Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.1413.189ON2042049441e-131
Smik_2.1333.189ON2042036285e-83
YBR014C (GRX7)3.189ON2032035852e-76
Skud_2.1263.189ON2042045652e-73
SAKL0C10494g3.189ON2301173996e-48
KAFR0A012303.189ON2201243943e-47
TBLA0F007503.189ON2341463762e-44
KLTH0G16060g3.189ON2131363732e-44
KNAG0J012603.189ON1941103626e-43
NDAI0G018003.189ON2221153612e-42
ZYRO0A04928g3.189ON2511173623e-42
AER017C3.189ON2161293561e-41
Kwal_56.231143.189ON2101063532e-41
KLLA0E17733g3.189ON2111113421e-39
TDEL0D043203.189ON2431163442e-39
YDL010W (GRX6)3.189ON2311113422e-39
Skud_4.2423.189ON2321113413e-39
Suva_4.2383.189ON2331843389e-39
Smik_4.2233.189ON2321113334e-38
CAGL0I04554g3.189ON2261513248e-37
Kpol_1045.693.189ON2621283191e-35
NCAS0E016003.189ON2291153101e-34
Ecym_53133.189ON2481262962e-32
TPHA0H006303.189ON191992643e-28
SAKL0H06468g8.679ON2581211961e-17
KAFR0A038708.679ON2671281821e-15
Skud_4.7881.38ON145931645e-14
YDR513W (GRX2)1.38ON143931646e-14
Smik_4.7941.38ON1431061647e-14
Suva_2.6931.38ON143931612e-13
Ecym_10441.38ON1581191533e-12
NCAS0C013408.679ON3571171594e-12
NDAI0K013508.679ON2711431549e-12
KLLA0C01298g1.38ON1071041442e-11
TPHA0G015908.679ON2971421522e-11
AFR710W1.38ON1111031424e-11
KAFR0D003601.38ON109971416e-11
SAKL0C01320g1.38ON165951446e-11
Kpol_1072.148.679ON2501231442e-10
KLLA0D05973g8.679ON2811351452e-10
Kwal_33.131661.38ON138961392e-10
Kwal_26.88148.679ON2751561424e-10
YPL156C (PRM4)8.679ON2841321416e-10
KNAG0C004501.38ON1571001376e-10
Kpol_2000.991.38ON141931367e-10
CAGL0K05813g1.38ON1421021332e-09
NDAI0F044301.38ON1361121322e-09
NDAI0E011508.679ON2361291336e-09
TPHA0B048201.38ON138981287e-09
Skud_16.1268.679ON2871291321e-08
KLTH0D11308g8.679ON2711171311e-08
NCAS0B016408.679ON2401141301e-08
Smik_3.421.38ON110791241e-08
Ecym_23948.679ON2811351311e-08
Kpol_2002.361.38ON109941242e-08
ZYRO0F17732g1.38ON1391061252e-08
YCL035C (GRX1)1.38ON110791223e-08
KLTH0F01276g1.38ON138951234e-08
Skud_3.271.38ON110791205e-08
TBLA0B038208.679ON251991266e-08
Suva_16.1548.679ON2831301266e-08
TDEL0C066401.38ON143991173e-07
NCAS0A003601.38ON138941146e-07
CAGL0M02167g8.679ON2331351177e-07
NCAS0B088701.38ON109941128e-07
TPHA0B03560singletonON106821102e-06
Suva_3.1781.38ON316941162e-06
Smik_6.3538.679ON2861251152e-06
TBLA0A050801.38ON118871092e-06
NDAI0A003801.38ON109971057e-06
KNAG0G025808.679ON2781251072e-05
TDEL0E05740singletonON108931022e-05
KNAG0F002501.38ON142831033e-05
ACR146W8.679ON21364992e-04
NDAI0E028908.519ON15583920.001
TPHA0E037301.38ON10699890.001
KNAG0A020908.519ON14983850.007
KLTH0E12034g8.519ON136101830.012
KAFR0A011908.519ON15783810.028
Kpol_513.118.519ON14783810.028
NCAS0B022908.519ON13940800.032
KLLA0B09636g8.519ON142104800.032
NCAS0C022408.519ON16183790.044
ZYRO0F08932g8.519ON147119770.090
SAKL0H10626g8.519ON143104770.093
CAGL0M07271g8.519ON149104760.12
TPHA0L015208.519ON150104760.13
Kwal_27.119488.519ON136101750.13
Suva_16.2558.519ON14983740.22
SAKL0B00792g8.15ON981196760.23
Smik_16.1788.519ON149104740.24
Skud_16.2248.519ON149104730.28
YPL059W (GRX5)8.519ON150104730.33
TPHA0B009504.211ON10877700.50
NDAI0C053908.519ON14446710.56
TBLA0H035008.519ON14983690.96
KAFR0F016801.158ON31961701.2
ZYRO0B07634g4.211ON10975671.3
Ecym_11878.519ON13983671.6
CAGL0J04686g4.300ON40956691.6
TPHA0K009607.233ON85061673.5
ADR053W8.519ON138106643.6
TBLA0F019207.276ON45156664.8
TDEL0E00250singletonON58739656.8
Skud_4.3568.240ON26271647.4
Smik_4.4008.337ON13781627.8
Kwal_55.200545.397ON41064648.5
TPHA0B033408.240ON24971638.6
KLTH0A05104g7.276ON43956639.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.141
         (204 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   368   e-131
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   246   5e-83
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   229   2e-76
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   222   2e-73
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   158   6e-48
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   156   3e-47
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   149   2e-44
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   148   2e-44
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   144   6e-43
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   143   2e-42
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   144   3e-42
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   141   1e-41
Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   140   2e-41
KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   136   1e-39
TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   137   2e-39
YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   136   2e-39
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   135   3e-39
Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   134   9e-39
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   132   4e-38
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   129   8e-37
Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   127   1e-35
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   124   1e-34
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   118   2e-32
TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   106   3e-28
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    80   1e-17
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    75   1e-15
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    68   5e-14
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    68   6e-14
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    68   7e-14
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    67   2e-13
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    64   3e-12
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    66   4e-12
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    64   9e-12
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    60   2e-11
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    63   2e-11
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    59   4e-11
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    59   6e-11
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    60   6e-11
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    60   2e-10
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    60   2e-10
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    58   2e-10
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    59   4e-10
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    59   6e-10
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    57   6e-10
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    57   7e-10
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    56   2e-09
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    55   2e-09
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    56   6e-09
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    54   7e-09
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    55   1e-08
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    55   1e-08
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      55   1e-08
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    52   1e-08
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    55   1e-08
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    52   2e-08
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    53   2e-08
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    52   3e-08
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    52   4e-08
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    51   5e-08
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    53   6e-08
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    53   6e-08
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    50   3e-07
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    49   6e-07
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    50   7e-07
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    48   8e-07
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      47   2e-06
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    49   2e-06
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    49   2e-06
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    47   2e-06
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    45   7e-06
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    46   2e-05
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    44   2e-05
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    44   3e-05
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    43   2e-04
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      40   0.001
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    39   0.001
KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.51...    37   0.007
KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa] ...    37   0.012
KAFR0A01190 Chr1 complement(230841..231314) [474 bp, 157 aa] {ON...    36   0.028
Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON} ...    36   0.028
NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519      35   0.032
KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar...    35   0.032
NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519      35   0.044
ZYRO0F08932g Chr6 complement(723285..723728) [444 bp, 147 aa] {O...    34   0.090
SAKL0H10626g Chr8 (914158..914589) [432 bp, 143 aa] {ON} uniprot...    34   0.093
CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} simila...    34   0.12 
TPHA0L01520 Chr12 complement(319260..319712) [453 bp, 150 aa] {O...    34   0.13 
Kwal_27.11948 s27 complement(1014824..1015234) [411 bp, 136 aa] ...    33   0.13 
Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W...    33   0.22 
SAKL0B00792g Chr2 (70679..73624) [2946 bp, 981 aa] {ON} similar ...    34   0.23 
Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W...    33   0.24 
Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W...    33   0.28 
YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}  GRX5Hydrop...    33   0.33 
TPHA0B00950 Chr2 complement(217773..218099) [327 bp, 108 aa] {ON...    32   0.50 
NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {...    32   0.56 
TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON...    31   0.96 
KAFR0F01680 Chr6 complement(332789..333748) [960 bp, 319 aa] {ON...    32   1.2  
ZYRO0B07634g Chr2 complement(600410..600739) [330 bp, 109 aa] {O...    30   1.3  
Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to...    30   1.6  
CAGL0J04686g Chr10 complement(446347..447576) [1230 bp, 409 aa] ...    31   1.6  
TPHA0K00960 Chr11 complement(197803..200355) [2553 bp, 850 aa] {...    30   3.5  
ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic hom...    29   3.6  
TBLA0F01920 Chr6 complement(479280..480635) [1356 bp, 451 aa] {O...    30   4.8  
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                 30   6.8  
Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 b...    29   7.4  
Smik_4.400 Chr4 (727540..727953) [414 bp, 137 aa] {ON} YDR156W (...    28   7.8  
Kwal_55.20054 s55 (232759..233991) [1233 bp, 410 aa] {ON} YDR346...    29   8.5  
TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.24...    29   8.6  
KLTH0A05104g Chr1 (426808..428127) [1320 bp, 439 aa] {ON} weakly...    29   9.2  

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  368 bits (944), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 182/204 (89%)

Query: 1   MAIVINKXXXXXXXXXXXXXXXXXXXXXXSSTSAGESGVNYHPGSLVTFDESGNAPGTPE 60
           MAIVINK                      SSTSAGESGVNYHPGSLVTFDESGNAPGTPE
Sbjct: 1   MAIVINKRNVRVLVITNLLLVLVFLVIRNSSTSAGESGVNYHPGSLVTFDESGNAPGTPE 60

