/663 (73%), Gaps = 6/663 (0%)

Query: 12  YIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDY 71
           +I  + AF +PG+S  TY   D I L VNRLTPS+YF+H DENG+ V++DKEHFLYSYDY
Sbjct: 15  HIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDY 74

Query: 72  YNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFI 131
           Y DKFHFC+PE VE++ ESLGSV+FGDRIYNSPF+L MLE KECV LCK+TIP  DAKFI
Sbjct: 75  YYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFI 134

Query: 132 NTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGK--TIPSTME 189
           N LIKNGFF NWL+DGLP+AR +YDS+T++ +Y +GF LG   V+   GG   TIP  + 
Sbjct: 135 NKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPG-VS 193

Query: 190 ELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVN 249
           +L +E  K       R+ KN+   L+   E+ +F NHFNI +EYHDRGN NYRVVGVTV+
Sbjct: 194 KLVNEAVKA---YKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVD 250

Query: 250 PLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQ 309
           P+SI+R    +C+ TG  L L E+ +N V FTYSV FI S+T WATRWDKYLH YDP IQ
Sbjct: 251 PISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQ 310

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPP 369
           WF                     RA++ D +RY +LNLDN F ED+GWKL HGDVFR+P 
Sbjct: 311 WFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPR 370

Query: 370 KSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMG 429
           K+MVLS+ VGSG+QLFLMI+C +  AALG +SP+ RG+LPT MFVLYA+FGFVGSYTSMG
Sbjct: 371 KAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMG 430

Query: 430 VYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSV 489
           VYKFFHGPYWKAN+I+TP+L+PG++ LLI+ +NFFLL  HSSG IPA T+  +I LW  V
Sbjct: 431 VYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLV 490

Query: 490 SIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVEL 549
           S+PLSF GS++A K+C W+++PT  N+I R+ P QPWY+R+I   L++GI  FG+IAVEL
Sbjct: 491 SVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVEL 550

Query: 550 YFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGLG 609
           YFIYSSLW+NKIFYMFG                   + YHSLCLENW WQWRSF+ GGLG
Sbjct: 551 YFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLG 610

Query: 610 CSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRI 669
           C+ Y+F+++I FT+FK  GFV+++LY+GYS +I  + C++TGA+ F  +M F+++I++ I
Sbjct: 611 CAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSI 670

Query: 670 KVE 672
           KV 
Sbjct: 671 KVH 673

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/658 (59%), Positives = 487/658 (74%), Gaps = 11/658 (1%)

Query: 15  LAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYND 74
           L +AF LPGV+PTTY   D++PLLVN LTPS +++H D +  D + DKE FLYSYDYY  
Sbjct: 19  LVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYK 77

Query: 75  KFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTL 134
           KFHFC+P  ++KQPESLGS+IFGDRIYNSPF+L++L++ EC +LCKS IPGKDAKFIN L
Sbjct: 78  KFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKL 137

Query: 135 IKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSE 194
           I NGFFQNW++DGLPAAR + D++T   +YG GFELG  DV         P T    D  
Sbjct: 138 ILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYE----PDTRSLHDEL 193

Query: 195 DSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIE 254
           + +  A  +   P +      +  E+ +FVNH++IQ+EYHDRG  NYR+VGVTVNP SI+
Sbjct: 194 ELQLNAKKNVLSPGD------KVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIK 247

Query: 255 RSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFXXX 314
           R SP +C +TG+ L L E +DN+VYFTYSVKFI SDTVWATRWDKYLHVYDP+IQWF   
Sbjct: 248 RDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLI 307

Query: 315 XXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMVL 374
                              A+++D ARYNELNLD +F E+ GWKL HGDVFR P K+++L
Sbjct: 308 NFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLL 367

Query: 375 SVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKFF 434
           SVLVGSG QL LM+  +I FA LG +SP+SRGSL TVMF+LYA+FG  GS+TSM  YKFF
Sbjct: 368 SVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFF 427

Query: 435 HGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLS 494
           +G  W+ NL++TP+L+PG+I  +++ +NFFL+F HSSG IP +T+  ++ LWF +SIPLS
Sbjct: 428 NGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLS 487

Query: 495 FAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYS 554
             GS IA K+C W+EHPTKTNQIARQ P QPWYL+TI   L+AGIF FGSIAVELYFIYS
Sbjct: 488 AIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYS 547

Query: 555 SLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGGLGCSVYM 614
           SLWFNKI+YMFG                   +TYHSLC+ENW WQWRSF+IGG GC+ Y+
Sbjct: 548 SLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYV 607

Query: 615 FIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672
           F H+ILFTKF+LGG  T+VLY+GYS +IS LCC+VTGAIGF SS+I +RKIYS +KV+
Sbjct: 608 FCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/689 (58%), Positives = 489/689 (70%), Gaps = 30/689 (4%)

Query: 6   WLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHF 65
           +L +   ++   AF LPGV+P+TY   DE+PLLVN LTPS+ +Q KD+ GK V S +E  
Sbjct: 5   YLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKM 63

Query: 66  LYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPG 125
           LYS+DYY  K HFCKPE + KQP+SLGS++FGDRIYNSPF +KML+ +  V LC  TIPG
Sbjct: 64  LYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPG 123

Query: 126 KDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIP 185
            DAKFIN LIKNGFFQNWL+DGLPAAR +YDS T T +Y  GF LGF ++K+ VGG  IP
Sbjct: 124 SDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIP 183

Query: 186 STMEELDS----------------------EDSKTGATLDARDPKNIKPNLVQTIELTHF 223
              +  DS                      EDS      + R+PK I   LV  +E  + 
Sbjct: 184 MDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKK---EKREPKRIS-KLVHNVEFPYL 239

Query: 224 VNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYS 283
            NH+ I VE HDRG GNYRVVGVTV+P S   S   A    G  L L E KDN+V F+YS
Sbjct: 240 ANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDS---ANPEKGNKLFLDEKKDNEVTFSYS 296

Query: 284 VKFIASDTVWATRWDKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYN 343
           V FI S+TVWATRWDKYLH Y+P IQWF                     +A++SDFARY 
Sbjct: 297 VNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYE 356

Query: 344 ELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPA 403
           E NLDN F+ED+GWKLGHGDVFRIP +SM+LS+LVGSG QLFLMII SIF AA+G++SP+
Sbjct: 357 EFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPS 416

Query: 404 SRGSLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNF 463
           SRGSLP+ MF  YALFGF GSY SM VYKFF GPYWKAN+I+TP+L+PG I + I+ +NF
Sbjct: 417 SRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNF 476

Query: 464 FLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPR 523
           FLLF HSSG IP   L  I+ +WF +S+PLSF GS +A+KR  W EHPTKTNQIARQ P 
Sbjct: 477 FLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPF 536

Query: 524 QPWYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXX 583
           Q WYL+TI A LIAGIF FG+IAVELYFIY+SLWFNKIFYMFG                 
Sbjct: 537 QSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVT 596

Query: 584 XXITYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIIS 643
             ITY SLC+ENW+WQWRSF IGG+GCS+Y+FIH+ILFTKFKLGGF T++LY+GY+ ++S
Sbjct: 597 VLITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLS 656

Query: 644 ALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672
            L C+VTGA+GF SSMIF+RKIYS ++V+
Sbjct: 657 ILSCIVTGAVGFISSMIFVRKIYSNVRVD 685

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/671 (60%), Positives = 489/671 (72%), Gaps = 20/671 (2%)

Query: 17  KAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKF 76
           + F LPGV+PTTY   D IPLLVN LTPS+YF+H D++GKD + D+E FLYSYDYY DKF
Sbjct: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76

Query: 77  HFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIK 136
           HFCKPE +EKQ ESLGS+IFGDRIYNSPF+L+ML+DKEC ALC S IP  DAKFIN LI 
Sbjct: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136

Query: 137 NGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTV-------------GGKT 183
           NGFFQNWLVDGLPAAR   D RTK+ +Y  GFELGF DV                  G T
Sbjct: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196

Query: 184 IPSTMEELDSEDSKTGATLDAR--DPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNY 241
            P   ++     SK+      +  DPK     LV+ +E  +F NHFNI+V+YHDRGNG+Y
Sbjct: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKE----LVKQLETAYFANHFNIEVQYHDRGNGDY 252

Query: 242 RVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYL 301
           RVVGV VNP SI+R S  +C+ TGE L L E+++  V+F+YSVKF  SDTVWATRWDKYL
Sbjct: 253 RVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYL 312

Query: 302 HVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGH 361
           HVYDP+IQW+                     R +R D +RYN+LNLD++F E+ GWKL H
Sbjct: 313 HVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372

Query: 362 GDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGF 421
           GDVFR P KS++LSVLVGSG QLF+M  C+I FA LGL+SP+SRGSL TVMF+LYALFG 
Sbjct: 373 GDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGS 432

Query: 422 VGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFF 481
           +GSYTSM  YKFF G YWK N+I+TPIL+PG +F +++ +NFFL+   S+G IP  T+  
Sbjct: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492

Query: 482 IIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFS 541
           I+ LWF  SIPLS AGS IA K+C+W+EHPTKT QI RQ P QPWYL+T  A LIAGIF 
Sbjct: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552

