Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4813.500ON1391397143e-98
Skud_16.4473.500ON1401396762e-92
YPR153W3.500ON1401396753e-92
Smik_16.4053.500ON1391396683e-91
CAGL0L08382g3.500ON1401395601e-74
NCAS0F035903.500ON1401395541e-73
TDEL0D056803.500ON1401394802e-62
TBLA0C045203.500ON1401344792e-62
KNAG0A079803.500ON1471394691e-60
TPHA0A057103.500ON1411384672e-60
KAFR0G037303.500ON1441354653e-60
KLTH0G02354g3.500ON1401394453e-57
ZYRO0D09724g3.500ON1391274437e-57
SAKL0F02508g3.500ON1401394411e-56
Kpol_480.93.500ON1411384332e-55
KLLA0E03895g3.500ON1401393778e-47
AFR319W3.500ON1411172822e-32
Kwal_47.189033.500ON113441263e-09
TBLA0I015202.540ON750101750.12
Kpol_1016.15.443ON125145671.5
KNAG0E025602.473ON57891661.8
Smik_15.4528.718ON84061661.9
YOR270C (VPH1)8.718ON84061626.0
Ecym_43178.254ON60571626.1
Kpol_1023.455.318ON44131617.7
KNAG0G028008.718ON82961619.0
KLLA0C07491g8.718ON82961619.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.481
         (139 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   279   3e-98
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   265   2e-92
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   264   3e-92
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   261   3e-91
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   220   1e-74
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   218   1e-73
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   189   2e-62
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   189   2e-62
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   185   1e-60
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   184   2e-60
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   183   3e-60
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   176   3e-57
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   175   7e-57
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   174   1e-56
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   171   2e-55
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   149   8e-47
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   113   2e-32
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    53   3e-09
TBLA0I01520 Chr9 (331173..333425) [2253 bp, 750 aa] {ON} Anc_2.5...    33   0.12 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    30   1.5  
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    30   1.8  
Smik_15.452 Chr15 complement(777660..780182) [2523 bp, 840 aa] {...    30   1.9  
YOR270C Chr15 complement(828052..830574) [2523 bp, 840 aa] {ON} ...    28   6.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...    28   6.1  
Kpol_1023.45 s1023 (98232..99557) [1326 bp, 441 aa] {ON} (98232....    28   7.7  
KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {O...    28   9.0  
KLLA0C07491g Chr3 (653352..655841) [2490 bp, 829 aa] {ON} simila...    28   9.3  

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  279 bits (714), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 139/139 (100%), Positives = 139/139 (100%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 121 VVQILFDVVLGYSMIGSIM 139
           VVQILFDVVLGYSMIGSIM
Sbjct: 121 VVQILFDVVLGYSMIGSIM 139

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  265 bits (676), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (95%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           RSF+TNNDIPVGY+TPKFPSLYWPINSSRYN AFLYYISDIWKFSLYWTLIFNGAFYV  
Sbjct: 2   RSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVTT 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GLYASLTHRKK GSIWIFVMYV +GGVQGLT GT+MGFLIGAIYRSGLFSMSTWIPLCCA
Sbjct: 62  GLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           VVQILFDV+LGYSMIGS+M
Sbjct: 122 VVQILFDVILGYSMIGSVM 140

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  264 bits (675), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           RSF+TNNDIPVGY+TPKFPSLYWPIN+S+YNTAFLYYISDIWKFSLYWTLIFNGAFYV A
Sbjct: 2   RSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTA 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           G+YASLTHRKKAGS+WIFVMYV +GGVQGLT GT+MGFLIGAIYRSGLFSMSTW+PLCCA
Sbjct: 62  GVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCA 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           VVQILFDVVL YSM+GS+M
Sbjct: 122 VVQILFDVVLSYSMVGSVM 140