Query: 61  SIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLA 120
           SIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLA
Sbjct: 61  SIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLA 120

Query: 121 ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDK 180
           ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDK
Sbjct: 121 ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDK 180

Query: 181 LLESLKEWSNGAFTVEAVPPSEST 204
           LLESLKEWSNGAFTVEAVPPSEST
Sbjct: 181 LLESLKEWSNGAFTVEAVPPSEST 204

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  246 bits (628), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 149/203 (73%)

Query: 1   MAIVINKXXXXXXXXXXXXXXXXXXXXXXSSTSAGESGVNYHPGSLVTFDESGNAPGTPE 60
           MAIVINK                      S+ +  ES +  H  SL T++++GNAPGT +
Sbjct: 1   MAIVINKRNVRVLVITNLLLILVFLVVRNSNANVNESTITPHGTSLATYNDAGNAPGTHK 60

Query: 61  SIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLA 120
           S+H S ANKQ KE DE NENS+E +FDAA EY+ ILK+S M+VFSKS+CPFSKKLK LLA
Sbjct: 61  SVHDSDANKQVKEPDETNENSEEAQFDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLA 120

Query: 121 ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDK 180
           ESY FSPSY+VVELD+  HT ELQ++IEK TGRRTVPNV+I+G+S+GGCD++  LH+ DK
Sbjct: 121 ESYTFSPSYYVVELDKREHTSELQEHIEKSTGRRTVPNVVIDGISRGGCDEITALHENDK 180

Query: 181 LLESLKEWSNGAFTVEAVPPSES 203
           LL S KEWS+G FTVEA+ PS+S
Sbjct: 181 LLNSFKEWSSGKFTVEAISPSQS 203

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  229 bits (585), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 143/203 (70%), Gaps = 1/203 (0%)

Query: 1   MAIVINKXXXXXXXXXXXXXXXXXXXXXXSSTSAGESGVNYHPGSLVTFDESGNAPGTPE 60
           MAIVINK                      S+ S  ES   +HP SLVTFD SGNAPGT +
Sbjct: 1   MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQ 60

Query: 61  SIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLA 120
           S+H +V N QDKE +EV++NS + +FDAA EY  I++QS M+VFSK+ CP+SKKLK LL 
Sbjct: 61  SVHDTV-NTQDKEAEEVDKNSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKLKALLT 119

Query: 121 ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDK 180
            SY FSPSY+VVELD+H HT ELQD IEKVTGRRTVPNVII G S+GG  ++  LHK D+
Sbjct: 120 NSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELHKNDE 179

Query: 181 LLESLKEWSNGAFTVEAVPPSES 203
           LL+S K+WS+GAFTV+A   SES
Sbjct: 180 LLDSFKKWSDGAFTVKANSQSES 202

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  222 bits (565), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 137/204 (67%)

Query: 1   MAIVINKXXXXXXXXXXXXXXXXXXXXXXSSTSAGESGVNYHPGSLVTFDESGNAPGTPE 60
           MAIVINK                      S+  A E+    HPGSL TFD+SGNAPGTPE
Sbjct: 1   MAIVINKRNVRVLVITNILLILVFLVVRSSNADASEAVKIIHPGSLATFDQSGNAPGTPE 60

Query: 61  SIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLA 120
           S   +V NKQDKEV E NE+SK V FDAA EY  IL+ S  VVFSK+ CP+SKKLK+LLA
Sbjct: 61  SADKAVTNKQDKEVGETNEDSKGVTFDAAAEYGKILEYSPFVVFSKTGCPYSKKLKSLLA 120

Query: 121 ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDK 180
           ESY  +PSY+VVELD+H H  EL+DYI   TGR TVPNV+ING+S+GG  +M  LH+ D 
Sbjct: 121 ESYAITPSYYVVELDEHEHGKELKDYIGDKTGRSTVPNVVINGISRGGYTEMAALHENDT 180

Query: 181 LLESLKEWSNGAFTVEAVPPSEST 204
           L++S KEWS+  FTV+A   SE T
Sbjct: 181 LVDSFKEWSSDKFTVKATSQSERT 204

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  158 bits (399), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 92/117 (78%)

Query: 79  ENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHG 138
           ++S  V+F+AA EY +IL++S MVVFSKSYCPFS KLK+LLA+ Y+F+PSY V+ELD+H 
Sbjct: 105 KDSSSVEFNAAKEYASILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHE 164

Query: 139 HTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTV 195
           H  ELQ YI  VTGR TVPNV+IN VS+GG DD+  LHK+ KLL+SLKEW     TV
Sbjct: 165 HGAELQKYIGDVTGRSTVPNVVINRVSRGGSDDLRALHKDGKLLDSLKEWGGKQLTV 221

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  156 bits (394), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (75%)

Query: 75  DEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVEL 134
           +E NE +  V F+AA EY +IL+ S MVVFSKS+CPFS KLK L A  Y+F+P++++VEL
Sbjct: 91  NEQNEENTAVTFNAAKEYASILELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVEL 150

Query: 135 DQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFT 194
           D+H H D LQ YI++ TGR TVPNV+INGVS+GG DD+  LH + KLL+SLK W +G F 
Sbjct: 151 DKHQHGDLLQAYIKEKTGRGTVPNVVINGVSRGGSDDLRALHADGKLLDSLKTWGSGNFQ 210

Query: 195 VEAV 198
           V+ +
Sbjct: 211 VKQI 214

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  149 bits (376), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 99/146 (67%), Gaps = 8/146 (5%)

Query: 57  GTPESIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLK 116
           G P SI  +  NK       ++ N +   FDAA EY  IL  S +++FSKSYCPFS  LK
Sbjct: 94  GLPSSIGTATDNK-------ISNNDENGTFDAAKEYAMILDLSPVIIFSKSYCPFSSNLK 146

Query: 117 NLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLH 176
            LL++ + F+P+Y+V+ELD+H H  ELQ YI K T R TVPN+I+NG+S+GG D++V L+
Sbjct: 147 QLLSKEFSFTPNYYVIELDRHSHGAELQAYIAKKTDRSTVPNMIVNGISRGGRDEIVALN 206

Query: 177 KEDKLLESLKEWSNGAFTV-EAVPPS 201
            E KLLE+L +WS+  FTV +A  PS
Sbjct: 207 DEGKLLEALNDWSDNTFTVKQAEKPS 232

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  148 bits (373), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%)

Query: 60  ESIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLL 119
           + I   V  K D       + ++E +FD A EY+ IL    M+VFSKS CPFSKKLK+LL
Sbjct: 69  QEIKNEVGIKGDDGASSGTDFTQEKEFDPAKEYQYILANRPMIVFSKSRCPFSKKLKDLL 128

Query: 120 AESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKED 179
           A+ ++FSPSY VVELD+H H  ELQ +I  +TGR TVPNVIINGVS+GGCDD   L ++ 
Sbjct: 129 AKEFEFSPSYMVVELDKHEHGAELQKHIGSLTGRSTVPNVIINGVSRGGCDDFEKLQEKG 188

Query: 180 KLLESLKEWSNGAFTV 195
           +LL SLK W + A TV
Sbjct: 189 ELLSSLKTWCDKALTV 204

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  144 bits (362), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (73%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           F  A EY++IL +S +V+FSKSYCP+S KLK LLA  +KF+P+Y VVELD+H H  ELQ 
Sbjct: 82  FSPAVEYDSILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELDEHEHGPELQK 141

Query: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTV 195
           YI + TGR TVPN+I+NGVS GGCDD+V L +  KLL+ L EW   A  V
Sbjct: 142 YIAEKTGRSTVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEWGGSAVNV 191

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  143 bits (361), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 88/115 (76%)

Query: 83  EVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDE 142
           EV FD A EY +IL++  MV+FSK++CP+SK LK LL+ +++ +P   V+ELD+H H +E
Sbjct: 96  EVPFDVAKEYTSILQRGPMVIFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEE 155

Query: 143 LQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVEA 197
           LQ YI++ TGR TVPN+IING SKGG DDM  L  E+ LL+SL EWSNGA+ V+A
Sbjct: 156 LQAYIKEQTGRGTVPNLIINGNSKGGSDDMKKLFDENVLLDSLNEWSNGAYEVQA 210

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  144 bits (362), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 79  ENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHG 138
           E++++ +FD   EY  IL  S ++VFSKS CP+SKKLK LL + Y F+PSY V+ELD+H 
Sbjct: 126 EHAQQTEFDPVKEYAMILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYFVIELDRHH 185

Query: 139 HTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTV 195
           +  ELQ Y+E+ TGR TVPNVIING S+GG D+  +LH E KLL S K+WS G FTV
Sbjct: 186 NGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQGTFTV 242

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  141 bits (356), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 1/129 (0%)

Query: 67  ANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFS 126
           A+K+D +V    + SK V FDAA  Y  IL  S MVVFSKS CP S  LK LL  +Y+F 
Sbjct: 80  ASKEDVDVARAQQQSK-VLFDAAKTYNEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFL 138

Query: 127 PSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLK 186
           P Y VVELD+H +  ELQ Y+ K T R TVPN++INGVS+GG D ++ LHK  +LLESL+
Sbjct: 139 PDYQVVELDKHANGAELQKYVTKTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLR 198

Query: 187 EWSNGAFTV 195
           +W+NG   V
Sbjct: 199 KWANGKHAV 207

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  140 bits (353), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 80/106 (75%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           FD A EY+ IL  S M+VFSKS CP+S K+K LL + Y+F+P Y VVELD+H H  ELQD
Sbjct: 91  FDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQD 150

Query: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNG 191
           YI KVT R TVPNV+I+GVS+GG DD   L  + KLLESL++WS+G
Sbjct: 151 YIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDG 196

