Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4803.498ON45245221570.0
Skud_16.4463.498ON45644214040.0
Smik_16.4043.498ON46045613680.0
YPR152C (URN1)3.498ON46545013660.0
Kpol_480.113.498ON4634665981e-71
KAFR0G037203.498ON4094395897e-71
TDEL0D056603.498ON4424495813e-69
TPHA0A056903.498ON4784895615e-66
KLTH0G02398g3.498ON4624625581e-65
Kwal_47.188953.498ON4434525509e-65
KNAG0A079703.498ON3884375067e-59
KLLA0E03939g3.498ON4354424661e-52
CAGL0L08404g3.498ON4104334092e-44
NCAS0F035803.498ON4133613978e-43
ZYRO0D09768g3.498ON4602293305e-33
SAKL0F02552g3.498ON4782783148e-31
Ecym_12313.498ON3292352813e-27
AFR317C3.498ON3282172602e-24
NDAI0B059003.498ON5221422541e-22
TBLA0D029303.498ON2762491415e-09
NCAS0C051102.649ON604861179e-06
TBLA0C009302.649ON658861091e-04
ZYRO0E00682g2.649ON570901036e-04
CAGL0L05368g2.649ON59052970.003
NDAI0G046002.649ON647117930.009
Kpol_1073.42.649ON53084910.014
TDEL0B074402.649ON57028900.018
TPHA0L020202.649ON58339870.041
KNAG0M024702.649ON60688860.058
KAFR0A002302.649ON556151860.059
Kwal_14.9392.649ON56252840.088
KLTH0C00924g2.649ON56481810.20
Suva_11.2162.649ON58533810.23
YKL012W (PRP40)2.649ON58382800.29
Ecym_33972.649ON57581800.30
KLLA0E18239g2.649ON57181800.31
ADR159C2.649ON56931790.36
Smik_11.2432.649ON57927770.75
SAKL0G19360g2.649ON56896751.2
Skud_11.2172.649ON58326732.0
CAGL0L12210g8.260ON298149732.2
SAKL0G14520g5.135ON16230675.3
Kwal_47.173028.134ON78781705.6
TDEL0F009908.134ON78981705.6
KLTH0E06908g8.134ON79181705.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.480
         (452 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   835   0.0  
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   545   0.0  
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   531   0.0  
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   530   0.0  
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   234   1e-71
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   231   7e-71
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   228   3e-69
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   220   5e-66
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   219   1e-65
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   216   9e-65
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   199   7e-59
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   184   1e-52
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   162   2e-44
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   157   8e-43
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   131   5e-33
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   125   8e-31
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   112   3e-27
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   104   2e-24
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   102   1e-22
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    59   5e-09
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    50   9e-06
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    47   1e-04
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    44   6e-04
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    42   0.003
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    40   0.009
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    40   0.014
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    39   0.018
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    38   0.041
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    38   0.058
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    38   0.059
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    37   0.088
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    36   0.20 
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    36   0.23 
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    35   0.29 
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    35   0.30 
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    35   0.31 
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    35   0.36 
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    34   0.75 
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    33   1.2  
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    33   2.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...    33   2.2  
SAKL0G14520g Chr7 complement(1253028..1253516) [489 bp, 162 aa] ...    30   5.3  
Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {...    32   5.6  
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    32   5.6  
KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {...    32   5.7  

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/452 (91%), Positives = 413/452 (91%)

Query: 1   MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELI 60
           MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELI
Sbjct: 1   MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELI 60

Query: 61  DDWHLIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVR 120
           DDWHLIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVR
Sbjct: 61  DDWHLIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVR 120

Query: 121 EEDVEKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGXXXX 180
           EEDVEKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYG    
Sbjct: 121 EEDVEKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGSSSE 180

Query: 181 XXXXXXXXXNDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPD 240
                    NDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPD
Sbjct: 181 EEEEEEEPENDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPD 240

Query: 241 FYKVGDAAVRESLFXXXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKAEIAPDC 300
           FYKVGDAAVRESLF                          PTKFHYLAQIVAKAEIAPDC
Sbjct: 241 FYKVGDAAVRESLFEEWCASASASASGNESEDEDDADLLEPTKFHYLAQIVAKAEIAPDC 300

Query: 301 IPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHER 360
           IPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHER
Sbjct: 301 IPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHER 360

Query: 361 DFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIALADPRYYVLG 420
           DFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIALADPRYYVLG
Sbjct: 361 DFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIALADPRYYVLG 420