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  261 bits (668), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (95%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           RSF+TNNDIPVGY+TPKFPSLYWPIN+ RYNTAFLYYISDIWKFSLYWTLIFNGAFY+  
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GLYASLTHRKKAGS+WIF MYV +GGVQGLT GT+MGFLIGAIYRSGLFSMSTWIPLCCA
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 121 VVQILFDVVLGYSMIGSIM 139
           VVQILFDVVLGYSM+GS+M
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  220 bits (560), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 101/139 (72%), Positives = 119/139 (85%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           +SFIT+ D+P+GY TP FPSLYWPIN  RY+TAFLY+I DIWKF+LYWT IFNGAFY  A
Sbjct: 2   KSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGGA 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GLYASLTH K+ G +WIF +Y+ + GVQG+  GT+MGFLIGAIYRSGLFSMSTW+P+CCA
Sbjct: 62  GLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCCA 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           VVQIL DV + YSM+GSIM
Sbjct: 122 VVQILLDVTMSYSMVGSIM 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  218 bits (554), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           RSFITNNDIP+GYITPKFPSLYWPIN+ +Y+  FLY ISDIWKF+LYWTLIFN AFY AA
Sbjct: 2   RSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAA 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GL AS +HR+  G IWI V+Y+ F GVQGL  GTIMGFLIGAIY +GLF+MSTWIPLCCA
Sbjct: 62  GLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCA 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           V QILFDV++ YS +  I+
Sbjct: 122 VAQILFDVIMAYSSVSGIL 140

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  189 bits (480), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 114/139 (82%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           RSFITNND+P+GY+TP FPSL+WPI++ +++ A LY +  IWKF+LYW+LIFNGAFY  A
Sbjct: 2   RSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIA 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GL+AS +HR++AG +WI  +Y+ +GG+Q + AGT++GFLIG+IY +GLFSMSTWIP CC 
Sbjct: 62  GLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCV 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           +VQILFD  + Y   G+IM
Sbjct: 122 IVQILFDFSVSYLSSGTIM 140

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  189 bits (479), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 87/134 (64%), Positives = 104/134 (77%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           +SFITNNDIPVGY+TP FPSLYWPIN+ +YNT+FLY  +DIWKFS+YW +I N  FY   
Sbjct: 2   KSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVT 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           G  A ++HR K G IWI  +Y+  G VQG+ AGTIMG++I AIY SGLF MSTWIP CCA
Sbjct: 62  GTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCA 121

Query: 121 VVQILFDVVLGYSM 134
           VVQILFDVV  + +
Sbjct: 122 VVQILFDVVQSFPI 135

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  185 bits (469), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 109/139 (78%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           R+F+ NN+IPVGY TP FPSLYWPI++  Y+ AFLY I DIWKF++YW LI NGAFY  +
Sbjct: 9   RTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGTS 68

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GL A+++H K   +I I  +Y+ + G+QG+  G I G L+GAIYR+GLF+MSTWIPLCCA
Sbjct: 69  GLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCCA 128

Query: 121 VVQILFDVVLGYSMIGSIM 139
           V QILFDVV+ YS +GS++
Sbjct: 129 VAQILFDVVMSYSHVGSLL 147

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  184 bits (467), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 84/138 (60%), Positives = 107/138 (77%)

Query: 2   SFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAG 61
           +F+T+ND+PVGY+TP FPSLYWPIN+S+YNTA+LY    IW F++YW+LI NG FY  AG
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 62  LYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAV 121
             A  THRKK G  WI  +Y+  GGVQG+  GTI+G++I A Y S LFSMSTWIPLCCAV
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 122 VQILFDVVLGYSMIGSIM 139
            Q+LF+V   YS++G++M
Sbjct: 124 AQVLFEVTTSYSLVGNLM 141

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  183 bits (465), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (77%), Gaps = 1/135 (0%)

Query: 6   NNDIPVGYITPKFPSLYWPIN-SSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAGLYA 64
              +P+GYITPKFPSLYWPI     ++ AFLY + DIWKF+LYW+LIFNGAFYV+AG  A
Sbjct: 10  EQSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVA 69

Query: 65  SLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVVQI 124
            LT +KK+ S+ IF  Y  FGG+QG+  GT+MGFL+G IYR+GLF MS WIP+CCAV QI
Sbjct: 70  CLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQI 129

Query: 125 LFDVVLGYSMIGSIM 139
           L+DV++ YS +G IM
Sbjct: 130 LYDVLVSYSTVGRIM 144

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  176 bits (445), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 80/139 (57%), Positives = 103/139 (74%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           +SF+T  D+P+GY TPKFPSL+WPIN+ RY  ++LYY +DIWKF+++WTLI    FY AA
Sbjct: 2   KSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAA 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GL+AS++HRKKA  +WI   Y+  GG Q L AGT+ G ++   Y++GLF MSTWIPLC A
Sbjct: 62  GLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSA 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           VV ILF V   YSM G I+
Sbjct: 122 VVLILFHVSTTYSMAGIII 140