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  136 bits (342), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 82/111 (73%), Gaps = 1/111 (0%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           ++A  EY+ IL QS +VVFSKSYCPFS +LKNLL E Y+F P Y +VELD+H +  ELQ 
Sbjct: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQK 154

Query: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196
           YI   TGR TVPNVIING+S+GG D+   LH+++ LL+SLK W+    +V+
Sbjct: 155 YIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVK 205

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  137 bits (344), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 84/116 (72%)

Query: 83  EVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDE 142
           E +FD A EY  IL  S ++VFSKS+CP+S +LK LL + Y  +PSY V+ELD+H H   
Sbjct: 122 EGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVA 181

Query: 143 LQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVEAV 198
           LQ +IEK TGR TVPN++ING S+GG DD+  LH + +LLESL +W +G FTV+ +
Sbjct: 182 LQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQL 237

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  136 bits (342), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 85/111 (76%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           F+   EY  IL  S +++FSKS C +SK +K LL   Y+F P+Y+++ELD+HGH +ELQ+
Sbjct: 113 FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQE 172

Query: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196
           YI+ VTGR TVPN+++NGVS+GG +++  LH + KLLESL+ WS+G F+VE
Sbjct: 173 YIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVE 223

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  135 bits (341), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 83/111 (74%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           F+   EY  +L  S +++FSKS CP+S+ +K LL   Y+F P+Y+++ELD+HGH +ELQ+
Sbjct: 114 FNVQKEYSLMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQE 173

Query: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196
           YI  +TGR  VPN++ING+S+GG +++  LH + KLL SL+ WSNG F+VE
Sbjct: 174 YIRLMTGRGAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGKFSVE 224

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  134 bits (338), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 106/184 (57%), Gaps = 30/184 (16%)

Query: 43  PGSLVTFDE---SGNAPGTPESIHGSVANKQDKEVDE-VNENSKEVK------------- 85
           P  L+  D+   SG +     S+  S  NK + EVDE +NE  ++V              
Sbjct: 42  PPQLLDIDKNSISGRSSRRIASVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLS 101

Query: 86  -------------FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVV 132
                        F+   EY  +L  + +++FSKS C +SK LK LL   Y+F P+Y+++
Sbjct: 102 AIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYII 161

Query: 133 ELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGA 192
           ELD+H H +EL++YI+  TGR TVPN++INGVS+GG +++  LH + KLL SL+EWS G 
Sbjct: 162 ELDKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGK 221

Query: 193 FTVE 196
           FTVE
Sbjct: 222 FTVE 225

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  132 bits (333), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 84/111 (75%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           F+   EY  +L  S +++FSKS C +SK +K LL   Y+F P+Y+++ELD+HGH +ELQ+
Sbjct: 114 FNVQKEYSLMLDLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQE 173

Query: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196
           YI+  TGR TVPN+++NG+S+GG +++  LH + KLLESL+ WS+G F+VE
Sbjct: 174 YIKLKTGRGTVPNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGKFSVE 224

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  129 bits (324), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 96/151 (63%)

Query: 48  TFDESGNAPGTPESIHGSVANKQDKEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKS 107
           T +E+   PG+ +    +  +  +KE  E  E + + ++  A E++ ++K + +V+FSKS
Sbjct: 76  TSNENAQLPGSKDQTDSNSNSLSNKEGQEDAEEAADAEYSPAKEFQKLVKSAPIVIFSKS 135

Query: 108 YCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKG 167
           YCPFSK LK LL ++Y+  P+Y  VE+DQH + D+L  YI+K+TGR TVPN+I NG SKG
Sbjct: 136 YCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYSYIKKLTGRNTVPNLIANGDSKG 195

Query: 168 GCDDMVTLHKEDKLLESLKEWSNGAFTVEAV 198
           G DDM+ LH  ++L   L EW  G   V  V
Sbjct: 196 GFDDMLALHNSNELESKLIEWGVGELQVSKV 226

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  127 bits (319), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 88/128 (68%), Gaps = 1/128 (0%)

Query: 77  VNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQ 136
           V   S+ VKFD A EY  I + S +++++K++CP+ K+L  LL ESY F P +H V+LD+
Sbjct: 135 VQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDK 194

Query: 137 HGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196
           H H DELQ ++ K TG  TVPN +ING S GG DD++ LH+  KL+E+++E S+ +  V+
Sbjct: 195 HTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVK 254

Query: 197 AV-PPSES 203
           A+  PS S
Sbjct: 255 AIEKPSNS 262

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  124 bits (310), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           FD A EY  IL +  MV+FSKS CP+S KLK LL  +++FSP   +VELD+H H D LQ 
Sbjct: 110 FDVAKEYAAILAKGPMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHEHGDVLQG 169

Query: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVEAVPP 200
           YI++ TGR TVPN+I+ G+S+GG DD+  L  E  LL+ LK W  G   V    P
Sbjct: 170 YIKEETGRGTVPNLIVGGLSRGGSDDIQKLFDEGTLLKELKTWGFGDLEVTQTTP 224

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  118 bits (296), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 88/126 (69%), Gaps = 2/126 (1%)

Query: 79  ENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHG 138
           ++S  + ++ A  Y+ IL  + +++FSK+ CP+S KLK+LL ++Y+F+P Y V+ELD   
Sbjct: 125 DSSDNIGYNPADRYQKILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEK 184

Query: 139 HTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVEAV 198
            T ELQ YI + TGR+TVPN+++NG S GG D++  LH + +LL+S+++WS+   TV   
Sbjct: 185 RTKELQFYISQQTGRKTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKKVTV--T 242

Query: 199 PPSEST 204
           P  +ST
Sbjct: 243 PKQKST 248

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  106 bits (264), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 85  KFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQ 144
           KFD A EY  I++ + +V+FSK++CP+ K+LK LLA++Y+FSP   ++ELD+H + DEL 
Sbjct: 69  KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128

Query: 145 DYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLE 183
            YI++ T   TVPN+I+NG S GG D +  L  +DKL+E
Sbjct: 129 SYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQ-DDKLVE 166

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 80.1 bits (196), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 71/121 (58%), Gaps = 15/121 (12%)

Query: 84  VKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDEL 143
           + FD +  ++ IL  S +V+F+KS    S+ LKNLL + Y+ SP   VVELD+H    EL
Sbjct: 123 LAFDPSINFKEILSTSPVVIFTKSSDLGSQYLKNLLTKEYQISPQVAVVELDKHAKGKEL 182

Query: 144 QDYIE--KVTGRRT----------VPNVIINGVS---KGGCDDMVTLHKEDKLLESLKEW 188
           QDYI+  K+T  ++          VP + INGVS   KG  DD+  LHK+  LL+ L+ +
Sbjct: 183 QDYIKLNKLTAYKSNLSPSDDIPEVPYLFINGVSIINKGLKDDIKKLHKDGSLLDKLRSF 242

Query: 189 S 189
           +
Sbjct: 243 A 243

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 74.7 bits (182), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 80  NSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGH 139
           N +   FD  T +  IL  S +V+F K+    S   KNLL   Y+ SP   VV+LD+H +
Sbjct: 140 NPESASFDVETNFNEILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVAVVDLDKHSN 199

Query: 140 TDELQDYIEK---VTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196
             +LQ+YI K   +T  + +P + IN V+    D++   HK+  LLE+ K+  NG    +
Sbjct: 200 GAKLQEYIRKNKLMTKDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKKLGNGKIMFK 259

Query: 197 AV-PPSES 203
            +  PS S
Sbjct: 260 KIEAPSNS 267

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 67.8 bits (164), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGR 153
           ++ Q  + V +K+YCP+ K  L  L  E         V+ELD+  +  E+QD +E+++G+
Sbjct: 47  LIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQ 106

Query: 154 RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLK 186
           RTVPNV ING   GG  D+ +L K  KL E LK
Sbjct: 107 RTVPNVYINGKHIGGNSDLESLKKSGKLAEILK 139

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 67.8 bits (164), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGR 153
           ++ Q  + V +K+YCP+ K  L  L  E         V+ELD+  +  E+QD +E+++G+
Sbjct: 47  LIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQ 106

Query: 154 RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLK 186
           +TVPNV ING   GG  D+ TL K  KL E LK
Sbjct: 107 KTVPNVYINGKHIGGNSDLETLKKNGKLAEILK 139

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 82  KEVKFDAATEYETILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHT 140
           K V  +  +  + ++ Q  + V +K+YCP+ K  L  L  E         V+ELD+  + 
Sbjct: 34  KMVSQETVSHVKDLIAQKDVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNG 93

Query: 141 DELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLK 186
            E+QD +E+++G++TVPNV ING   GG  D+ TL K  KL E LK
Sbjct: 94  SEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILK 139

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVV-ELDQHGHTDELQDYIEKVTGR 153
           ++ Q  + V +K+YCP+ K   + L +      S  VV ELD+  +  E+QD +E+++G+
Sbjct: 47  LIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKAVVLELDEMSNGSEIQDALEEISGQ 106

Query: 154 RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLK 186
           +TVPNV ING   GG  D+  L K  KL E LK
Sbjct: 107 KTVPNVYINGKHIGGNSDLEALKKNGKLAELLK 139

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 74  VDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFS-PSYHVV 132
           + ++ +  K V      + ++++KQS + V SK+YCP+ ++ K  L E  K   P   V+
Sbjct: 40  IVKIRQQKKMVSPATVQQVQSLIKQSKIFVASKTYCPYCRRAKKTLFEDKKIPLPEAKVL 99

Query: 133 ELDQHGHTD-ELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSN 190
           ELD  G    ++Q  + +++G+RTVPN+ I G   GG  ++  L    +L   LKE  N
Sbjct: 100 ELDIMGQEGVDIQAALLELSGQRTVPNIYIGGKHIGGNSELQALESSGELDGLLKEVLN 158