Query: 421 ILDKTAGWVRWLAAEGVDPAAGWPRRARGHCR 452
           ILDKTAGWVRWLAAEGVDPAAGWPRRARGHCR
Sbjct: 421 ILDKTAGWVRWLAAEGVDPAAGWPRRARGHCR 452

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/442 (62%), Positives = 327/442 (73%), Gaps = 16/442 (3%)

Query: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
           +WQEFKTPAG RY+YNK TK+S+W+ PDFK  S  ++  K  ++ERKP F+LELID WHL
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125
           +ICNDGTKFYYN +S + K EI +E   QC+AL+ SLDKEKL+LLIGVARGY++R+EDV+
Sbjct: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120

Query: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGXXXXXXXXX 185
           KIFESLNEEI+LFKKNQ      + DE NEE GD   P + +  GL+SGYG         
Sbjct: 121 KIFESLNEEINLFKKNQNEA--GRVDEANEEPGDVNPPLKEHHTGLISGYGSSSEEEEEE 178

Query: 186 ---------XXXXNDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIE 236
                        N DA IIDDLNQID+GD +ERGLFF+L DRYELDKFSTWSLQ KKIE
Sbjct: 179 EEEEEEDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIE 238

Query: 237 NDPDFYKVGDAAVRESLFXX-XXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKA- 294
           NDPDFY +GD AVRE  F                           PTK+HYLAQI+AKA 
Sbjct: 239 NDPDFYTIGDDAVREGFFEEWCGHEHSDSAAAEASGSEDVGDVLEPTKYHYLAQILAKAG 298

Query: 295 EIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQEC 354
            I PD +PQDIRKQQK L+KAYRIKEYVPSKR+QD+FVSQLLFYYKTFSLEQRKEIFQ+C
Sbjct: 299 TIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDC 358

Query: 355 LRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIALADP 414
           LRDHERDFA AV+S+R++ GLIS+WQA+L    ADGASVE+ LL+IE+RC +  +  ADP
Sbjct: 359 LRDHERDFAGAVKSIRRESGLISQWQAVLE-APADGASVEEVLLNIEYRCNI--VVAADP 415

Query: 415 RYYVLGILDKTAGWVRWLAAEG 436
           RYYV+GILDKT  WVRWLAAEG
Sbjct: 416 RYYVVGILDKTMVWVRWLAAEG 437

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/456 (60%), Positives = 326/456 (71%), Gaps = 21/456 (4%)

Query: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
           VWQEFKTP G++Y+YNK TK+S+W+KP+ KK S  +D AKV+Q+ER P FALELID WHL
Sbjct: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63

Query: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125
           IICNDGTK Y+N +S I K +I +E  G+C AL+ SLDK+KL+LLIG+ARGY+V+EED++
Sbjct: 64  IICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDID 123

Query: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGXXXXXXX-- 183
           KIFESLNEEIDLFKKNQ     E+  E  EEAG  ++    +  GL+SGYG         
Sbjct: 124 KIFESLNEEIDLFKKNQDGF--EREIETREEAGVVKSLLSESHTGLISGYGSSSEEEEEE 181

Query: 184 --------XXXXXXNDDAGIIDDLNQIDSGDVN---ERGLFFQLCDRYELDKFSTWSLQC 232
                         N +  IIDDLN ID+ D++   ER LFFQLCDRY+LDKFSTWSLQ 
Sbjct: 182 EEEEEEEDHAEQGVNQNVSIIDDLNHIDADDIDEGRERSLFFQLCDRYKLDKFSTWSLQS 241

Query: 233 KKIENDPDFYKVGDAAVRESLFXXXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVA 292
           KKIENDP+FYK+ D  VRE LF                          PTK+HYLAQIVA
Sbjct: 242 KKIENDPEFYKIRDDTVREGLF----EEWCEKHSAKESDSEDESNVLEPTKYHYLAQIVA 297

Query: 293 KA-EIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIF 351
           KA  IAPD IPQDIRK+QKAL+KAYRIKEYVP KR+QDRFVSQLLFYYKTF+LEQRK IF
Sbjct: 298 KAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIF 357

Query: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411
           Q+CL DHERDF  A+ SLRQD  LISRWQA+L     DG S+ED LLSIE+RC V AI +
Sbjct: 358 QDCLWDHERDFGGAIASLRQDNKLISRWQALLE-DPIDGTSIEDVLLSIENRCCVSAIVV 416