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  175 bits (443), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 82/127 (64%), Positives = 97/127 (76%), Gaps = 1/127 (0%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           RSFIT ND+PVGY TP FPSLYWP   SR +   +Y +S IWKF+LYW+LIFN  FY   
Sbjct: 2   RSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALT 60

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GL+AS +HRK+AG +WI  +Y  +GGVQG+  GTI GFLIG IY SGLFSMSTWIP CCA
Sbjct: 61  GLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCA 120

Query: 121 VVQILFD 127
           V Q+L+D
Sbjct: 121 VAQVLYD 127

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  174 bits (441), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 76/139 (54%), Positives = 107/139 (76%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           +SF+T  D+P+GY+TP FPSLYWP+N+ +++ ++LYY SDIW+F++YWTLI    FY +A
Sbjct: 2   KSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSA 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           GL AS +HRK AG IWI   Y+  GG+Q + +GT++G LI  IY++GLF+MSTW+PL CA
Sbjct: 62  GLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCA 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           ++QILF+V   Y M G I+
Sbjct: 122 LMQILFNVSTSYLMAGVII 140

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  171 bits (433), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 105/138 (76%)

Query: 2   SFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAG 61
           SF+T+ DIPVGY  P FPSLYWPI+S +Y+ ++LY    IW+F++YW++I NG FY+ +G
Sbjct: 4   SFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISG 63

Query: 62  LYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAV 121
           L AS THRK+AG +WI V+Y+  G  QG+  GT+ G+L+  IY SGLF+MSTWIPLCCA+
Sbjct: 64  LMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCAI 123

Query: 122 VQILFDVVLGYSMIGSIM 139
            Q+LFD+   +S+ G +M
Sbjct: 124 TQVLFDLCSSFSLGGMVM 141

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  149 bits (377), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 94/139 (67%)

Query: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60
           ++F    D+PVGY  P FPSLYWP+N+ +++ A+LYY+ DIW+F+++WT+I     Y   
Sbjct: 2   KTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGTT 61

Query: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120
           G  A  TH+K     W+  +Y+  G  Q   +GT++G LI  IY++GLF+MSTWIPLCCA
Sbjct: 62  GAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCCA 121

Query: 121 VVQILFDVVLGYSMIGSIM 139
           VVQILF+V   YSM   I+
Sbjct: 122 VVQILFNVSTSYSMTSPII 140

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  113 bits (282), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 72/117 (61%), Gaps = 1/117 (0%)

Query: 10  PVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAGLYASLTHR 69
           P GYI+P FPSL W  +  R N A LYY  DI +F+++WTLI  G  Y A GL A  +HR
Sbjct: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71

Query: 70  KKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVVQILF 126
           +  G + I  +Y+  G +  +  GT  G +  AIYR+ L +MSTWIPL  AVVQ L+
Sbjct: 72  RITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON}
          YPR153W - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 53.1 bits (126), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%)

Query: 56 FYVAAGLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFL 99
          FY AAGL+AS++HR+ AG +WI   YV  GG Q + AGT+ G +
Sbjct: 3  FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

>TBLA0I01520 Chr9 (331173..333425) [2253 bp, 750 aa] {ON} Anc_2.540
           YHL008C
          Length = 750

 Score = 33.5 bits (75), Expect = 0.12,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 48/101 (47%), Gaps = 8/101 (7%)

Query: 21  LYWPINSS-----RYNTAFLYYISDI-WKFSLYWTLIFNGAFYVAAGLYASLTHRKKAGS 74
           LY  INS+     + N   L +I  + + F+LY+ +I     + +  LY ++   ++A +
Sbjct: 49  LYMAINSTDPELYKTNPGILEFIGGVCYGFALYFVVITGADLFNSNVLYCTVGLLRRAIT 108

Query: 75  IWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWI 115
           I+  ++ V+   +  + A     +L G  Y SG+     W+
Sbjct: 109 IFDCIIIVSVSWISNIGASLFNAYLFG--YLSGIGRKENWV 147

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 2   SFITNNDIPVGYITPKF-PSLYWPI------NSSRYNTAFLYYIS 39
           S + NN I  G + PKF PS  WP+      N+   N+   YY +
Sbjct: 738 SLLLNNYIEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFA 782

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 18/91 (19%)