Query: 542 FGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWR 601
           FGSIAVELYF+YSSLWFNKIFYMFG                   +TY+SLCLENW WQWR
Sbjct: 553 FGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWR 612

Query: 602 SFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIF 661
            F IGG GC++Y+F+HAILFTKFKLGGFVT+VLYVGYS +IS L C++TGA+GF SS+ F
Sbjct: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672

Query: 662 IRKIYSRIKVE 672
           +R+IYS IKV+
Sbjct: 673 VRRIYSSIKVD 683

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/690 (58%), Positives = 487/690 (70%), Gaps = 21/690 (3%)

Query: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60
           M   I L   L+ +    F LPGV+PTTY   D IPLLVN LTP++Y+QH DE+G D+  
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG- 59

Query: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120
           DKE  LYSYDYY  KFHFC+PE +EKQ ESLGS+IFGDRIYNSPFQ++ML++KEC +LC 
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFT------- 173
            +IP  DAKFIN LI NGFFQNWLVDGLPAAR   D RTK+ +Y  GFELG+        
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSEL 179

Query: 174 -----------DVKQTVGGKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTH 222
                      D   + G     S  + LD+  +K   +L  R   +    LV+ +E  +
Sbjct: 180 RMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKR--SLAKRKQVSNTKELVKQLETPY 237

Query: 223 FVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTY 282
           F NHF I+V+YHDRGNGNYRVVGV VNP SI+R SP  C  TGE L L E +  +V+F+Y
Sbjct: 238 FANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSY 297

Query: 283 SVKFIASDTVWATRWDKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARY 342
           SVKF  S+TVWATRWDKYLHVYDP+IQWF                       +  D +RY
Sbjct: 298 SVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRY 357

Query: 343 NELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSP 402
           N++NLD++F E+ GWKL HGDVFR P +S++LSVLVGSG QLFLM  C+I FA LGL+SP
Sbjct: 358 NQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSP 417

Query: 403 ASRGSLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMN 462
           +SRGSL TVMF+LYALFG  GSYTSM  YKFF GPYWK N+++TPIL+PG +F +++A+N
Sbjct: 418 SSRGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALN 477

Query: 463 FFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSP 522
           FFL+   S+G IP  T+  I+ LWF  SIPLS AGS IA K+CKWDEHPTKT QI RQ P
Sbjct: 478 FFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIP 537

Query: 523 RQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXX 582
            QPWYL+T+ A+LIAGIF FGSIAVELYFIYSSLWFNKIFYMFG                
Sbjct: 538 FQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLI 597

Query: 583 XXXITYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFII 642
              +TY+SLCLENW WQWR F IGG GC++YMFIHAILFTKF+LGGF T+VLYVGYS ++
Sbjct: 598 TVLLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVM 657

Query: 643 SALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672
           S L C++TG +GF SS+ F+R+IYS +KV+
Sbjct: 658 SLLSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/665 (56%), Positives = 468/665 (70%), Gaps = 15/665 (2%)

Query: 8   ALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLY 67
           AL L  A+++A  LPG+SPT Y A  EI L VN LTPS +FQHKD++G ++ SDKEH+LY
Sbjct: 7   ALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLY 66

Query: 68  SYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKD 127
           SYDYYN K HFCKPE+V +Q ESLGSV+FGDR+YNSPF+L MLEDK CV+LCKS IPG+D
Sbjct: 67  SYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGED 126

Query: 128 AKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPST 187
           A FIN LIKNGF  NWLVDGLPA   + + R  + +   GF LG  ++ Q V    + + 
Sbjct: 127 AAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP 186

Query: 188 MEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVT 247
            EE       TG +           N+V  +EL H  NH++I ++YH+   G YR+VGV 
Sbjct: 187 REE-------TGISAHGS-------NVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVE 232

Query: 248 VNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQ 307
           V P SI+++S  +C  TGE ++L ED+DN+V +TYSV+++     WATRWD Y   YD  
Sbjct: 233 VEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTT 291

Query: 308 IQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRI 367
           +QWF                     RA++SDFARYNELNLD+EFHE++GWKL HGDVFR+
Sbjct: 292 VQWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRM 351

Query: 368 PPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTS 427
           P KS++LSVLVGSG+QL L+ +  I  AA+   +  SR  LPT+ FVLYALFGFVGSY S
Sbjct: 352 PNKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYAS 411

Query: 428 MGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWF 487
           MGVY+FF GPY K N+I+TP L+PG I L I+++NFFLL AHSS  IP   LF ++ LW 
Sbjct: 412 MGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWL 471

Query: 488 SVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAV 547
            +S+PLS AGS  A K C WD+HPTKTNQIARQ P QPWYL+T+ A L+AGIF F SIAV
Sbjct: 472 IISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAV 531

Query: 548 ELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGG 607
           ELYFIY+SLWF++ FYMFG                   ITYHSLCLENW WQWRSFI+GG
Sbjct: 532 ELYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGG 591

Query: 608 LGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYS 667
           LG +VY+FIH+I FT+FKL GF T+VLYVGYS +IS LCC+ TGA+GFFSSM  +RKI+S
Sbjct: 592 LGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFS 651

Query: 668 RIKVE 672
            +KV+
Sbjct: 652 SVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/627 (57%), Positives = 462/627 (73%), Gaps = 8/627 (1%)

Query: 46  IYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPF 105
           +++ HK++ G+D+S+D +  +YSYDYY +K HFCKPEHVEK   S+GSV+FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 QLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYG 165
           QL ML++K C  LC STI G+DAKFIN LIKNG++QNWL+DGLPAAR VYD+RTK+N+YG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 TGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVN 225
            GFELG  +++QT G K +P++ +        T   L  RD KNI  NL+Q IE+ +FVN
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSAD--------TFRDLHKRDAKNIVQNLMQDIEVPYFVN 172

Query: 226 HFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVK 285
           HF+I++EYHDRGN NYRVVGVTVNP+SI+RS  G C  TG+ L+L E + N ++FTYSV+
Sbjct: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232

Query: 286 FIASDTVWATRWDKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNEL 345
           FI S+T W TRWDKYLHVYDP IQW                      +A++SDF+RY EL
Sbjct: 233 FIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGEL 292

Query: 346 NLDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASR 405
           NLD    EDA WKLGHGDVFR P   M+LS+LVGSG+QLFLMIIC+IF  A+GL++P SR
Sbjct: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352

Query: 406 GSLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFL 465
           G+LPTVMF+LY  F F+ S+ SMGVYKFF+G  W  N I+TP L+PG + L+I+ +N FL
Sbjct: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFL 412

Query: 466 LFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQP 525
           +F HSSGVIP  T   +I LWF + +PLS  GS +A K C WD HPTKTN +++  P Q 
Sbjct: 413 IFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472

Query: 526 WYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXX 585
           WYL+TI A+LI G+FSFGS++VELYF+Y+SLWFNKIFYM+G                   
Sbjct: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVL 532

Query: 586 ITYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISAL 645
            TY+SL  ENW WQWRSF+I GLGCS Y+F+H++LFT+ KLGGF   +LY+GYSF+I++L
Sbjct: 533 FTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592

Query: 646 CCVVTGAIGFFSSMIFIRKIYSRIKVE 672
             VVTGA+GF SSM+F+R IYS +KV+
Sbjct: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/667 (53%), Positives = 461/667 (69%), Gaps = 20/667 (2%)

Query: 6   WLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHF 65
           W+A   ++ LA+ F LPG +PTTYR  D IPLLVN +TP+++    D  G D   DKE +
Sbjct: 7   WVA---WLGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERY 61

Query: 66  LYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPG 125
           LY+YDYY  + H C+P+ +EK  ESLGS+IFGDR++NSPF+LKMLE+K CVALC+ T+P 
Sbjct: 62  LYAYDYYYPRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPA 121

Query: 126 KDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIP 185
           +DAKFIN LI++GFF NWLVDGLPA R ++D+RT T +YGTGFELG          + I 
Sbjct: 122 EDAKFINQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG----------RVIR 171

Query: 186 STMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVG 245
            T E+ + E+      ++ +  + ++P     + + +F+NHF I V+YH R     RVVG
Sbjct: 172 GT-EDRNQEEP---GEIELQTRRVLQPG-ESVVAVPYFINHFEITVDYHKRAEDELRVVG 226

Query: 246 VTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYD 305
           V+V P S++      C+ +G  L L E  D  V FTYSV+F  SD  WATRW KYLHVYD
Sbjct: 227 VSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYD 286

Query: 306 PQIQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVF 365
           P++QW+                     RA+++D  RYN+ NLDNEF ED GWKL H DVF
Sbjct: 287 PKVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVF 346

Query: 366 RIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSY 425
           R P K+++LSV VGSG QLFLM  C++F A LG +SP+SRGSL T+MFVLYA+FG  GSY
Sbjct: 347 RSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSY 406

Query: 426 TSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFL 485
            SM  YK F G  WK N+++TP+L+PG IF  ++ MNFFL+   SSG +P  T+  I+ L
Sbjct: 407 LSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVL 466

Query: 486 WFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSI 545
           WF +SIP+S  GS  A K+  WD+HPTKT+QIA+Q P QPWYLRT  A  IAG+F FG+I
Sbjct: 467 WFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAI 526