Query: 412 ADPRYYVLGILDKTAGWVRWLAAEGVDPAAGWPRRA 447
           ADPRYYV+GIL+KT  WVRWLAAEG  P+   P  A
Sbjct: 417 ADPRYYVVGILEKTVVWVRWLAAEGAPPSRFTPAGA 452

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/450 (60%), Positives = 323/450 (71%), Gaps = 19/450 (4%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
           WQEFKTPAGK+Y+YNKNTK+SRW+KP+ KK S  +  AK +Q ERKP F+LEL++ WHLI
Sbjct: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64

Query: 67  ICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVEK 126
           I NDGTK Y+N +S   K +I +E   +C +L+ SLDKEKL+LLIGVARGY +REED++K
Sbjct: 65  IYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDIDK 124

Query: 127 IFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGXXX------- 179
           I ES NEEI LFK+NQ  V  E+ DE +EEAGD ++P Q +  GLVSGYG          
Sbjct: 125 ILESCNEEIHLFKRNQDEV--ERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEEDEEE 182

Query: 180 ---XXXXXXXXXXNDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIE 236
                        N D  IIDDLN+ID+ D++ER +FF+L DRY+LDKFSTWSLQ KKIE
Sbjct: 183 DEEEDEENEEQIVNQDISIIDDLNRIDTDDIDERNIFFELFDRYKLDKFSTWSLQSKKIE 242

Query: 237 NDPDFYKVGDAAVRESLFX----XXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVA 292
           NDPDFYK+ D  VRESLF                              PTK+HYLAQIVA
Sbjct: 243 NDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTKYHYLAQIVA 302

Query: 293 KA-EIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIF 351
            A  IAPD IPQDIRKQQKAL+KAY+IKEY+PSKRDQD+FVSQLLFYYKTF LEQRKEIF
Sbjct: 303 NAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIF 362

Query: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411
            +CLRDHERDF  AV+SLRQD  LI RWQ +L+   AD +S+ED LLSIEHRC V  I +
Sbjct: 363 CDCLRDHERDFTGAVESLRQDKELIDRWQTLLK-APADSSSIEDILLSIEHRCCVSPIVV 421

Query: 412 ADPRYYVLGILDKTAGWVRWLAAEGVDPAA 441
            +PRYYV+GIL+KT  WVRWLAAE V P++
Sbjct: 422 TEPRYYVVGILEKTVVWVRWLAAE-VGPSS 450

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  234 bits (598), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 152/466 (32%), Positives = 243/466 (52%), Gaps = 64/466 (13%)

Query: 5   EVWQEFKTPAGKRYFYNKNTKESRWDKPD----FKKASGAQDRAKVAQVERKPMFALELI 60
           ++W+EF  P G++Y+YN  +KES W KPD     +K     DRA        P+F   L+
Sbjct: 4   KIWKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDRAGA------PLFVFPLL 57

Query: 61  DDWHLIICNDGTKFYYNGESN--ISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYN 118
           + WHLIIC  G K+YYN   N  ISK E+ ++ + Q   L+N++DK+KLILLI VARGYN
Sbjct: 58  NGWHLIICVGGEKYYYNKVLNDTISK-ELSDDSSLQ---LLNAVDKDKLILLIAVARGYN 113

Query: 119 VREEDVEKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQAN-----SAGLVS 173
               D EK+++ L +E +L   + +   + +     +E  D +   + N     + GL+ 
Sbjct: 114 W--PDYEKLYDELLKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNVVAVSNTGLIG 171

Query: 174 GY---------------GXXXXXXXXXXXXXNDDAGIIDDLNQIDSG-----DVN---ER 210
           GY                             +D   + ++LN ID G     D++    +
Sbjct: 172 GYLSSDDEESSDENQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLEKSK 231

Query: 211 GLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFXX---------XXXXX 261
            LF +L + ++LD +S+W LQ KKI+N PD++++ D + RE LF                
Sbjct: 232 SLFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVT 291

Query: 262 XXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEY 321
                              PTKFHYLA I++KA+IA D I  DI++  K+LFK ++IK++
Sbjct: 292 NFEGEDEETLTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLFKEFKIKDF 351

Query: 322 VPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISRWQA 381
           + SK+DQ+ F S+LLF+YK F L +RK +F + L+++E      + ++  ++ ++   + 
Sbjct: 352 IKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENEN---LIIPNINSNIEIV---RH 405

Query: 382 ILRPTAADGASVEDALLSIEHRCGVGAIAL---ADPRYYVLGILDK 424
           I++    +   +E  LL IE   G+  + +    DP+YY+LGI DK
Sbjct: 406 IIKNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDK 451