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 62/117 (52%), Gaps = 11/117 (9%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           FD    +  I+  S  V+F KS    S  L+ LL E Y+ SP   VV+LD+H +  EL+ 
Sbjct: 228 FDPERSFNQIIHTSPAVLFIKSSSTDSLNLRKLLKEEYEISPELAVVDLDKHSNGVELEQ 287

Query: 146 YIEK---VTGRRT-----VPNVIING---VSKGGCDDMVTLHKEDKLLESLKEWSNG 191
           YI++   +T  RT     VP + +NG   ++ G   D+  LHK   LLE L+  S+G
Sbjct: 288 YIKQNKLLTEERTNSPINVPYLFLNGNSVINNGLSKDISKLHKNGHLLEKLRSLSDG 344

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 72/143 (50%), Gaps = 24/143 (16%)

Query: 78  NENSKEVK------------FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKF 125
           N+NSK++K            F+A   ++ IL  S  V+F KS    S+ LKNLL+  Y+ 
Sbjct: 121 NDNSKKLKDSQNVHLLSSTSFNAEDNFKQILNTSPAVLFIKSSEWDSQYLKNLLSIEYEI 180

Query: 126 SPSYHVVELDQHGHTDELQDYIE---------KVTGRRTVPNVIINGVS---KGGCDDMV 173
           SP   +V+L++H + ++L +YI+         K +    +P + INGVS    G   D+ 
Sbjct: 181 SPQLAIVDLEKHSNGNQLLNYIKKNKLLPPSNKASSTPNLPYLFINGVSIINNGLSKDIK 240

Query: 174 TLHKEDKLLESLKEWSNGAFTVE 196
            LH    LL  LK +S+G    E
Sbjct: 241 QLHSNGHLLNKLKSYSDGHIFFE 263

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 58/104 (55%), Gaps = 6/104 (5%)

Query: 88  AAT--EYETILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQ 144
           AAT    + ++  S + V SK+YCP+ +  LK L  E         V++L+Q     ++Q
Sbjct: 4   AATIARVQGLINSSKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQ 63

Query: 145 DYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKE---DKLLESL 185
           D + ++TG++TVPN+ ING   GG  D+  L+     DKLL SL
Sbjct: 64  DALAEITGQKTVPNIFINGKHIGGNSDLQELNNSGDLDKLLASL 107

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 71/142 (50%), Gaps = 14/142 (9%)

Query: 68  NKQDKEVDEVNENS-KEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFS 126
           NK ++  D+ + N+ K   FDAA  Y+ I+  S +V+F KS    S ++K LL  SY+  
Sbjct: 147 NKNNRNNDKYDINAYKNAAFDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEIL 206

Query: 127 PSYHVVELDQHGHTDELQDYIEK---VTG--------RRTVPNVIINGVS--KGGCDDMV 173
           P   +V+LD+H     L DYI K   +T         +  VP ++INGVS       +  
Sbjct: 207 PEIAIVDLDRHVQGALLHDYIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFH 266

Query: 174 TLHKEDKLLESLKEWSNGAFTV 195
            LH E  LL+ LK  +  +  +
Sbjct: 267 KLHNEGLLLQKLKNLAGDSVMI 288

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 6/103 (5%)

Query: 91  EYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPS-YHVVELDQHGHTDE-LQDYIE 148
           + + +++Q+ + + SK+YCP+ +  K  L E  +   S   ++ELD  G     +Q  ++
Sbjct: 9   QVQALIQQNRVFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELDTMGEEGAVIQAALQ 68

Query: 149 KVTGRRTVPNVIINGVSKGGCDDMVTLHKE---DKLL-ESLKE 187
           +++G+RTVPN+ ING   GG  D+  L      D+LL E+L+E
Sbjct: 69  ELSGQRTVPNIYINGRHVGGNSDLEALKASGELDQLLEEALRE 111

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 95  ILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGR 153
           ++ +  + V SKSYCP+SK  L  L  E    +    V++++Q     ++QD + ++TG+
Sbjct: 13  LINEKDVFVASKSYCPYSKAALNTLFTELNVPTSKALVLQVNQLPEGSDIQDALLELTGQ 72

Query: 154 RTVPNVIINGVSKGGCDDMVTLH---KEDKLLESLKE 187
           RTVPN+ I G   GG DD+  L    K +KLLE + E
Sbjct: 73  RTVPNIYIKGKHIGGNDDLQILKQSGKLEKLLEGILE 109

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 60.1 bits (144), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 57/95 (60%), Gaps = 4/95 (4%)

Query: 93  ETILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVT 151
           +T++KQS + V SK+YCP+ +  L+ L  +    +    V++L+Q     E+QD +++++
Sbjct: 67  QTLIKQSKIFVASKTYCPYCQATLRTLFDDKKVPNDKIKVLQLNQLDDGAEIQDALQEIS 126

Query: 152 GRRTVPNVIINGVSKGGCDDMVTLHKE---DKLLE 183
           G+RTVPN+ I G   GG  D+  L      D+LLE
Sbjct: 127 GQRTVPNIYILGKHIGGNSDLQELAAAGELDRLLE 161

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 10/123 (8%)

Query: 84  VKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDEL 143
           + FDA   ++ I+  S +V+F KS  P S  LKNLL   Y+ SP   VV+LD+H     L
Sbjct: 120 LNFDAERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQGQLL 179

Query: 144 QDYIE--KVTGRRT-----VPNVIINGVS---KGGCDDMVTLHKEDKLLESLKEWSNGAF 193
           Q YI+  ++T         VP + INGVS    G   D+     +  LL+ LK +++   
Sbjct: 180 QKYIKAYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFASDNV 239

Query: 194 TVE 196
            ++
Sbjct: 240 MIQ 242

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 16/135 (11%)

Query: 85  KFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQ 144
           +F  +  ++ IL  S +++F KS    S  LKN+L   Y FSP   VV+LD+H   D +Q
Sbjct: 147 RFSPSLGFQQILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGDSMQ 206

Query: 145 DYIE--KVTGRRT----------VPNVIINGVS---KGGCDDMVTLHKEDKLLESLKEWS 189
           +YI+  ++   ++          VP + INGVS   K   DD++  H +  LL  L+  +
Sbjct: 207 EYIQLNRLATYKSNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKLRHVA 266

Query: 190 NGAFTVEAVP-PSES 203
           +   ++  V  PS S
Sbjct: 267 DSKVSISKVDIPSNS 281

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 93  ETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSP-SYHVVELDQHGHTDELQDYIEKVT 151
           + ++K + + V SK+YCP+ +    LL E  K +    +VV+LD      E+Q+ + +++
Sbjct: 40  QGLIKNNKIFVASKTYCPYCQATLKLLFEDKKLTKDQVYVVQLDTIKEGSEIQEALAEIS 99

Query: 152 GRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           G++TVPNV I+G   GG  D+  L    KL   LK+
Sbjct: 100 GQKTVPNVYISGEHIGGNSDLQALESSGKLDALLKK 135

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 74/156 (47%), Gaps = 16/156 (10%)

Query: 51  ESGNAPGTPESIHGSVANKQDKEVDEV-----NENSKEVKFDAATEYETILKQSHMVVFS 105
           +SG+   T  +I   VA   D    EV     N  +    FDAA  +  IL  S +V+F 
Sbjct: 108 DSGSGSATQRAIATRVAATADIVRSEVVHGHGNYRASGSDFDAAASFSEILNTSPVVIFV 167

Query: 106 KSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTV-------PN 158
            S    S+ L++LL   Y+ SP+  VV+L++H    +L+ +I      +T        P 
Sbjct: 168 DS-AQDSELLRSLLHRHYEVSPAPAVVDLEKHSRGAQLESFIRLYKTDQTSNPSPREPPY 226

Query: 159 VIINGVSKGGCD---DMVTLHKEDKLLESLKEWSNG 191
           + +NG S    D   D+  LH ++KLLE L+  + G
Sbjct: 227 LFVNGQSVINTDFKSDIQDLHAQNKLLEKLRSVAEG 262

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 12/132 (9%)

Query: 77  VNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQ 136
           + +N    KFD  T++  I++ S  V+F KS    S  LKNLL   ++ SP    V+L++
Sbjct: 145 LQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATVDLEK 204

Query: 137 HGHTDELQDYIEK---------VTGRRTVPNVIINGVS---KGGCDDMVTLHKEDKLLES 184
           H H  EL+ YI++                P + +NG+S   +G   D++  H +  LL  
Sbjct: 205 HSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEPHSKGLLLPL 264

Query: 185 LKEWSNGAFTVE 196
           LK  + G   VE
Sbjct: 265 LKSEARGNLLVE 276

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 57.4 bits (137), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 89  ATEYETILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYI 147
            T+ + ++ +  + V SK+YCP+ +  LK L  E         V++LD+     E+Q+ +
Sbjct: 55  VTQVKELIGEKPIFVASKTYCPYCRATLKTLFKELEIPESEAVVLQLDEMPDGPEIQEAL 114

Query: 148 EKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
             + G++TVPN+ I G   GG DD+ TL K  KL   LKE
Sbjct: 115 FDINGQKTVPNIYIKGQHIGGNDDLQTLKKAGKLEGLLKE 154

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 57.0 bits (136), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGR 153
           ++ Q  + V +KSYCP+ +  L+ L  + +       V++L+Q    D++Q  + ++TG+
Sbjct: 45  LIGQKKVFVAAKSYCPYCQASLQTLFTDYHVPKDKSLVLQLNQMEDGDDIQAALAEITGQ 104

Query: 154 RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLK 186
           RTVPN+ I+G   GG  D+  L    KL E LK
Sbjct: 105 RTVPNIYIDGKHIGGNSDLQQLKSSGKLDELLK 137