Query: 546 AVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFII 605
           AVELYFIY+S+WFN +FYMFG                   +TY+SLC+ENWSWQWRSFII
Sbjct: 527 AVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFII 586

Query: 606 GGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKI 665
           GG+GCS Y+FI++ILFTKF+LGGFVT+VLYVGYS +IS L C+VTG IGF SS+ F+RKI
Sbjct: 587 GGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKI 646

Query: 666 YSRIKVE 672
           YS IKV+
Sbjct: 647 YSSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/665 (45%), Positives = 400/665 (60%), Gaps = 65/665 (9%)

Query: 8   ALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLY 67
           +  L   ++  F  PGVSP TY   DEIPLLVN L                SSD   FL+
Sbjct: 6   SFLLCAGVSYGFYFPGVSPVTYHIGDEIPLLVNYL----------------SSD---FLW 46

Query: 68  SYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKD 127
           + DYY+D    CKP  +++Q ESLGSVIFGDR+YNSPF++ ML++ ECV LC +TI   D
Sbjct: 47  NIDYYSDSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---D 103

Query: 128 AKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPST 187
               NT     +  NWLVDGLP      D  +  N Y    EL                 
Sbjct: 104 TALWNTFFGYRYSYNWLVDGLPVLG--IDGTSDANGYHNNSELFMG-------------- 147

Query: 188 MEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVT 247
                                       Q  E  +  NHF+I + Y+DRG G YRVV   
Sbjct: 148 ---------------------------YQADEQKYIYNHFDIYIHYNDRGKGEYRVVFAE 180

Query: 248 VNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQ 307
             P+S+ R+    CS   +P+ +      ++ FTYSV F  SD  W+TRWD+YLHVYD  
Sbjct: 181 AKPISLPRTGSELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFD 240

Query: 308 IQWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRI 367
           IQ                       R ++ D A Y+E NLD+EF +D  WK+ HG+VFR 
Sbjct: 241 IQLAELISFSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRS 300

Query: 368 PPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTS 427
           P K+++LSV VGSG QLF M +C++   + G +SP++RGSL TVMFVLYALFG VGSYTS
Sbjct: 301 PSKALLLSVFVGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTS 360

Query: 428 MGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWF 487
           M +YKFF G  WK NLI+TP+L+P  +F+  V +NFFL++A SSG +P  T+  II LWF
Sbjct: 361 MSIYKFFGGQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWF 420

Query: 488 SVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAV 547
            +S+P+S  GS ++ K  +WDEHP KTNQIARQ P QPWY++T  AT +AG+F FG++AV
Sbjct: 421 ILSVPVSIIGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAV 480

Query: 548 ELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWSWQWRSFIIGG 607
           ELY+IY+S+W   IF+M+G                   +TY+SLC+ENW WQWRSFIIGG
Sbjct: 481 ELYYIYASIWGEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGG 540

Query: 608 LGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYS 667
           +GCSVY+F+H++ F KFK  GFV++VLY+GYS ++S +CC+VTG+IGF +++ F+RKIYS
Sbjct: 541 VGCSVYVFLHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYS 600

Query: 668 RIKVE 672
            IKV+
Sbjct: 601 NIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  147 bits (371), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 168/696 (24%), Positives = 269/696 (38%), Gaps = 126/696 (18%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           + P  Y   D + L+VN+                V SD     Y+Y  Y+    F  P  
Sbjct: 42  LRPNYYSKGDPVELIVNK----------------VESDLTQLPYAY--YD--LPFTCPPT 81

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
           + K+P   SL  +I GDR + S + L   ED +C  LC      +  K    L+KNG+  
Sbjct: 82  MHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVV 141

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            WL+D  LPA      +     YY +GF LGF D +    GKT  +T             
Sbjct: 142 QWLIDDELPAVTTFISTTDHKKYYASGFPLGFVDPET---GKTYLNT------------- 185

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLS-IERSSPG 259
                                    H  I + Y+      + + G  + P S ++   PG
Sbjct: 186 -------------------------HVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPG 220

Query: 260 ACSTTGEPLTLVEDKDND---VYFTYSVKFIASDTV-WATRWDKYLHVYD------PQIQ 309
           A     +   +V + D+D   + FTYSV +     V W  RWD YL+  +       Q  
Sbjct: 221 ASKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFH 280

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAG--------WKLGH 361
           W                      R  +     +++++ +    +D G        W L  
Sbjct: 281 WISLANSFGIVFLISSITAVILYRTFKISRRSFSDISKE---EDDKGSIYVVARKWLLNE 337

Query: 362 GDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGF 421
                  P + VL + V  G+Q    ++ S+  +         R S+ T+  + +    F
Sbjct: 338 QT-----PLANVLIIFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAF 392

Query: 422 VGSYTSMGVYKFFH----------GPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSS 471
           + S+T   + K               Y+    ++   LLP  + L+ + +N  +    S+
Sbjct: 393 MASFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDST 452

Query: 472 GVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTI 531
             +P  T+ F+I ++F V IPLS  G YIA K    +  P+ +  I   S R   Y +TI
Sbjct: 453 HALPFGTVLFLISVYFVVCIPLSLLGGYIAVKST--NSKPSFSFSIGNYSDRIFVY-KTI 509

Query: 532 Q--------------ATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXX 575
                          A L  G+F F  I VEL ++Y SLW  K   +Y +G         
Sbjct: 510 TMSPSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLL 569

Query: 576 XXXXXXXXXXITY---HSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLG--GFV 630
                      T+   +S    + +W+W SF IG   C+ YM ++++ +  F L   GF 
Sbjct: 570 CIVICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFS 628

Query: 631 TVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           ++ + V Y  + + +C   TG+I   +S  F++KIY
Sbjct: 629 SIFISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  145 bits (367), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 169/693 (24%), Positives = 269/693 (38%), Gaps = 112/693 (16%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           + P  YR  D + LLVN+                V SD   F   Y YY+  F  C P  
Sbjct: 41  LQPNVYRWGDHVELLVNK----------------VESDLTQF--PYGYYDLPFT-CPPTE 81

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
            +K+P   SL  +I GDR + S ++LK  +D  C ALC         +    L++ G+  
Sbjct: 82  -DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            WL+D  LPAA     +     YY +GF LGF D          P T             
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD----------PDT------------- 177

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
                             E T+   H  + + Y+      + +VG  V P S+ +   PG
Sbjct: 178 ------------------EKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPG 219

Query: 260 ACSTTGE-PLTLVEDKDNDVY--FTYSVKFIASDTV-WATRWDKYLH------VYDPQIQ 309
           A     +  L + E++D   Y  FTYSV +     V W+ RW+ +L+          +  
Sbjct: 220 ASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFH 279

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRAVRSDF-ARYNELNLDNEFHEDAGWKLGHGDVFRIP 368
           W                      R VR    A   E     + +E+A    G    +   
Sbjct: 280 WMTLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQ 339

Query: 369 PKS-----MVLSVLVGSGIQLFLMIICSIFFA-ALGLVSPASRGSLPTVMFVL----YAL 418
             S      +L++ V  G+Q    II S+ F+ +L  +       L    F L    Y  
Sbjct: 340 TDSSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLW 399

Query: 419 FGFVGSYTSMGVYKFFHGPYWKANL--IITPILLPGAIFLLIVAMNFFLLFAHSSGVIPA 476
             FVG++  +       G   +     I+    LPG + +    +N+ +    SS  +P 
Sbjct: 400 HLFVGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPF 459

Query: 477 RTLFFIIFLWFSVSIPLSFAGSYIAHK--RCKWDEHPTKTNQIAR--QSPRQPWYL--RT 530
           RT+   + ++F + IPLS  G  ++H+  R +    P  ++  AR  +  R P  L  R 
Sbjct: 460 RTIVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSIKPCRAPTTLAPRK 519

Query: 531 IQATL--------IAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXX 580
           I   L        I G   F  I VEL +IY S+W  K   +Y++G              
Sbjct: 520 ISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVC 579

Query: 581 XXXXXITY-----HSLCLENWSWQWRSFIIGGLGCSVYMFIHAI--LFTKFKLGGFVTVV 633
                  Y     H       SW+W+ F++G   C+ YM ++++  +F   K+ GF ++ 
Sbjct: 580 EVSFLGCYVMMRKHKRVATFDSWRWKCFMMGT-SCAWYMELYSLYYIFHTLKMTGFPSIF 638

Query: 634 LYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           + V YS I + +C    G++G+ +S   + +++
Sbjct: 639 ISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVF 671

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  145 bits (367), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 163/713 (22%), Positives = 274/713 (38%), Gaps = 130/713 (18%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           ++P  YR  D + L+VN+                V SD     Y+Y  Y+    F  P  
Sbjct: 52  ITPNFYRKGDPLELIVNK----------------VESDLTQLPYAY--YD--LPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
           + K+P   SL  +I GDR + S ++LK  ED  C  LC      +  + ++ L++ G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVV 151

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            WL+D  LPAA     +     YY +GF LGF D          P T             
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFID----------PDT------------- 188

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
                             + T+  NH  + + +H   N    +VG  V P S+ +   PG
Sbjct: 189 ------------------DKTYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPG 230

Query: 260 ACSTTGEPLTLVEDKDNDVY---FTYSVKFIASDTV-WATRWDKYLHVYD------PQIQ 309
           A     +   ++ + +N++    FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFH 290