Query: 11  VGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAGLYASL---- 66
           + ++ P       P N   ++ A +Y++SD    S++W +++ GA  + +  YASL    
Sbjct: 391 LSHVNPALDLADLPAN--LFSAATIYFVSD----SIWWKIVYVGALVIGSSGYASLLVAT 444

Query: 67  -------THRKKAGSIW-IFVMYVAFGGVQG 89
                    R K G+I  IF ++ + G V G
Sbjct: 445 LVSIVFTVDRSKQGTITGIFYLWRSIGNVLG 475

>Smik_15.452 Chr15 complement(777660..780182) [2523 bp, 840 aa] {ON}
           YOR270C (REAL)
          Length = 840

 Score = 30.0 bits (66), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 12/61 (19%)

Query: 65  SLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVVQI 124
           SL H + +  +W   + +AFG           GFL G      LFSM  W  L CAV+ +
Sbjct: 740 SLAHAQLSSVLWTMTIQIAFG---------FRGFL-GVFMTVALFSM--WFALTCAVLVL 787

Query: 125 L 125
           +
Sbjct: 788 M 788

>YOR270C Chr15 complement(828052..830574) [2523 bp, 840 aa] {ON}
           VPH1Subunit a of vacuolar-ATPase V0 domain, one of two
           isoforms (Vph1p and Stv1p); Vph1p is located in V-ATPase
           complexes of the vacuole while Stv1p is located in
           V-ATPase complexes of the Golgi and endosomes
          Length = 840

 Score = 28.5 bits (62), Expect = 6.0,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 12/61 (19%)

Query: 65  SLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVVQI 124
           SL H + +  +W   + +AFG           GF +G      LF+M  W  L CAV+ +
Sbjct: 740 SLAHAQLSSVLWTMTIQIAFG---------FRGF-VGVFMTVALFAM--WFALTCAVLVL 787

Query: 125 L 125
           +
Sbjct: 788 M 788

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 63  YASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVV 122
           + S + R   G++ +FV+Y  FGGV   T+ +I  F  G  ++  L      IP+   V 
Sbjct: 332 FLSPSARGSLGTV-MFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFLFVT 390

Query: 123 QILFDVVLGYS 133
            +L +  L Y+
Sbjct: 391 TVLLNFFLIYA 401

>Kpol_1023.45 s1023 (98232..99557) [1326 bp, 441 aa] {ON}
           (98232..99557) [1326 nt, 442 aa]
          Length = 441

 Score = 28.1 bits (61), Expect = 7.7,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 43  KFSLYWTLIFNGAFYVAAGLYASLTHRKKAG 73
           +F +   L+ NGA  +  G Y +LT R KAG
Sbjct: 324 EFWILHGLVANGAVIIDEGAYKALTRRNKAG 354

>KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {ON}
           Anc_8.718 YOR270C
          Length = 829

 Score = 28.1 bits (61), Expect = 9.0,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 12/61 (19%)

Query: 65  SLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVVQI 124
           SL H + +  +W   + ++F GV G         L+G     GLF+M  W  L C ++ +
Sbjct: 736 SLAHNQLSSVLWTMTIQISF-GVPG---------LLGVCMTVGLFAM--WFVLTCCILVV 783

Query: 125 L 125
           +
Sbjct: 784 M 784

>KLLA0C07491g Chr3 (653352..655841) [2490 bp, 829 aa] {ON} similar
           to uniprot|P32563 Saccharomyces cerevisiae YOR270C VPH1
           Subunit of vacuolar-ATPase V0 domain one of two isoforms
           (Vph1p and Stv1p) Vph1p is located in V- ATPase
           complexes of the vacuole while Stv1p is located in
           V-ATPase complexes of the Golgi and endosomes
          Length = 829

 Score = 28.1 bits (61), Expect = 9.3,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 12/61 (19%)

Query: 65  SLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVVQI 124
           SL H + +  +W   + +AFG          M   +G +    LF+M  W  L C ++ +
Sbjct: 736 SLAHAQLSTVLWTMTIEIAFG----------MSGFVGVVMTVALFAM--WFVLTCVILVV 783

Query: 125 L 125
           +
Sbjct: 784 M 784

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.474 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,551,221
Number of extensions: 578744
Number of successful extensions: 1636
Number of sequences better than 10.0: 40
Number of HSP's gapped: 1633
Number of HSP's successfully gapped: 40
Length of query: 139
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 41
Effective length of database: 42,244,131
Effective search space: 1732009371
Effective search space used: 1732009371
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)