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 81  SKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVV-ELDQHGH 139
           +K V  D     + ++ Q  + V SKSYCP+ +  K  L E  K      VV ELD+   
Sbjct: 32  NKMVSQDTVNSVKNMIGQKKIFVASKSYCPYCRAAKQTLFEELKVPMDKAVVLELDEIEE 91

Query: 140 TDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKL 181
             ++Q  + ++ G+ TVPN+ I+G   GG  D+  L +  KL
Sbjct: 92  GSDIQQALAEINGQNTVPNIYIDGQHIGGNSDLQKLKQTGKL 133

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 65/112 (58%), Gaps = 5/112 (4%)

Query: 79  ENSKEVKFDAATEY-ETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVV-ELDQ 136
           +N+ ++      EY + ++K++ +++F+KSYCP+ K  K+ + E      S  +V +LD 
Sbjct: 25  QNTNKMVSQQTVEYVQKLIKENKVIIFAKSYCPYCKAAKHTIFEEINVPKSKALVLDLDL 84

Query: 137 HGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKE---DKLLESL 185
             +  E+Q  +  + G++TVP+V ING   GG  ++  ++K     K++E+L
Sbjct: 85  MDNGQEIQQALLAINGQKTVPHVYINGEFIGGNSEVQKIYKSGELQKMVEAL 136

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 55.8 bits (133), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 11/129 (8%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           F+    +  IL+ S MV+F KS    SK ++++L + Y+ SP   VV+LD+H H DEL++
Sbjct: 108 FNPEVNFFQILETSPMVLFIKSSERDSKIIRDILTKEYEISPELAVVDLDKHKHGDELEE 167

Query: 146 YIEK---------VTGRRTVPNVIINGVS-KGGCDDMVTLHKEDKLLESLKEWSNGAFTV 195
           +I            +   ++P + +N VS +     +  LH ++ L++  +  SNG    
Sbjct: 168 FIRLNKLNEQAIFSSSLASLPYLFVNEVSMEIDTATIKDLHSKNFLIKKFELMSNGKVLF 227

Query: 196 EAV-PPSES 203
           E   PPS S
Sbjct: 228 ERKNPPSNS 236

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 53.9 bits (128), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 82  KEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTD 141
           +EV  ++      ++KQ  + V +KSYCP+ K     L +  K  P    + L   G +D
Sbjct: 29  REVSPESIARVNALIKQKSVFVAAKSYCPYCKNTLITLFDELKV-PKEKALVLQLDGMSD 87

Query: 142 --ELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHK 177
             ELQD ++++ G+RTVP + I+G   GG  ++  L K
Sbjct: 88  GLELQDTLQQINGQRTVPQIYIDGKHVGGNSELQKLKK 125

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 62/129 (48%), Gaps = 12/129 (9%)

Query: 80  NSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGH 139
           N  + +FD    +  I+  S  V+F KS    S  LKNLL   ++ SP    V+L++H H
Sbjct: 151 NDGQKEFDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSH 210

Query: 140 TDELQDYIEK-------VTGRRTV--PNVIINGVS---KGGCDDMVTLHKEDKLLESLKE 187
             +L+ YI++        T   ++  P + +NGVS    G   D++  H E  LL  LK 
Sbjct: 211 GYQLEKYIKQNKLSINPSTALESIHSPYLFLNGVSVINNGMAKDIIEPHSEGLLLSILKS 270

Query: 188 WSNGAFTVE 196
            + G   VE
Sbjct: 271 EARGNLLVE 279

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 59/117 (50%), Gaps = 12/117 (10%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           FD A  ++ IL  S +V+F  S    S++L+ LL   Y+ SP+  VV+L++H    +L+ 
Sbjct: 143 FDPAANFQEILSASPVVLFVDS-AQDSERLRALLQRDYEVSPAPAVVDLEKHSRGAQLET 201

Query: 146 YIEKVTGR--------RTVPNVIINGVSKGGCD---DMVTLHKEDKLLESLKEWSNG 191
           YI     +        R  P + +NG S    D   D+  LH +++LL  LK  + G
Sbjct: 202 YIRYYRTKPASATAVPRQPPYLFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVAEG 258

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 7/114 (6%)

Query: 81  SKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHT 140
           S    F+    +  I+  S +V+F KS    S+ +++LL + Y+ SP   VV+LD+H H 
Sbjct: 110 SHAAAFNVQQHFTQIIHTSPVVLFMKSSQDDSRLMRDLLQKEYEISPEIAVVDLDKHTHG 169

Query: 141 DELQDYIE--KVTGRRT----VPNVIIN-GVSKGGCDDMVTLHKEDKLLESLKE 187
             LQDYI   K+  R T    +P + IN         ++ +LHK+  LL++ K+
Sbjct: 170 AALQDYIRLNKLDNRGTAYVKLPYLFINEQFVHVDVKNVKSLHKDGALLKTFKD 223

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPS-YHVVELDQHGHTDELQDYIEKVTGR 153
           ++  + + V SK+YCP+     N L E  K   S   V++L++     E+Q  + ++ G+
Sbjct: 13  LIADNEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEINGQ 72

Query: 154 RTVPNVIINGVSKGGCDDM 172
           RTVPN+ ING   GG DD+
Sbjct: 73  RTVPNIYINGKHIGGNDDL 91

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 64/135 (47%), Gaps = 16/135 (11%)

Query: 85  KFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQ 144
           +F  A  ++ IL  S +VVF+K     S+ LKNLL   Y+ +P   +V+L +H   DELQ
Sbjct: 147 EFMPAIAFQEILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEIAIVDLMKHDQGDELQ 206

Query: 145 DYI--EKVTGRRT----------VPNVIINGVSKGGCD---DMVTLHKEDKLLESLKEWS 189
            YI   K+    T          VP + INGVS        D+   H    L+E L+ ++
Sbjct: 207 KYIMLNKLNTYNTHYDASDDIPDVPYLFINGVSVINVSLEKDIKLQHTSGLLIEKLRSFA 266

Query: 190 NGAFTVEAV-PPSES 203
                 + + PPS S
Sbjct: 267 GEKVKFKRLSPPSNS 281

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 1/94 (1%)

Query: 93  ETILKQSHMVVFSKSYCPFSKKLKNLLAESYKF-SPSYHVVELDQHGHTDELQDYIEKVT 151
           +T++ +  + V +KSYCP  +  +  L E Y        V+ELD      E+Q+ + ++T
Sbjct: 11  KTMIGEKPVFVAAKSYCPHCRATRETLFEEYNLPREKALVLELDLMTDGAEIQEALAEIT 70

Query: 152 GRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESL 185
            + TVPN+ I G   GG  D+  L K+ +L E L
Sbjct: 71  HQDTVPNIFIYGQHVGGNSDLQALKKDGQLKEML 104

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 82  KEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVV-ELDQHGHT 140
           + V  D     + ++ Q  + V SK+YCP+ +     L    +F  +  +V +L+     
Sbjct: 34  RMVSQDTIQRVKGLIGQKKLFVASKTYCPYCQATLKTLFTDLQFPEAQAIVLQLNTIDDG 93

Query: 141 DELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLK 186
            ++QD + ++ G+RTVPN+ I+G   GG  D+  L+   KL   LK
Sbjct: 94  QDIQDALYEINGQRTVPNIYIDGKHIGGNSDLQELNASGKLQALLK 139

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPS-YHVVELDQHGHTDELQDYIEKVTGR 153
           ++ ++ + V SK+YCP+     N L E  K   S   V++L+      ++Q  + ++ G+
Sbjct: 13  LIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQ 72

Query: 154 RTVPNVIINGVSKGGCDDM 172
           RTVPN+ ING   GG DD+
Sbjct: 73  RTVPNIYINGKHIGGNDDL 91

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%), Gaps = 4/95 (4%)

Query: 93  ETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSP-SYHVVELDQHGHTDELQDYIEKVT 151
            +++K + + V +K+YCP+      LL +  K       +++LD      E+Q+ + +++
Sbjct: 40  RSLIKDNKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMKEGSEIQEALTEIS 99

Query: 152 GRRTVPNVIINGVSKGGCDDMVTLH---KEDKLLE 183
           G+RTVPN+ I G   GG  D+  L    K D+LLE
Sbjct: 100 GQRTVPNIYILGEHIGGNSDLQALEASGKLDELLE 134

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 50.8 bits (120), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPS-YHVVELDQHGHTDELQDYIEKVTGR 153
           ++ +  + V SK+YCP+     N L +  K   S   V++L++     ++Q  + ++ G+
Sbjct: 13  LIAEKEIFVASKTYCPYCHAALNTLFQQLKVPKSKVLVLQLNEMEDGADIQAALYEINGQ 72

Query: 154 RTVPNVIINGVSKGGCDDM 172
           RTVPNV ING   GG DD+
Sbjct: 73  RTVPNVYINGKHIGGNDDL 91

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (55%), Gaps = 8/99 (8%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           ++    ++ IL  S MV+F +S    SK +K L    Y+ SP + +V+LD H + + LQ+
Sbjct: 125 YNPELNFKQILNTSPMVLFIRSSQKSSKFIKKLFLNEYEISPEFAIVDLDLHKNGNILQN 184

Query: 146 YIE--KVTGR---RTVPNVIINGVSKGGCD---DMVTLH 176
           YI+  K+  +     VP + INGVS    +   D+++LH
Sbjct: 185 YIQTKKIINKDDTLDVPYLFINGVSVINSNLNKDIISLH 223

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 63/130 (48%), Gaps = 12/130 (9%)

Query: 79  ENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHG 138
           +N+ E KFD    +  I+  S  V+F KS    S  LK LL   ++ SP   +V+L++H 
Sbjct: 146 KNNNEKKFDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKHS 205