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNE----LNLDNEFHEDA--GWKLGHGD 363
           W                      R + +D +        +N++    ED     K G   
Sbjct: 291 WMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYS 350

Query: 364 VFRIPPKSM-----------VLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVM 412
           V+ +    +           VL +LV  G+Q    II S+  +         R S+ T+ 
Sbjct: 351 VYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMA 410

Query: 413 FVLYALFGFVGSYTSMGVYKFFHGPYWKANLI-----------ITPIL-------LPGAI 454
            + + L  F+ S+    +         KAN +            +PI        LPG +
Sbjct: 411 ILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIV 470

Query: 455 FLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHK---------RC 505
            +    +N  +    S+  +P +T+ F + ++F V IPLS  G  +A+            
Sbjct: 471 MVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGI 530

Query: 506 KWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNK--IFY 563
             DE  +  N +     R  +         + GIF    I VE+ ++Y SLW  K   +Y
Sbjct: 531 TKDESNSDGNGLFVPKSRAKFNPLVYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYY 590

Query: 564 MFGXXXXXXXXXXXXXXXXXXXITY--HSLCLENW----SWQWRSFIIGGLGCSVYMFIH 617
            +G                    +Y     C E+     +W+W+ F +G  G  VYM ++
Sbjct: 591 FYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELY 649

Query: 618 AI--LFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSR 668
           ++  +F    + GF ++++ + YS I + +C +  GA+ + ++  FI KIY +
Sbjct: 650 SLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIYHQ 702

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  145 bits (365), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 167/711 (23%), Positives = 276/711 (38%), Gaps = 130/711 (18%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           ++P  Y+ ND + L+VN+                V SD     Y+Y  Y+    F  P  
Sbjct: 53  ITPNFYKKNDFLELIVNK----------------VESDLTQLPYAY--YD--LPFTCPPT 92

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
           + K+P   SL  +I GDR + S ++L+  ED  C  LC      K  + ++ L++ G+  
Sbjct: 93  MHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVV 152

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            WL+D  LPAA     +     YY +GF LGF D          P T             
Sbjct: 153 QWLIDDELPAATTFISTTDHKKYYASGFPLGFVD----------PDT------------- 189

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
                             + T+  NH  + + +H  G+    VVG  V P S+ +   PG
Sbjct: 190 ------------------DKTYLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPG 231

Query: 260 ACSTTGEPLTLVEDKDNDVY---FTYSVKFIASDTV-WATRWDKYLHVYD------PQIQ 309
           A     +   +V + ++D+    FTYSV +     V W  RW+ +L+  +       Q  
Sbjct: 232 ASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFH 291

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNE----LNLDNEFHEDA--GWKLGHGD 363
           W                      R +R+D    +     +N +    ED+    K G   
Sbjct: 292 WMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNS 351

Query: 364 VFRIPPKSM-----------VLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVM 412
           V+ +    +           VL VLV  G+Q    II S+  +         R S+ T+ 
Sbjct: 352 VYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMA 411

Query: 413 FVLYALFGFVGSY--TSMGVYK---------FFHGPYWKANLIITPIL-------LPGAI 454
            + + L  F+ S+  T +G+             H   +K     +PI        LPG +
Sbjct: 412 ILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMV 471

Query: 455 FLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHK---------RC 505
            +    +N  +    S+  +P RT+ F I ++F V IPLS  G  +A+            
Sbjct: 472 MIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGI 531

Query: 506 KWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMF 565
             DE     +++ +   R  +         + GIF    I VE+ ++Y SLW  K  + F
Sbjct: 532 TKDETDGNGSKLFKPKSRTRFNPLVHCGVYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYF 591

Query: 566 GXXXXXXXXXXXXXXXXXXXITYHSL----CLENW----SWQWRSFIIGGLGCSVYMFIH 617
                               I    L    C ++     +W+WR F +G  G  VYM ++
Sbjct: 592 FYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELY 650

Query: 618 AI--LFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           ++  +F    + GF ++++ + YS + + LC +  GA+   ++  FI +IY
Sbjct: 651 SLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  141 bits (356), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 167/717 (23%), Positives = 278/717 (38%), Gaps = 142/717 (19%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           ++P  Y+  D + L+VN+                V SD     Y+Y        F  P  
Sbjct: 52  ITPNFYKNGDPLELIVNK----------------VESDLTQLPYAYY----DLPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
           + K P   SL  +I GDR + S ++L   ED  C  LC      +  + ++ LI+ G+  
Sbjct: 92  MHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVV 151

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            WL+D  LPAA     +     YY +GF LGF D          P T +           
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFMD----------PDTGK----------- 190

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
                               T+  NH  + + +H   NG   +VG  V P S+ +   PG
Sbjct: 191 --------------------TYLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPG 230

Query: 260 ACSTTGE-PLTLVEDKDNDVY--FTYSVKFIASDTV-WATRWDKYLHVYD------PQIQ 309
           A  T  +  +T+ ED++   Y  FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFH 290

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNE----LNLDNEFHEDA---------- 355
           W                        + +D    +     +N++    ED           
Sbjct: 291 WMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNS 350

Query: 356 ------GW-KLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSL 408
                  W + G  D+F +      L VLV  G+Q    +I S+  +         R S+
Sbjct: 351 VYMVAKDWIQNGKPDLFSLKG----LIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSV 406

Query: 409 PTVMFVLYALFGFVGSY--TSMGVY---KFFHGPYWKAN-------------LIITPILL 450
            T+  + + +  F+ S+  T + +    + F+  Y+  N              II    L
Sbjct: 407 LTMAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSL 466

Query: 451 PGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHK------- 503
           PG I +    +N  +    S+  +P +T+ F I ++F V IPLS  G  +A+        
Sbjct: 467 PGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYW 526

Query: 504 --RCKWDEHPTKTNQIARQSPRQPWYLRTIQ--ATLIAGIFSFGSIAVELYFIYSSLWFN 559
                 DE  +K N++    P+ P     +      + G+F    I VE+ ++Y SLW  
Sbjct: 527 LSGITIDESDSKNNKLFL--PKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLE 584

Query: 560 K--IFYMFGXXXXXXXXXXXXXXXXXXXITY--HSLCLENW----SWQWRSFIIGGLGCS 611
           K   +Y +G                    +Y     C E+     +W+W+ F +G  G  
Sbjct: 585 KTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-G 643

Query: 612 VYMFIHAI--LFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           VYM ++++  +F    + GF ++++ + YS + + +C +  GA+ + ++  FI KIY
Sbjct: 644 VYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY 700

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  139 bits (350), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 161/689 (23%), Positives = 271/689 (39%), Gaps = 99/689 (14%)

Query: 30  RANDEIPLLVNRLTPSIYFQHKDEN--GKDVSSDKEHFLYSYDYYNDKFHFCKPEHVEKQ 87
           R N+ I      L P+ YFQ  +       V SD     Y+Y  Y+    F  P  + K+
Sbjct: 29  RGNNTILEKAGWLQPNFYFQGDEVELIVNKVESDLTQLPYAY--YD--LPFTCPPTMHKK 84

Query: 88  PE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQNWLV 145
           P   SL  +I GDR + S + LK  +D  C  LC      +  K    L+++G+   WL+
Sbjct: 85  PLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQWLI 144

Query: 146 DG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGATLDA 204
           D  LPAA     +  +  YY +GF LGF D          P T +               
Sbjct: 145 DEELPAATTFISTIDQKKYYASGFPLGFVD----------PDTGK--------------- 179

Query: 205 RDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPGACST 263
                            +   H  + + Y+      + +VG  V P S+ +   PGA S 
Sbjct: 180 ----------------VYLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGA-SK 222

Query: 264 TGEPLTLVEDKDND----VYFTYSVKFIASDTV-WATRWDKYLHVYD------PQIQWFX 312
             EP  +V  +++D    + FTYSV +     V W  RWD YL+  +       Q  W  
Sbjct: 223 NYEPYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWIS 282

Query: 313 XXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVF-RIPPKS 371
                               R+ +S      ++N   E      +++    +     P +
Sbjct: 283 LANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINERTPLA 342

Query: 372 MVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVY 431
            +L + V  G+Q    ++ S+  +           S+ T+  + + L  F+ SY    + 
Sbjct: 343 NLLILFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVLCFVLGAFMSSYIGSVLL 402

Query: 432 KFFHGPYWKAN----------LIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFF 481
           +  +    K             I+    LPG + ++ + +N  +    S+  +P +T+  
Sbjct: 403 RLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVM 462

Query: 482 IIFLWFSVSIPLSFAGSYIAHKRC--------KWDEHPTKTNQIARQ-SPRQPWYL---- 528
            I ++F V IPLS  G Y+A+           K+     +    A +  P++  +L    
Sbjct: 463 FITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGAR 522

Query: 529 -RTIQATL---IAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXX 582
            ++I+  L   ++GIF F  I VEL ++Y S+W  K   +Y +G                
Sbjct: 523 LKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEI 582

Query: 583 XXXITYHSLCL---ENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLG--GFVTVVLYVG 637
               TY  L +    N  W+W SF +G   C+ YM ++++ +  F L   GF ++ + V 
Sbjct: 583 AIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSIFISVC 641

Query: 638 YSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           Y  + + LC    G+I   +S  F+ K+Y
Sbjct: 642 YGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  135 bits (339), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 166/703 (23%), Positives = 269/703 (38%), Gaps = 139/703 (19%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           +SP  Y   D++ + VN+                V SD  HF  SY YY+  F     + 
Sbjct: 57  LSPNFYEYGDKVDITVNK----------------VESDLTHF--SYGYYDLHFTCPPSQD 98

Query: 84  VEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQNW 143
           ++  P +   +++G++ + S +QL   +D++CV LC     G+  K    LIK  +   W
Sbjct: 99  MKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQW 158

Query: 144 LV-DGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGATL 202
           L  D LP A    +++ K  YY +GF LG  D          P T E             
Sbjct: 159 LADDDLPGATTYLNTKDKKKYYSSGFPLGQYD----------PETDE------------- 195

Query: 203 DARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPGAC 261
                              +  NH  I + YH    G   +VG  V P S+ +   PGA 
Sbjct: 196 ------------------AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGA- 236

Query: 262 STTGEPLTLVEDKDND----VYFTYSVKFIASDTV-WATRWDKYLH------VYDPQIQW 310
           S    P  +  D  N+    + FTY+V +     V W  RW+ +++          Q  W
Sbjct: 237 SKDYTPYKI--DPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHW 294

Query: 311 FXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPK 370
                                 R   +D +   +L         A W      +F     
Sbjct: 295 ITFANGIIVTSCLLLIVIAILKRQ-ETDGSITTQL--------AAEWSKARVPLF----- 340

Query: 371 SMVLSVLVGSGIQ-LFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMG 429
              L++LV  GI  LF  +   I   +L          L   +F+  +     GS+TS  
Sbjct: 341 -FQLNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFIS-----GSFTSSF 394

Query: 430 VYKFFHGPYWKANLIITPIL---LPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLW 486
           +     G   +  L+ + I    LPG   ++++ +N+ L   +++  +P  T+  +   +
Sbjct: 395 IGALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAY 454

Query: 487 FSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIA----RQSPRQPWYLRT-----------I 531
           F V +P+S  G   A +  K +   T  N  A     +   +P Y+ +           I
Sbjct: 455 FIVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPI 514

Query: 532 QATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXITYH 589
             TL  G+  F  I VEL F Y SLW  K  ++Y++G                     Y 
Sbjct: 515 AITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYI 574

Query: 590 SLCLEN------W------------SWQWRSFIIGGLGCSVYMFIHAILFTKF--KLGGF 629
            L   N      W            SW+W++F +GG   + YM  ++IL+  F  +   F
Sbjct: 575 HLNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDF 633

Query: 630 VTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKI--YSRIK 670
           ++  L+V YS + + LC    G++ + SS+ FI K+  Y++ K
Sbjct: 634 ISSFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKLNEYNKAK 676

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  133 bits (334), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 168/716 (23%), Positives = 277/716 (38%), Gaps = 141/716 (19%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           V+P  Y+  D + L+VN+                V SD     Y+Y  Y+  F  C P  
Sbjct: 51  VNPNLYKIGDHVELIVNK----------------VESDLTQLPYAY--YDLPF-ICPPTK 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
            EK+P   SL  +  GDR + S ++L    D  C  LC      +       L++ G+  
Sbjct: 92  -EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVT 150

Query: 142 NWLVD-GLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            WL+D  LPAA     S     YY  GF +G+ D                      +TG 
Sbjct: 151 QWLIDESLPAATTFISSTNHNKYYAAGFPVGYVD---------------------DRTGK 189

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
           T                       NH  + + YH      + +VG  V P S+ +   PG
Sbjct: 190 TF--------------------LNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPG 229

Query: 260 ACSTTGEPLTLVEDKDNDVYF---TYSVKFIASDTV-WATRWDKYLHVYD------PQIQ 309
           A     +   +V +KD+++ F   TYSV +     V W  RW+ +L+  +       Q  
Sbjct: 230 ANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFH 289

Query: 310 WFXXXXXXXXXXXXXXXXXXXX----XRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVF 365
           W                          +  R         NL  +  +D   K+  G VF
Sbjct: 290 WMSFLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKIS-GSVF 348

Query: 366 ----------RIPP-KSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFV 414
                     +IP  K+++   L   GIQ    I+ S+  +         R ++ T+  +
Sbjct: 349 VNAKTWITVGKIPYWKALI--CLTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLI 406

Query: 415 LY----ALFGFVGSYTSMGVYKFFHGPYWKANLIITPIL---------LPGAIFLLIVAM 461
            +    A+ G++GS   +  Y+   G Y +  +  T +          LPG + ++  ++
Sbjct: 407 CFICGAAISGYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSL 464

Query: 462 NFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPT-------KT 514
           N  +L   S+  +P +T  F++ ++F   IPLS  G  +A   CK D + T       + 
Sbjct: 465 NCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNCKVDSYNTLKRITSLRR 523

Query: 515 NQIARQS-----PRQPWYLR----------TIQATLIAGIFSFGSIAVELYFIYSSLWFN 559
           N I+R+S      +   Y R          T    L  G FSF  I VEL ++Y S+W  
Sbjct: 524 NTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLE 583

Query: 560 KI--FYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLEN-----WSWQWRSFIIGGLGCSV 612
           K   +Y +G                     Y  L  +N      +W W+SF++G   C+ 
Sbjct: 584 KTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAW 642

Query: 613 YMFIHAILFTKFKLG--GFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           YM ++++ +  F L   GF ++ + V YS + + +C    G++ + +S + + +IY
Sbjct: 643 YMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY 698

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  131 bits (330), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 171/736 (23%), Positives = 272/736 (36%), Gaps = 171/736 (23%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           + P  Y  ND + ++VN+                + SD   F Y+Y  Y   F  C P +
Sbjct: 56  IRPNVYEENDPVEIIVNK----------------IESDLTQFPYAY--YELPFT-CPPTN 96

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQN 142
           V+K    SL  +I GDR + S + L   +D+ C+ LC         +  + LIK G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 143 WLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGAT 201
           WL+D  LPAA     ++    YY +GF LGF D K T  GK                   
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMD-KDT--GK------------------- 194

Query: 202 LDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPGA 260
                              T+  NH  + + YH      + +VG+ V P S+ +   PGA
Sbjct: 195 -------------------TYLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGA 235

Query: 261 CSTTGE-PLTLVEDKDNDVYFTYSVKFIASDTV-WATRWDKYLHVYD------PQIQWFX 312
                   +   E +   + FTYS+ +     V W  RW+ +++  +       Q  W  
Sbjct: 236 SKNFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWIS 295

Query: 313 XXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSM 372
                               ++V +D     E    +     + W + H  +        
Sbjct: 296 LANSVVIVTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLN------ 344

Query: 373 VLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFV-GSYTSMGVY 431
            L+V    G+Q    I+ S+  +         R S+ T+     AL  F+ G+YTS    
Sbjct: 345 HLNVFTAMGVQFLFTILGSLIISCSMNKLHNIRNSVLTM-----ALMCFISGAYTSS--- 396

Query: 432 KFFHGPYWKANLIITPIL-------LPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIF 484
             F G    AN   T  +       LPG    +++ +N  +    S+  +P  T+  +I 
Sbjct: 397 --FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLIT 454

Query: 485 LWFSVSIPLSFAGSYIA---HKRC-----------------KWDEHPTKTNQI----ARQ 520
           ++F V IPLS  G   A    ++C                  +D+ P   N++       
Sbjct: 455 VYFIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISG 514

Query: 521 SPRQPWYLRT-IQATLIAGIFSFGSIAVELYFIYSSLWFNKI--FYMFGXXXXXXXXXXX 577
           + + P  LR  +  T+I+GI  F  I VEL F+Y SLW  K   +Y++G           
Sbjct: 515 NSKLPLMLRQPVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCV 574

Query: 578 XXXXXXXXITYHSLC-------------------------------------LENWSWQW 600
                     Y +L                                      L    W+W
Sbjct: 575 VVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQWRW 634

Query: 601 RSFIIGGLGCSVYMFIHA----ILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFF 656
           +SF IGG   SV  ++ A       T  K+  F +++L+  YS + + LC    GA+G+ 
Sbjct: 635 KSFQIGG---SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYL 691

Query: 657 SSMIFIRKIYSRIKVE 672
           S   F+ +I++  K E
Sbjct: 692 SCCWFVNRIHTNSKKE 707

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  130 bits (328), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 161/711 (22%), Positives = 271/711 (38%), Gaps = 130/711 (18%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           ++P  Y+  D + L+VN+                V SD     Y+Y  Y+    F  P  
Sbjct: 52  ITPNFYKKGDPLELIVNK----------------VESDLTQLPYAY--YD--LPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
           + K+P   SL  +I GDR + S + L   ED  C  LC      +  + ++ L++ G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLVREGYVV 151

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            WL+D  LPAA     +     YY +GF LGF D          P T +           
Sbjct: 152 QWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD----------PDTGK----------- 190

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
                               T+  NH  + + +H   N    +VG  V P S+ +   PG
Sbjct: 191 --------------------TYLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPG 230

Query: 260 ACSTTGEPLTLVEDKDNDVY---FTYSVKFIASDTV-WATRWDKYLHVYD------PQIQ 309
           A     +   +V + +N++    FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFH 290