Query: 139 HTDELQDYIEK-------VTGRRTV--PNVIINGVS---KGGCDDMVTLHKEDKLLESLK 186
           +  EL+ YI++        T    +  P + +NGVS    G   D++  H +  LL  LK
Sbjct: 206 YGYELEKYIKENKLDVDPSTALEAIHSPYLFLNGVSVINNGIARDIIEPHSKGLLLPVLK 265

Query: 187 EWSNGAFTVE 196
             + G   VE
Sbjct: 266 SKAGGNLLVE 275

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 90  TEYETILKQSHMVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYIE 148
           T  + ++ ++ + V SK+YCP+ +  LK L  +         V++L+      E+Q+ + 
Sbjct: 42  TRVKDLIAKNKIFVASKTYCPYCQATLKTLFDDLNVPKSKSLVLQLNTMDDGAEIQEALF 101

Query: 149 KVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           ++ G+++VPN+ I+G   GG  D+  L    KL E LKE
Sbjct: 102 EINGQKSVPNIYIDGKHIGGNSDLQELKNAGKLDEVLKE 140

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 93  ETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPS-YHVVELDQHGHTDELQDYIEKVT 151
           + ++K++ ++VF+KSYCP+S   +  L    K   S   V+ELD      E+Q  +  + 
Sbjct: 40  QKLIKENKIIVFAKSYCPYSIATRRTLFNDCKVPQSKALVLELDLMQDGQEIQQALLAIN 99

Query: 152 GRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESL 185
           G++TVP+V I G   GG  ++  + +  +L + L
Sbjct: 100 GQKTVPHVYIAGEFIGGNHELQQIFQSGELQKKL 133

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query: 84  VKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDEL 143
           +++D    ++ I+  S  V+F +S    S  L+ LL   Y+ +P   +V+LD+H H   L
Sbjct: 96  IEYDPEKNFKQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLL 155

Query: 144 QDYI--EKVTGRRT------------VPNVIING---VSKGGCDDMVTLHKEDKLLESLK 186
           + +I   K+   +              P + ING   ++ G  DD++  H++ +LL  LK
Sbjct: 156 ERHILSHKIKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLK 215

Query: 187 EWS--NGAFTVEAVP 199
            ++  N  F    +P
Sbjct: 216 AFAGENIVFNKRDLP 230

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 95  ILKQSHMVVFSKSYCPFS-KKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGR 153
           ++ +  + V SK+YCP+    +K L  E         V++L++     E+Q  + ++ G+
Sbjct: 13  LINEKEIFVASKTYCPYCHATIKTLFKELNVPKSKALVLQLNEMDDGAEIQQALFEINGQ 72

Query: 154 RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           +TVPN+ ING   GG D +  L KE   LE L E
Sbjct: 73  KTVPNIYINGKHVGGNDKLQDL-KESGELEDLLE 105

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 101 MVVFSKSYCPFSKKLKNLLAESYKF-SPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNV 159
           + V +KSYCP+ +  K+ L +     +    V++LDQ      +Q  + ++T + TVPN+
Sbjct: 18  IFVAAKSYCPYCQASKSTLFKELNVPADKATVLDLDQMQDGQAIQAILAELTQQNTVPNI 77

Query: 160 IINGVSKGGCDDMVTLHKEDKL 181
            ING   GG  D+  L    +L
Sbjct: 78  FINGKHIGGNSDLQALKNNGEL 99

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPS-YHVVELDQHGHTDELQDYIEKVTGR 153
           ++ +  + V SK+YCP+     N L +      S   V++L++     ++Q  + ++ G+
Sbjct: 219 LIAEKEIFVASKTYCPYCHAALNTLFQKMNVPKSKVLVLQLNEMKDGVDIQAALYQLNGQ 278

Query: 154 RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           RTVPN+ ING   GG DD+  L +E   LE L E
Sbjct: 279 RTVPNIYINGKHIGGNDDLQEL-RETGELEDLLE 311

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 16/125 (12%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           FD    +  I+K S  V+F KS    S  L+NLL + ++ SP    V+L++H    EL+ 
Sbjct: 156 FDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYELEK 215

Query: 146 YIEKVTGRRTV-----------PNVIINGVS---KGGCDDMVTLHKEDKLLESLKEWSNG 191
           YI++   +  +           P + +NGVS    G   D++  H +  LL  LK  + G
Sbjct: 216 YIKQ--NKLNIDPDIALESIHPPYLFLNGVSLINNGIEKDIIEPHSKGSLLSVLKSEARG 273

Query: 192 AFTVE 196
              VE
Sbjct: 274 NLLVE 278

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 101 MVVFSKSYCPFSKK-LKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNV 159
           + V  KS CP+SKK L+ L  + +       ++ +D+  +  E++  I   TG++TVPN 
Sbjct: 29  IFVARKSDCPYSKKTLETLFDDLHVPKDKVLLITVDEIENGAEVKQAIIDYTGQKTVPNT 88

Query: 160 IINGVSKGGCDDMVTLHKEDKLLESLK 186
            ING   GG DD+  L +  +L E L+
Sbjct: 89  YINGRHIGGNDDLQKLKQTGELQELLR 115

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 4/97 (4%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVV-ELDQHGHTDELQDYIEKVTGR 153
           ++ +  + + SK+YCP+       L E  K   S  +V +L++     ++Q+ + ++ G+
Sbjct: 13  MINEKEIFIASKTYCPYCFSTIKTLFEELKVPKSKALVLQLNEMDDGADIQEALFEINGQ 72

Query: 154 RTVPNVIINGVSKGGCDDMVTLHKE---DKLLESLKE 187
           +TVPN+ ING   GG   +  L +    D LLE + E
Sbjct: 73  KTVPNIYINGKHIGGNSQLQDLKESGELDDLLEPIME 109

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 12/125 (9%)

Query: 86  FDAATEYETILKQSHMVVFSKS--YCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDEL 143
           +D  + +  ++  S +V+F KS      +  ++ +L+  Y+ SP   VV+LD+H + +EL
Sbjct: 148 WDPLSTFTEVMNMSPVVLFIKSSERNSLADHVRKVLSTEYEISPGAAVVDLDKHRYGEEL 207

Query: 144 QDYIE--KVTG--RRTVPNVIINGVSKGGCDDMVT------LHKEDKLLESLKEWSNGAF 193
           Q+YIE  K+ G   + +P + +N V   G  ++ +      LH    LL+  K+ +    
Sbjct: 208 QNYIETQKLPGGSSQQLPYLFVNRVPVIGAGEIDSVAEFKRLHSTGALLDRFKQLAERKV 267

Query: 194 TVEAV 198
             E +
Sbjct: 268 LFEKI 272

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRR 154
           +++ + +V+FSK++CP+ K       E+        V++LD+     E+QD + ++ G++
Sbjct: 13  LVEDNKVVIFSKTFCPYCKATLKTFDEARLPVGLVRVLQLDKLDDGSEIQDALYELNGQK 72

Query: 155 TVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           TVP++ I     GG  ++  L K + +LE + E
Sbjct: 73  TVPSIYILKRHIGGNSELQKL-KHEGVLEFIME 104

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 106 KSYCPFSKKLKNLLAESYKFSPS-YHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           K++CP+ K     L +  K   S   V++L++  H  E+Q+ + ++ G++TVP++ IN +
Sbjct: 53  KTWCPYCKATIVTLLDQMKVPASKIKVLKLNELKHGREIQEALFQMNGQKTVPHIYINQI 112

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GG  D+  L    KL   L E
Sbjct: 113 FIGGNSDLEELRVSGKLRNLLGE 135

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145
           F  A  ++ I+  S  V+F K     S+ L++LL   Y+ +P   VV+L +H ++ +LQ 
Sbjct: 82  FRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEVTPEIAVVDLSKHRYSGDLQR 141

Query: 146 YIEK 149
           YI +
Sbjct: 142 YIRE 145

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FSK    LL +      KF+ +Y+V+E        EL+D I++ T   T+P + +N  
Sbjct: 58  CGFSKATIQLLGQQGVDPAKFA-AYNVLE------DPELRDAIKEFTEWPTIPQLFVNKE 110

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD + ++ +  +L E L+E
Sbjct: 111 FVGGCDVITSMSRSGELAEVLEE 133

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 91  EYETILKQSHMVVFSKSYCPFSKKLKNLLAESYK-FSPSYHVVELDQHGHTDELQDYIEK 149
           E + ++ +  + + +KSYC  S   K  L + Y        V+ELD+    + +   + K
Sbjct: 8   EVQKMIDEKPVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALSK 67

Query: 150 VTGRRTVPNVIINGVSKGGCDDMVTLHKE---DKLLESL 185
           ++ + T+PN+ I G   GG  D+  +++    +KLL+S+
Sbjct: 68  ISQQSTLPNIFIKGKHIGGYQDLKEMNESGELEKLLDSI 106

>KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.519
           YPL059W
          Length = 149

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLA----ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FSK   NLL     +  KF+ +Y+V+E        EL+  I++ +   T+P + +N  
Sbjct: 57  CGFSKATINLLGKQGVDPAKFA-AYNVLE------DPELRTAIKEFSDWPTIPQLYVNNE 109

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD + ++ K  +L + L+E
Sbjct: 110 FVGGCDVITSMAKSGELADVLEE 132

>KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa]
           {ON} similar to uniprot|Q02784 Saccharomyces cerevisiae
           YPL059W GRX5 Hydroperoxide and superoxide- radical
           responsive glutathione-dependent oxidoreductase
           mitochondrial matrix protein involved in the
           synthesis/assembly of iron-sulfur centers monothiol
           glutaredoxin subfamily member along with Grx3p and Grx4p
          Length = 136

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 55/101 (54%), Gaps = 16/101 (15%)