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNE----LNLDNEFHEDA--GWKLGHGD 363
           W                      + +  D    +     +N++    ED     K G   
Sbjct: 291 WMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNS 350

Query: 364 VFRIPPKSM-----------VLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVM 412
           V+ +    +           VL VLV  G+Q    +I S+  +         R S+ T+ 
Sbjct: 351 VYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMA 410

Query: 413 FVLYALFGFVGSYTSMGVYKFFHGPYWKANLI-----------ITPIL-------LPGAI 454
            + + L  F+ S+    +         + N +            +P+        LPG +
Sbjct: 411 ILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLV 470

Query: 455 FLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHK---RCKW---- 507
            +    +N  +    S+  +P RT+ F I ++F V IPLS  G  +A+       W    
Sbjct: 471 MVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGI 530

Query: 508 --DEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNK-IFYM 564
             DE    ++++     R  +         + G+F F  I VEL ++Y S+W  K  FY 
Sbjct: 531 TKDETCGNSSRLFVPRSRTKFNPLVYCGIYLCGLFPFLVIYVELQYVYKSVWLEKTTFYY 590

Query: 565 FGXXXXXXXXXXXXXXXXXXXITYHSL---CLENW----SWQWRSFIIGGLGCSVYMFIH 617
           F                    I  +SL   C E+     +W+W+ F +G  G  VYM ++
Sbjct: 591 FYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMELY 649

Query: 618 AI--LFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
           ++  +F    + GF + ++ + YS + + +C +  G + + ++  FI KIY
Sbjct: 650 SLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIY 700

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  129 bits (323), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 156/686 (22%), Positives = 274/686 (39%), Gaps = 118/686 (17%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           + P  Y   D + L+VN +   I          D+          + YY+    F  P  
Sbjct: 41  LKPNVYSIGDPLELVVNTVESEI---------TDIP---------FGYYD--LPFTCPPT 80

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
            EK+P   SL  +I GDR + S ++L + +D  C  LC      +  +    LIK+G+  
Sbjct: 81  PEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMV 140

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            W++D  LPAA     +     YY  GF LG                             
Sbjct: 141 QWMIDDDLPAATTYISTTDNLKYYAPGFPLG----------------------------- 171

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
              + DP++ +           F NH  + + Y+   +    +VG    P S+ +   PG
Sbjct: 172 ---SVDPRSSR---------VFFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPG 219

Query: 260 ACSTTGEPLTLVEDKDNDVYF---TYSVKFIASDTV-WATRWDKYLH---VYDPQIQWFX 312
           A S   +P  + +    ++ +   TYSV +     + W+ RW  Y++   + D     F 
Sbjct: 220 A-SKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFH 278

Query: 313 XXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSM 372
                                 +   F   NE  L+++ +ED+       D+F +    +
Sbjct: 279 WMALANSVGIVLFVTFIVIVNLIMI-FRNPNE-QLESKENEDSS------DIFNVANNWL 330

Query: 373 V---------LSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYA----LF 419
                     L V V  GIQ+  MI+  +  +         + S+ T+  + +     + 
Sbjct: 331 RARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMA 390

Query: 420 GFVGSYTSM----GVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIP 475
            FVG++  M      Y F++  +     ++    LPG+I +L +++N  +    S+  +P
Sbjct: 391 SFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALP 446

Query: 476 ARTLFFIIFLWFSVSIPLSFAGSYIA---HKRCKWDEHPTKT---NQIARQSPRQPWYLR 529
             T+   +  +F V I +S  G  +A   H+  + D  P  T    ++ R+S      L 
Sbjct: 447 FGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLV 506

Query: 530 TIQATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMF-----GXXXXXXXXXXXXXXXX 582
              A LI+G   F  I VEL ++Y S+W  K  ++Y++                      
Sbjct: 507 VFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGC 566

Query: 583 XXXITYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKF--KLGGFVTVVLYVGYSF 640
              +  +   + + +W+WR F+I   GCS YM I+++ +  F   + G   V + V YSF
Sbjct: 567 LVLMKLNHKFINDQNWRWRCFVIST-GCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSF 625

Query: 641 IISALCCVVTGAIGFFSSMIFIRKIY 666
           I + LC + TG++G+ +S  F++KI+
Sbjct: 626 IFNVLCGLATGSLGYLTSSWFVKKIH 651

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 152/729 (20%), Positives = 264/729 (36%), Gaps = 178/729 (24%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           + P  Y+  D++ L VN++                  + E     Y YY+ +F  C P  
Sbjct: 44  IKPNVYKRGDKVDLTVNKV------------------ESEITNLPYGYYDLRF-VCPPSE 84

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQN 142
            +K    SL  VI GDR + S + L+    ++C  LC         +  + LI+  +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 143 WLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGAT 201
           WL+DG LPAA     +R+   +Y  GF LG                   +D E  K    
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLG------------------RVDHETDK---- 182

Query: 202 LDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPGA 260
                              TH  NH  + + Y       Y +VG  V P S+ +   PGA
Sbjct: 183 -------------------THLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGA 223

Query: 261 CSTTGEPLTLVEDKDNDVY--FTYSVKFIASDTV-WATRWDKYLH----VYDPQIQWF-- 311
            S + EP  +  ++    Y  FTYSV +     + W+ RW+ +      + +  + +F  
Sbjct: 224 -SKSFEPYVINTEETEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYW 282

Query: 312 XXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKS 371
                                  +R+D           +F     ++     V+ +   +
Sbjct: 283 ISLANSAIVVALMTLFIALIFLKIRAD-----------DFVGTLAFEWASQPVYYLTQLN 331

Query: 372 MVLSVLVGSGIQ-LFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGV 430
           +  S+    GIQ LF +I  S    +L  V       L T      A+   +G+YTS  V
Sbjct: 332 LAASM----GIQFLFSIIGSSTISCSLCKVHNIRSWELSTA-----AICFVLGAYTSSLV 382

Query: 431 YKFFHGPYWKANL---IITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWF 487
                 P  K NL   ++    LP    +++   N  +    SS  +P  TL  ++  +F
Sbjct: 383 GSLL-APGPKMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYF 441

Query: 488 SVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPW-YLRTIQ-------------- 532
            + +PLSF G + A K           N +  +  + P+ +L +I+              
Sbjct: 442 VICLPLSFLGGFSARKL-----RSAPANGLNYEQSKVPFSFLLSIEYHEYNLLPAGQEKE 496

Query: 533 ----------ATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXX 580
                      T++ G   F     EL F+Y SLW  K  ++ ++G              
Sbjct: 497 IPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVC 556

Query: 581 XXXXXITY-----------------------HSLC---------LENW------------ 596
                + Y                        S+C         L+N+            
Sbjct: 557 EVSLVVCYVLMIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKNYMASTARRWKASF 616

Query: 597 -SWQWRSFIIGGLGCSVYMFIHAILFTKF--KLGGFVTVVLYVGYSFIISALCCVVTGAI 653
            SW+W++F+ G    + Y  ++++ +  F   L  F +++L+V Y+ + + +C    GA+
Sbjct: 617 SSWRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGAL 675

Query: 654 GFFSSMIFI 662
           G+ + + F+
Sbjct: 676 GYLTCLWFL 684

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 119/256 (46%), Gaps = 39/256 (15%)

Query: 449 LLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWD 508
           LLPG + L  + +N  +    S+ V+P  T+  ++F++F V IPLS  G  IA  +   +
Sbjct: 420 LLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEE 479

Query: 509 EHPTKTNQIARQSPRQP-----------------------WYLR-------TIQATLIAG 538
               +++ I R S  +                        W L+       T+ + L +G
Sbjct: 480 YSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASG 539

Query: 539 IFSFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENW 596
           IF F  I VEL F+Y S+W+ K   +Y +G                    +Y  + + + 
Sbjct: 540 IFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSK 599

Query: 597 ----SWQWRSFIIGGLGCSVYMFIHAI--LFTKFKLGGFVTVVLYVGYSFIISALCCVVT 650
               SW+W++F +    C+ YM  ++I  +F    +  F ++++ V YS + +ALC +  
Sbjct: 600 DNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAM 658

Query: 651 GAIGFFSSMIFIRKIY 666
           G+IG+ +S+ F++++Y
Sbjct: 659 GSIGYLASLWFVKRVY 674

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 113/283 (39%), Gaps = 69/283 (24%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           ++PT YR  D + ++VN+                + SD       Y YY+    F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNK----------------IESDATQL--PYGYYD--LPFTCPPT 72

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
           V+K+P   SL  VI GDR + S ++L+  +D EC  LC         + ++  IK  +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            W +D  LPAA     +  +  YYG+GF LGF                      D +TG 
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFV---------------------DEETGK 171

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
                                +  NH  + + YH   + N+ +VG  + P S+ +   PG
Sbjct: 172 --------------------VYVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPG 211

Query: 260 ACSTTGEPLTLVEDKDND---VYFTYSVKFIAS-DTVWATRWD 298
           A     +   +V +  N+   + FTYSV +    D  W  R++
Sbjct: 212 ASKDYDQYEVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYN 254

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 159/729 (21%), Positives = 258/729 (35%), Gaps = 179/729 (24%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           V P  Y+  +E+ +L+N++            GK           SY YY+ +F  C P  
Sbjct: 40  VRPRIYQDGEEVEMLLNQVV-----------GKPGE-------LSYGYYDLQFT-CTPTK 80

Query: 84  VEKQ-PESLGSVIFGDRIYNSPFQLKMLEDKECVALC-KSTIPGKDAKFINTLIKNGFFQ 141
             +    SL  V  GDR + S ++L    + +C  LC + T P    +  ++LI+  +  
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE-ADSLIRQNYTV 139

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
             L+D  +PA++     R    YY  GF LGF D          P T             
Sbjct: 140 QLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD----------PET------------- 176

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGA 260
                             ++T+  NHF + + Y+      Y +VG  V P S+       
Sbjct: 177 ------------------DVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPG 218

Query: 261 CSTTGEPLTLVEDKDNDVYF---TYSVKFIASDTV-WATRWDKYLHVYDPQIQWFXXXXX 316
            S   E    V   + DV F   TYSV +     V W  RW+ YL   D  +        
Sbjct: 219 SSKDYENYA-VNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN------- 270

Query: 317 XXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVF----------R 366
                           R ++     +  L L +     +   LG G +F          R
Sbjct: 271 -----------KSLCFRGIKVTMV-FIILTLMSLAIIVSRLGLGTGSMFITAVASEWVRR 318

Query: 367 IPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTV---MFVLYALFGFVG 423
             P  + L+  V  GIQ+       IF A   L+   S G L  +   +  + AL    G
Sbjct: 319 GAPCLLFLNTFVSMGIQV-------IFAAPATLLLICSMGKLHNISNFLVCIAALCYMTG 371

Query: 424 SYTSMGVYKFFHGPYWKANL-----------IITPILLPGAIFLLIVAMNFFLLFAHSSG 472
            + S      F G     NL           ++    LP     ++V  N          
Sbjct: 372 IFMSA-----FGGILLSGNLLDNKAQIRKYSVLYGSALPALTVAVLVLANSIAWIIERGK 426

Query: 473 VIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEH------PTKTNQIARQSPRQP- 525
            +P R +  ++ L+F VS+PLS  G   A  + K D+H       TK       SP +P 
Sbjct: 427 EMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQHFQLYSLSTKYTGTP-VSPSKPT 484

Query: 526 ----------------------WYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFN--KI 561
                                 W  +    T I GI  F +I +++ FI+  LW +   +
Sbjct: 485 FWFNFEYDTRGTPACAHEQIPMWLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSL 544

Query: 562 FYMFGXXXXXXXXXXXXXXXXXXXITY--------HSLCLENW-----------SWQWRS 602
           F ++                    I Y           C ++            SW+W++
Sbjct: 545 FQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKA 604

Query: 603 FIIGGLGCSVYMFIHAILFTKF--KLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660
           F +GG   + Y   +++ +  F  +L  F +++LY+ Y  +++       G+IG+ +   
Sbjct: 605 FYMGG-AAAWYWEAYSLYYMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCW 663

Query: 661 FIRKIYSRI 669
           F+ K+  +I
Sbjct: 664 FLNKLTYKI 672

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 113/292 (38%), Gaps = 65/292 (22%)

Query: 16  AKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDK 75
           ++++    + P  Y+  D++ +++N++                    E   + Y YY+ +
Sbjct: 32  SQSYDFGWIKPNVYKKGDKVDVIINKVV------------------SETARFPYGYYDLQ 73

Query: 76  FHFCKPEHVEKQPE-SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTL 134
           F  C P   +K    SL  +I GDR + S + L   E  +C+ LC      +  K  + L
Sbjct: 74  F-VCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADAL 132

Query: 135 IKNGFFQNWLV-DGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDS 193
           I+ G+  +WL+ D LPAA     +++   +Y  GF LG  D    V GK           
Sbjct: 133 IRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD---AVTGK----------- 178

Query: 194 EDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI 253
                                      T   NH  + V Y       + ++G  V P S+
Sbjct: 179 ---------------------------TRLYNHLMLVVRYQTVDVNKHTIIGFEVYPKSV 211

Query: 254 ERSSPGACSTTGEPLTLVEDKDNDVY--FTYSVKFIASDTV-WATRWDKYLH 302
             +     +   +P  +  ++    Y  FTYS+ +     + W+ RW+ ++H
Sbjct: 212 SDAHCPGANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 60/146 (41%), Gaps = 24/146 (16%)

Query: 444 IITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHK 503
           +I+   LPG +   ++ +N  +    SS  IP  T+   +  +F +S PLS  G + A K
Sbjct: 394 VISGSALPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARK 453

Query: 504 RCKWDEHPTKTNQIARQ---------------------SPRQPWYLRTIQATLIAGIFSF 542
             K        N I++                       P        I  T++AGI  F
Sbjct: 454 M-KNAAKLAPANAISKSPFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPF 512

Query: 543 GSIAVELYFIYSSLWFN--KIFYMFG 566
             I VEL+++Y S+W      +Y++G
Sbjct: 513 VVICVELFYVYKSMWLQTTNFYYLYG 538

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 597 SWQWRSFIIGG-LGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGF 655
           SW+W+SF+ GG +   + ++    L     L    +++L+V Y+ + + +C    GA+G+
Sbjct: 614 SWRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 656 FSSMIFIRKIYSRIKVE 672
            S + F+  I S  K  
Sbjct: 674 LSCLWFLSHISSSSKAH 690

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 111/269 (41%), Gaps = 58/269 (21%)

Query: 40  NRLTPSIYFQHKDEN--GKDVSSDKEHFLYSYDYYNDKFHFCKPEHVEKQP--ESLGSVI 95
           NRLTP+IY +  D       + SD       Y YY+  F  C P + +++P   SL  ++
Sbjct: 35  NRLTPNIYRKGDDVELIVNKIESDLTKL--PYGYYDLPF-ICPPTN-QRKPLHMSLTEIL 90

Query: 96  FGDRIYNSPFQLKMLEDKECVALC-KSTIPGKDAKFINTLIKNGFFQNWLVDG-LPAARN 153
            GDR + S + L   +D +C  LC + T P    K IN L+K  +   W +D  LPA+  
Sbjct: 91  RGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQWSIDNDLPASTT 149

Query: 154 VYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGATLDARDPKNIKPN 213
              +     YY  GF LGF D          P T                          
Sbjct: 150 FISTSENRKYYIPGFSLGFVD----------PDT-------------------------- 173

Query: 214 LVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPGACSTTGEPLTLVE 272
                E  +  NH  + + YH   + ++ +VG+ V P S+ +   PGA S   E   LV 
Sbjct: 174 -----ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGA-SRNYEQFELVA 227

Query: 273 DKDNDVY---FTYSVKFIAS-DTVWATRW 297
           + D +V    FTYSV +    D  W  R+
Sbjct: 228 NDDEEVTYIPFTYSVYWREEFDVEWKDRY 256

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 109/244 (44%), Gaps = 34/244 (13%)

Query: 449 LLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWD 508
           LLP  I ++ + +N  +    SS  +P +T+ F+I ++F V IPLS  G   A   C+  
Sbjct: 421 LLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQ-- 478

Query: 509 EHPTKTNQIARQSPRQPW-------YLRTIQATL----------IAGIFSFGSIAVELYF 551
               K    A  SP Q           RTI++            I G+F F  I VEL  
Sbjct: 479 ----KRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLASIGGLFPFFIIYVELQH 534

Query: 552 IYSSLWFNKI------FYMFGXXXXXXXXXXXXXXXXXXXITYHSL-CLENWSWQWRSFI 604
           +Y  +W  K       +++F                    + + S   LEN SW+WRSF 
Sbjct: 535 VYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQ 593

Query: 605 IGGLGCSVYMFIHAILFTKFKLG--GFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFI 662
           I    C+ YM ++++ +  + L   GF +++L V  S + + LC    G+IG+ ++  F+
Sbjct: 594 ISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFV 652

Query: 663 RKIY 666
            ++Y
Sbjct: 653 GRVY 656

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 119/539 (22%), Positives = 195/539 (36%), Gaps = 150/539 (27%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           V P TY   D + ++VN++      Q KD  G       E   Y Y   +D  + C P +
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLG----DSNEGVSYKY---HDLPYICPPTN 93

Query: 84  VEKQ-PESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQN 142
            +K    SL  +  GD    S + LK   D +C ALC         +    +I   +  N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 143 WLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGAT 201
           W +D  LPAA     S T+   Y  GF LG+                     +D +TG+ 
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLGW---------------------KDPETGSY 192

Query: 202 LDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPGA 260
                               +  NH  + + Y+   +  + +VG  V P SI +   PGA
Sbjct: 193 --------------------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGA 232

Query: 261 CSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFXXXXXXXXX 320
               G    L + ++ND    +S+   +    W   ++     YD + +W          
Sbjct: 233 RRGHGH-YELKDLENND---EFSLIPFSYSVYWREEFE-----YDWRTRW---------- 273

Query: 321 XXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLG-------------------- 360
                           S F R N ++LD    ED   +LG                    
Sbjct: 274 ----------------SLFVRPNYMDLD---AEDESLQLGFISNLLHWYSPYTTVIIFTI 314