Query: 96  LKQSHMVVFSKS-----YCPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDY 146
           +K + +V+F K       C FS+   +LL +      KF+ +Y+V+E        EL++ 
Sbjct: 33  IKSAPVVLFMKGTPEFPQCGFSRATVSLLGQQGVDPLKFA-AYNVLE------DPELREG 85

Query: 147 IEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           I++++   T+P + +N    GGCD +V++ +  +L + L++
Sbjct: 86  IKELSEWPTIPQLYVNEEFIGGCDILVSMAQSGELTKLLED 126

>KAFR0A01190 Chr1 complement(230841..231314) [474 bp, 157 aa] {ON}
           Anc_8.519 YPL059W
          Length = 157

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FS+    +L +      KF+ +Y+V+E        EL+D I++ +   T+P + +N  
Sbjct: 61  CGFSRATIAMLGQQGVNPAKFA-AYNVLE------DPELRDAIKEFSNWPTIPQLYVNKE 113

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD + T+    +L + L+E
Sbjct: 114 FVGGCDVITTMATSGELADVLEE 136

>Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON}
           complement(30908..31351) [444 nt, 148 aa]
          Length = 147

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FS+   N+L +      KF+ +Y+V+E        EL+  I++ +   T+P + +N  
Sbjct: 62  CGFSRATINILGQQGVDPQKFA-AYNVLE------DPELRQGIKEYSEWPTIPQLYVNKE 114

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD + T+ ++ +L + L+E
Sbjct: 115 FVGGCDIITTMAQDGQLADLLEE 137

>NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519
          Length = 139

 Score = 35.4 bits (80), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 142 ELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKL 181
           EL+D I++ T   T+P + +NG   GGCD +V++ K   L
Sbjct: 83  ELRDGIKEYTDWPTIPQLFVNGEFIGGCDVIVSMSKNGDL 122

>KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar to
           uniprot|Q02784 Saccharomyces cerevisiae YPL059W GRX5
           Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 142

 Score = 35.4 bits (80), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 55/104 (52%), Gaps = 16/104 (15%)

Query: 93  ETILKQSHMVVFSKS-----YCPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDEL 143
           E  ++ + +V+F K       C FS+   N+L +      KF+ +Y+V+E        EL
Sbjct: 36  EDAIESAPVVLFMKGTPEFPQCGFSRATINMLGQQGVDPVKFA-AYNVLE------DPEL 88

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           ++ I++++   T+P + +N    GGCD ++ + +  +L + L+E
Sbjct: 89  REGIKEISEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLEE 132

>NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519
          Length = 161

 Score = 35.0 bits (79), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FSK    LL +      KF+ +Y+V+E        EL++ I++ T   T+P + +   
Sbjct: 61  CGFSKATIQLLGQQGVDPAKFA-AYNVLE------DPELREAIKEFTEWPTIPQLFVENE 113

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD + ++ +  +L E L E
Sbjct: 114 FVGGCDVITSMARSGELAELLDE 136

>ZYRO0F08932g Chr6 complement(723285..723728) [444 bp, 147 aa] {ON}
           similar to uniprot|Q02784 Saccharomyces cerevisiae
           YPL059W GRX5 Hydroperoxide and superoxide-radical
           responsive glutathione-dependent oxidoreductase
           mitochondrial matrix protein involved in the
           synthesis/assembly of iron-sulfur centers monothiol
           glutaredoxin subfamily member along with Grx3p and Grx4p
          Length = 147

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 20/119 (16%)

Query: 82  KEVKFDAATEYETILKQS----HMVVFSKS-----YCPFSKKLKNLLAES----YKFSPS 128
           ++ +   +TE    +K++     +V+F K       C FSK   +LL +      KF+ +
Sbjct: 27  RQTQLFMSTETRAAIKEAIGSAPVVLFMKGTPEFPQCGFSKATISLLGQQGVDPMKFA-A 85

Query: 129 YHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           Y+V+E        EL++ I++ +   T+P + +N    GGCD + T+ +   L   L++
Sbjct: 86  YNVLE------DPELREGIKEYSEWPTIPQLYVNKEFVGGCDILTTMAQSGDLCNLLEQ 138

>SAKL0H10626g Chr8 (914158..914589) [432 bp, 143 aa] {ON}
           uniprot|Q6YFE4 Saccharomyces kluyveri Glutaredoxin
          Length = 143

 Score = 34.3 bits (77), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 55/104 (52%), Gaps = 16/104 (15%)

Query: 93  ETILKQSHMVVFSKS-----YCPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDEL 143
           E+ ++ + +V+F K       C FSK   N+L +      KF+ +Y+V+E        EL
Sbjct: 37  ESAIESAPVVLFMKGTPEFPQCGFSKATINMLGQQGVDPMKFA-AYNVLE------DAEL 89

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           ++ +++ +   T+P + +N    GGCD ++ + +  +L + L++
Sbjct: 90  REGVKEFSEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLED 133

>CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} similar
           to uniprot|Q02784 Saccharomyces cerevisiae YPL059w GRX5
          Length = 149

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 16/104 (15%)

Query: 93  ETILKQSHMVVFSKS-----YCPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDEL 143
           E  +  + +V+F K       C FS+   ++L +      KF+ +Y+V+E        EL
Sbjct: 39  EGAIASAPVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFA-AYNVLE------DPEL 91

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           ++ I++ +   T+P + +N    GGCD + ++ +  +L + L+E
Sbjct: 92  REGIKEFSNWPTIPQLYVNKEFIGGCDVITSMARSGELADVLEE 135

>TPHA0L01520 Chr12 complement(319260..319712) [453 bp, 150 aa] {ON}
           Anc_8.519 YPL059W
          Length = 150

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 16/104 (15%)

Query: 93  ETILKQSHMVVFSKS-----YCPFSKKLKNLL----AESYKFSPSYHVVELDQHGHTDEL 143
           E  +  + +V+F K       C FS+    +L     +  KF+ +Y+V+E        EL
Sbjct: 39  EGCVSSAPVVLFMKGTPEFPQCGFSRATIEILDHQGIDPNKFA-AYNVLE------DPEL 91

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           +D I++ +   T+P + +N    GGCD + T+ +   L E L E
Sbjct: 92  RDGIKEFSEWPTIPQLYLNKEFVGGCDILTTMAQNGDLAELLDE 135

>Kwal_27.11948 s27 complement(1014824..1015234) [411 bp, 136 aa]
           {ON} YPL059W (GRX5) - Protein with glutaredoxin activity
           [contig 26] FULL
          Length = 136

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 53/101 (52%), Gaps = 16/101 (15%)

Query: 96  LKQSHMVVFSKS-----YCPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDY 146
           +K + +V+F K       C FS+    +L +      KF+ +Y+V+E        EL++ 
Sbjct: 33  IKSAPVVLFMKGTPEFPQCGFSRATVGMLGQQGVDPLKFA-AYNVLE------DPELREG 85

Query: 147 IEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           I++++   T+P + +N    GGCD + ++ +  +L + L++
Sbjct: 86  IKELSDWPTIPQLYVNEEFVGGCDIITSMAQTGELTKLLED 126

>Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLA----ESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FS+    LL     +  KF+ +Y+V+E        EL++ I++ +   T+P + +N  
Sbjct: 60  CGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPELREGIKEFSEWPTIPQLYVNKE 112

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD + ++ +  +L E L E
Sbjct: 113 FVGGCDVITSMARSGELAELLDE 135

>SAKL0B00792g Chr2 (70679..73624) [2946 bp, 981 aa] {ON} similar to
           uniprot|P19263 Saccharomyces cerevisiae YLR071C RGR1
           Component of RNA polymerase II holoenzyme/mediator
           complex affects chromatin structure and transcriptional
           regulation of diverse genes required for glucose
           repression HO repression RME1 repression and sporulation
          Length = 981

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 87/196 (44%), Gaps = 31/196 (15%)

Query: 38  GVNYHPGSLVTFDESGNAPGTPESIHGSVANKQDKEVDEVNEN-SKEVKFDAATE--YET 94
           GV+ +   LV    +GN    P + + ++ N  +  +DE+  N S+ +K D  +   ++ 
Sbjct: 353 GVDKNTQCLVLRWNNGNDQNNPLNQYHNILNNLESVLDEITFNHSQMIKSDLLSTGVFQV 412

Query: 95  ILKQSHMVVFS-----KSYCPFSKKLKNLLAESYKF-SPSY----HVVELDQHGHTDELQ 144
             + S +++F       S  P   K+ NL++  + F +PS     +V  ++     +EL 
Sbjct: 413 DDENSDILLFQVPTTCVSTAPIQMKI-NLISGVFYFKNPSTLLLSYVRRINSSSTVEELT 471

Query: 145 DYIEKVTGRRTVPNVIINGVSKGG--CDDMVTL--------HKEDK------LLESLKEW 188
             +EK+   + V +V+ N   K G  C D+V L        HK  K      L   LK W
Sbjct: 472 RILEKLKLDKIV-HVLRNMFEKTGWICSDIVKLTYPILHESHKNQKKILTRDLFIRLKHW 530

Query: 189 SNGAFTVEAVPPSEST 204
               + + ++  S+ST
Sbjct: 531 PANWYLIMSIVSSDST 546

>Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 16/104 (15%)

Query: 93  ETILKQSHMVVFSKSY-----CPFSKKLKNLLA----ESYKFSPSYHVVELDQHGHTDEL 143
           E  ++ + +V+F K       C FS+    LL     +  KF+ +Y+V+E        EL
Sbjct: 39  EDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPEL 91

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           ++ I++ +   T+P + +N    GGCD + ++ +  +L + L+E
Sbjct: 92  REGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 16/104 (15%)

Query: 93  ETILKQSHMVVFSKSY-----CPFSKKLKNLLA----ESYKFSPSYHVVELDQHGHTDEL 143
           E  ++ + +V+F K       C FS+    LL     +  KF+ +Y+V+E        EL
Sbjct: 39  EDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPEL 91