Query: 361 --------------HGDVFRIPPKSMV-----------------LSVLVGSGIQ-LFLMI 388
                         H  VF   PK+++                 L++LV  G Q LF+ +
Sbjct: 315 LLFLVSLLVLDINSHKLVFMSNPKTVIAWATTANKLNKTWKNILLNILVSMGCQALFIFM 374

Query: 389 ICSIFFAAL-GLVSPASRGSLPTVMFVLYALF--GFVGSYTSMGVYKFFHGPYWKANL-I 444
              +  ++L  L + ++   L  + ++  +L    FVG++  M +++    P +   + I
Sbjct: 375 PVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTWLRMYMFQKKMTPNYDPKMSI 434

Query: 445 ITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHK 503
           +   +LPG     +   N    F   +   P R L ++IF++F  SIP+S  G  +A K
Sbjct: 435 VCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIFVYFIFSIPMSLIGGSLAVK 493

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 108/526 (20%), Positives = 181/526 (34%), Gaps = 121/526 (23%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           + P  Y+  D++ +  N+  P            D  +  +  L  YD       F  P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP------------DDPAVSQPALCYYD-----LPFVCPPS 102

Query: 84  VEKQP--ESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQ 141
             K+P   SL  +  GD +  S + L+  +D+ C  LC      K  +    LIKN +  
Sbjct: 103 DTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 142 NWLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGA 200
            W VD  LP       ++     Y  GF LG+                      D++TG 
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYF---------------------DNQTGQ 201

Query: 201 TLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPG 259
                                +   H    V YH   +  + +VG+ V P SI + + PG
Sbjct: 202 --------------------AYLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPG 241

Query: 260 ACSTTGEPLTLVEDKDND----VYFTYSVKFIAS-DTVWATRWDKY------LHVYDPQI 308
           A S    PL +   ++ND    + F+YSV +    D  W  RWD +      L   D   
Sbjct: 242 A-SKDFIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSF 300

Query: 309 QWFXXXXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIP 368
            W+                       +  +  R     L N+  +     +      R P
Sbjct: 301 HWYSLINSNSITVGVITFLCL----VISMNRMRI----LYNKSWKKRQLSITTTTTTRYP 352

Query: 369 PKSMVLSVLVGSGIQLFLMIICSI--------------------FFAALGLVSPASRGSL 408
               + ++ + SGIQ F ++I S+                    FF A G++     G+L
Sbjct: 353 N---IFTICITSGIQFFFLLISSVLITFQISKFHQIKDTIIVALFFIAFGIIVSVFIGTL 409

Query: 409 PTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFA 468
               F+L                  F   Y+  N I+    LP  I L +  +N  +  +
Sbjct: 410 IQRTFILTN----------------FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLS 453

Query: 469 HSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKT 514
             +   P +   +    +F +SIPLS     ++ +   + ++P+++
Sbjct: 454 EKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRFISFPKYPSRS 499

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 133/697 (19%), Positives = 243/697 (34%), Gaps = 120/697 (17%)

Query: 24  VSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEH 83
           + P  Y+  D + LLVN+   ++            ++D + ++Y     +D    C P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL------------NADLKPYIY-----HDLPFVCPPTS 89

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQN 142
           V K       S+  GD +  S ++LK  +D EC  LC              +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 143 WLVDG-LPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGAT 201
           W +D  LP +     + T+   Y  GF LG                    D + +K    
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLG------------------RFDKDKNK---- 187

Query: 202 LDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI-ERSSPGA 260
                               +  NH  + + Y+   +  + +VG  V   S+ +   PGA
Sbjct: 188 -------------------VYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGA 228

Query: 261 CSTTGEPLTLVEDKDND---VYFTYSVKFIAS-DTVWATRW---DKYLHVYDPQIQWFXX 313
                E   ++ + D+D   + FTYSV +    D  W +RW   D  +   DP++     
Sbjct: 229 SKNYEEYELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKL--INK 286

Query: 314 XXXXXXXXXXXXXXXXXXXRAVRSDFARYNELNLDNEFHEDAG-----WKLGHGDVFRIP 368
                                      +  E    N+F  +A      W   +    +  
Sbjct: 287 SMLSNIMQPTRTGLFLLPLIIFSIIIVKVVENGEKNKFTTEAQLASKCWIESNNINLKSS 346

Query: 369 PKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG-----FVG 423
             + +L++++  G+Q    +I  I    L +       ++  +   ++ + G     F+G
Sbjct: 347 FSASILTLVISMGVQSIFSLI-GIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLG 405

Query: 424 SYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFII 483
           ++  M +       Y     I+   LLP  + + +  ++  +    SS   P +TL  +I
Sbjct: 406 TWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMI 465

Query: 484 FLWFSVSIPLSFAGSYIAHKRCK----------WDEHPTKTNQIAR-QSPRQPW-----Y 527
             ++ + +P S  G  +A K  K           D      ++  R ++  +P       
Sbjct: 466 SFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNK 525

Query: 528 LRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYM-------FGXXXXXXXXXXXXXX 580
           L T+  +LI  I  F  I  ELY+I+++ W N   ++                       
Sbjct: 526 LGTLVYSLITAIVPFFIIKSELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSSTSLV 585

Query: 581 XXXXXITYHSLCLENW-----SWQWRSFIIGGLGC------SVYMFIHAILFTKFKLGGF 629
                I      +  W     S +W  F+     C      S+Y  I  I     ++ GF
Sbjct: 586 GLFVNIMMTKKGISQWRDDPISLRWSCFLNSFNICYLTGLYSLYYIIEVI-----RIHGF 640

Query: 630 VTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666
              VL + Y+  ++ +  +  GAI + +    I K+Y
Sbjct: 641 SMTVLTIFYTIALNVILGISCGAIAYMTCYWLIIKLY 677

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 95/279 (34%), Gaps = 65/279 (23%)

Query: 25  SPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEHV 84
            P+ Y   + + LLV+                ++ +D+E     + YY   F    P   
Sbjct: 38  QPSAYTRGERVQLLVD----------------NIWTDRE----VWGYYETLFTCPPPAEA 77

Query: 85  EKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQNWL 144
                SLG V   +  + S + L +  + +C  LC   +     + +  +I++G    W 
Sbjct: 78  RAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWT 137

Query: 145 VDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGATLDA 204
           +DGLPAA   Y  R  +  Y  GF+LG                  E+D+E          
Sbjct: 138 LDGLPAA-TTYPDRQSSYRYEAGFKLG------------------EVDAETGH------- 171

Query: 205 RDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACSTT 264
                               NH  + V Y    +G Y +VG    P S+         T 
Sbjct: 172 ----------------VRLHNHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTE 215

Query: 265 GEPLTLVEDKDNDVY--FTYSVKFIASDTV-WATRWDKY 300
            E   L  D    +   FTY+V +     V W  RW  Y
Sbjct: 216 YEHFWLNPDAQAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

>NDAI0D02370 Chr4 complement(547014..548030) [1017 bp, 338 aa] {ON}
           Anc_5.118
          Length = 338

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 408 LPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKAN--LIITPILLPGAIFLLIVAMNFFL 465
           +P ++  +  L G++G   S G  K   GPY   +  L+I P L    I++L   M   L
Sbjct: 82  IPLIVGCIVELIGYIGRAIS-GNDKEALGPYIMQSVLLLIAPTLYAATIYMLFGRMAH-L 139

Query: 466 LFAHSSGVIPAR--TLFFII 483
           LFA S  ++PAR  TL F++
Sbjct: 140 LFAESLMIMPARFNTLIFVL 159

>YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON}
           Protein of unknown function; transcription is activated
           by paralogous transcription factors Yrm1p and Yrr1p
           along with genes involved in multidrug resistance;
           mutant shows increased resistance to azoles; YMR102C is
           not an essential gene
          Length = 834

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 3/77 (3%)

Query: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180
           ST   +D KF+ T  K+G  + W V G P  R   DS  ++N       +    +KQ V 
Sbjct: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMR---IKQQVS 234

Query: 181 GKTIPSTMEELDSEDSK 197
               P   + LDS   K
Sbjct: 235 SLNNPKEKQFLDSATEK 251

>TPHA0A05180 Chr1 (1165194..1166888) [1695 bp, 564 aa] {ON} Anc_5.87
           YHR159W
          Length = 564

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 138 GFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELD 192
           G +Q  + D    A++VYDS  K  Y  +  +L   D+KQ      + S M +++
Sbjct: 476 GIYQRNM-DAKRNAKSVYDSNNKDQYSNSSSDLNVNDIKQFKTPNKVKSVMNDIE 529

>TBLA0D04990 Chr4 (1229559..1231292) [1734 bp, 577 aa] {ON}
           Anc_1.371 YFR012W
          Length = 577

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 604 IIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVV 649
           I  GL    Y+FI  + F  F L   V +  +   SF++SA  C+V
Sbjct: 109 IAAGLNFLTYLFISILSFFPFTLFSMVIIFFFNVISFLLSAFSCIV 154

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,324,845
Number of extensions: 3167248
Number of successful extensions: 10155
Number of sequences better than 10.0: 63
Number of HSP's gapped: 10211
Number of HSP's successfully gapped: 104
Length of query: 672
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 556
Effective length of database: 40,180,143
Effective search space: 22340159508
Effective search space used: 22340159508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)