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           ++ I++ +   T+P + +N    GGCD + ++ +  +L + L+E
Sbjct: 92  REGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}
           GRX5Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers; monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 150

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 16/104 (15%)

Query: 93  ETILKQSHMVVFSKSY-----CPFSKKLKNLLA----ESYKFSPSYHVVELDQHGHTDEL 143
           E  ++ + +V+F K       C FS+    LL     +  KF+ +Y+V+E        EL
Sbjct: 39  EDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPEL 91

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           ++ I++ +   T+P + +N    GGCD + ++ +  +L + L+E
Sbjct: 92  REGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>TPHA0B00950 Chr2 complement(217773..218099) [327 bp, 108 aa] {ON}
           Anc_4.211 YLR364W
          Length = 108

 Score = 31.6 bits (70), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDY----IEKV 150
           ++  S    FS S+CP      ++     KF  S  V   D      E Q+      ++V
Sbjct: 11  LITSSEFFQFSASWCPDCVYANSIWT---KFHVSDKVTIFDIGSLPKEEQEQWRQAFQRV 67

Query: 151 TGRRTVPNVIINGVSKG 167
           TG R +P + +NGV  G
Sbjct: 68  TGSRNLPTIFVNGVIWG 84

>NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {ON}
           Anc_8.519
          Length = 144

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 142 ELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           EL++ I++ T   T+P + +N    GGCD +V++ K  +L    +E
Sbjct: 88  ELREGIKEFTQWPTIPQLFVNKEFIGGCDVIVSMSKSGELTSVFEE 133

>TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON}
           Anc_8.519 YPL059W
          Length = 149

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FS+   +LL +      KF+ +++V+E        EL++ I++ T   T+P + +N  
Sbjct: 61  CGFSRATISLLGQQGVDPAKFA-AFNVLE------DPELRNGIKEYTEWPTIPQLFVNKE 113

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD +  + +  +L + L++
Sbjct: 114 FVGGCDIITNMSQSGELAKLLED 136

>KAFR0F01680 Chr6 complement(332789..333748) [960 bp, 319 aa] {ON}
           Anc_1.158 YJL180C
          Length = 319

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSP-SYHVVELDQHGHTDELQ 144
           F   +EYE  L++         Y P  KK+++ L+E++  SP +  +++ D+HG    +Q
Sbjct: 162 FSPRSEYEGALREEQ----DSLYLPIIKKIESFLSENFGSSPITLQILDADRHGLRGNVQ 217

Query: 145 D 145
           +
Sbjct: 218 N 218

>ZYRO0B07634g Chr2 complement(600410..600739) [330 bp, 109 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W Hypothetical ORF
          Length = 109

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 95  ILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQ--DYIEKVTG 152
           +LK   ++ FS S+CP   +  N + +        +V ++      D+ Q     ++VTG
Sbjct: 12  LLKSHKVLQFSASWCP-DCRYANSVWKKLGIENKIYVFDIASFPRPDQEQWRSAFQQVTG 70

Query: 153 RRTVPNVIINGVSKG 167
            R +P++  NG   G
Sbjct: 71  SRNLPSIYYNGTLWG 85

>Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to
           Ashbya gossypii ADR053W
          Length = 139

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 11/83 (13%)

Query: 109 CPFSKKLKNLLAES----YKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGV 164
           C FS+    +L +      KF+ +Y+V+E     H  EL++ I++ +   T+P + IN  
Sbjct: 55  CGFSRASIQILGQQGVDPSKFA-AYNVLE-----H-PELREGIKEYSEWPTIPQLYINKE 107

Query: 165 SKGGCDDMVTLHKEDKLLESLKE 187
             GGCD +  + +  +L E L++
Sbjct: 108 FIGGCDILTNMAQSGELAELLEK 130

>CAGL0J04686g Chr10 complement(446347..447576) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q06410 Saccharomyces cerevisiae
           YLR423c
          Length = 409

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 147 IEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVEAVPPSE 202
           +++V  RR +   ++ G+ K   +++ TLH ED+ L +     NGAF  E + P E
Sbjct: 338 LQEVQRRRALSQKML-GIIKNCENELKTLHDEDQKLRTHFLSENGAFLPETIWPGE 392

>TPHA0K00960 Chr11 complement(197803..200355) [2553 bp, 850 aa] {ON}
           Anc_7.233 YIL047C
          Length = 850

 Score = 30.4 bits (67), Expect = 3.5,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 65  SVANKQDKEVDEVNENSKEVK--------FDAATEYETILKQSHMVVFSKSYCPFSKKLK 116
           S  N  D+ V    EN    K        FD  T YE I+   +MV  +K +   SKK+ 
Sbjct: 229 SNENNYDRFVQYAEENYSIFKNSLEPNKEFDPLTSYENIITNWYMVDLTKDHSTMSKKIH 288

Query: 117 N 117
           N
Sbjct: 289 N 289

>ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL059W (GRX5)
          Length = 138

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 16/106 (15%)

Query: 93  ETILKQSHMVVFSKS-----YCPFSKKLKNLLA----ESYKFSPSYHVVELDQHGHTDEL 143
           E  +  + +V+F K       C FSK    +L     +  KF+ +++V+E        EL
Sbjct: 33  EGAISSAPVVLFMKGTPEFPQCGFSKAAIEILGRQGVDPAKFA-AFNVLE------DSEL 85

Query: 144 QDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWS 189
           +  I++ +   T+P + +N    GGCD +  + +  +L   L+E S
Sbjct: 86  RSGIKEYSEWPTIPQLYVNKEFVGGCDILTNMAQSGELTTMLEEAS 131

>TBLA0F01920 Chr6 complement(479280..480635) [1356 bp, 451 aa] {ON}
           Anc_7.276
          Length = 451

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 32/56 (57%)

Query: 132 VELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           + L ++ + DE+QDY++ +   +++ +V++  VS      +  L +E+KL   L +
Sbjct: 226 INLGKNKNGDEVQDYLKGIEKFQSLADVLVINVSSPNTPGLRDLQQEEKLTNLLSQ 281

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 64  GSVANKQDKEVDEVNENSKEVKFDAATE-YETILKQSHM 101
           G+V    D E DE+ E  K V++D AT+ Y+ +L Q H+
Sbjct: 45  GAVTVPSDLEYDELTEEEK-VQWDLATQPYKKVLDQRHL 82

>Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 bp,
           262 aa] {ON} YDR098C (REAL)
          Length = 262

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 105 SKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD-----YIEKVTGRRTVPNV 159
           S+  C FS++L  +L E        H V     G  D L+D     +++K +   T P +
Sbjct: 184 SEPKCGFSRQLVGILRE--------HQVRF---GFFDILRDDSVRQHLKKFSEWPTFPQL 232

Query: 160 IINGVSKGGCD 170
            ING  +GG D
Sbjct: 233 YINGEFQGGLD 243

>Smik_4.400 Chr4 (727540..727953) [414 bp, 137 aa] {ON} YDR156W
           (REAL)
          Length = 137

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 8/81 (9%)

Query: 130 HVVELDQHGHTDELQDYIEKVTGRR--TVPNVIINGVSKGGCDDMVT------LHKEDKL 181
           H  +L QH  TDE+  ++E     +   + +  +N +S    D  VT      L+ +  L
Sbjct: 23  HATQLPQHVSTDEVLQFLEGFINEKENVIDSTTVNTISGSAADGDVTAVVNPSLNMDTNL 82

Query: 182 LESLKEWSNGAFTVEAVPPSE 202
             S+ +        + +PP++
Sbjct: 83  FSSISQLKRIQRDFKGLPPAQ 103

>Kwal_55.20054 s55 (232759..233991) [1233 bp, 410 aa] {ON} YDR346C
           (SGI1) -  [contig 156] FULL
          Length = 410

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 7/64 (10%)

Query: 112 SKKLKNLLAESYKFSPSYHVVELDQHGHTDELQ-----DYIEKVTGRRTVPNVII--NGV 164
           S KL+N   E + F      +E+D+ G T  ++     D I  +T  R VP V +  NG 
Sbjct: 107 STKLENFRIEGFNFYADELAIEMDESGSTISIKSSVSPDSIVDLTLERCVPGVKVGENGT 166

Query: 165 SKGG 168
           S  G
Sbjct: 167 SYYG 170

>TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.240
           YDR098C
          Length = 249

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 109 CPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGG 168
           C FS++L  +L E Y+    +  +  D     D ++  ++K +   T P + ING  +GG
Sbjct: 175 CGFSRQLVGILRE-YQLRFGFFDILKD-----DSVRQGLKKFSDWPTFPQLYINGEFQGG 228

Query: 169 CDDMVTLHKED 179
            D +    +ED
Sbjct: 229 LDIIKRSLEED 239

>KLTH0A05104g Chr1 (426808..428127) [1320 bp, 439 aa] {ON} weakly
           similar to uniprot|P28272 Saccharomyces cerevisiae
           YKL216W URA1 The enzyme catalyzes the conversion of
           dihydroorotic acid to orotic acid
          Length = 439

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 32/56 (57%)

Query: 132 VELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKE 187
           + L ++ + DE+QDY++ V   +++ +V++  VS      +  L  E KL + L++
Sbjct: 214 INLGKNKNGDEVQDYLKGVETFQSLADVLVINVSSPNTPGLRDLQNESKLADLLQK 269

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,971,625
Number of extensions: 915600
Number of successful extensions: 3258
Number of sequences better than 10.0: 155
Number of HSP's gapped: 3221
Number of HSP's successfully gapped: 155
Length of query: 204
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 100
Effective length of database: 41,556,135
Effective search space: 4155613500
Effective search space used: 4155613500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)