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  231 bits (589), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 155/439 (35%), Positives = 231/439 (52%), Gaps = 50/439 (11%)

Query: 4   NEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDW 63
           N++W+E++ P GK+Y+YN  TK++ W+KP+          AK  ++E  P+F + L++DW
Sbjct: 2   NKIWKEYRAPNGKKYYYNTETKKTTWEKPE---------AAKREEIE--PVFVIRLMNDW 50

Query: 64  HLIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREED 123
            L+ICN+G K+Y + E+  +K   DEE       L+   DKEKL+ LIG+ARGY +  E+
Sbjct: 51  KLVICNNGMKYYLDNENEPTKELSDEESL----RLIELFDKEKLVCLIGIARGYAI--EN 104

Query: 124 VEKIFESLNEEIDLFK---KNQVVVVEEKADEPNEEA--GDAETPPQANSAGLVSGYGXX 178
           VEKI+ ++ EE++  K   KN+   ++++A+    E    +AE P      G  S     
Sbjct: 105 VEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGYDSSESEE 164

Query: 179 XXXXXXXXXXXNDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIEND 238
                      N+ A         D G   ++  F +L DRY LDKFS WS++  K+  D
Sbjct: 165 EEEEEDDYEFLNNVA---------DEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKD 215

Query: 239 PDFYKVGDAAVRESLFXX------XXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVA 292
           PDFY V D   RE LF                                PTKFHYL+QIV+
Sbjct: 216 PDFYLVTDDQEREDLFERWCSGQGIHSTSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVS 275

Query: 293 KAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTF-SLEQRKEIF 351
           K+EI    I QDI++Q K LFK Y+IK+++ S ++Q++FVS+LLFYYKTF  +E R + F
Sbjct: 276 KSEIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQF 335

Query: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411
            + LR+   ++         D+  +S  + I R    D  ++E  LL IE  C      L
Sbjct: 336 NDFLREKNANYTSM-----SDMNTLS--EHIKR---NDTYAIETTLLQIE--CNFPQDVL 383

Query: 412 ADPRYYVLGILDKTAGWVR 430
           +D RYY+L +  KT   V+
Sbjct: 384 SDVRYYILDLKQKTIELVK 402

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  228 bits (581), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 143/449 (31%), Positives = 230/449 (51%), Gaps = 32/449 (7%)

Query: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
           +W  F  P+G++Y+YN  TKES W +P+     G   R K+ + E +P +A+ L++DW L
Sbjct: 4   LWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR-EPEPFYAIPLVNDWFL 62

Query: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125
           +I + G K+Y++  +  + + +++    + A L++++DK K+ILL+ +ARGYN    D  
Sbjct: 63  VIDDIGGKYYFDSSTEEASWTLED---PESAELLSTIDKNKIILLVAIARGYNTNVGD-- 117

Query: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANS--AGLVSGYGXXXXXXX 183
           ++++ + +++   +K   V  E + +   E         +     +GL++GY        
Sbjct: 118 RVYQEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSEEEEN 177

Query: 184 XXXXXXNDDAGIIDD----LNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDP 239
                      + DD     N  D   +  R  FFQL  R++ D +STWS+Q +KI+ DP
Sbjct: 178 EIDSDVEKLNNLGDDDLPKENHEDESQI--RNDFFQLLQRHQCDPYSTWSIQARKIQEDP 235

Query: 240 DFYKVGDAAVRESLF-----------XXXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLA 288
            FY++ D ++RES+F                                     P  FHYLA
Sbjct: 236 LFYRITDDSIRESMFEEWCEKAINRTTNPQDLVDEDNLDDDSREEEEEDELEPLPFHYLA 295

Query: 289 QIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRK 348
            IV+KA I P  I QDI+ Q KA FK Y+IK++V SK  Q+ FVS+LLFYYK F+L++RK
Sbjct: 296 HIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERK 355

Query: 349 EIFQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVG- 407
           EIF + L  H R     ++   + +      +A     + D  ++E  LL +E+  G+  
Sbjct: 356 EIFHDLLESHSRSIKKNLEQESESMRSTLSEEA----GSNDAYAIETKLLKMENLIGLAR 411

Query: 408 -AIALA-DPRYYVLGILDKTAGWVRWLAA 434
               LA DP+YYVLGI DK    + +L +
Sbjct: 412 DMEELANDPKYYVLGIKDKMIELMHYLTS 440

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  220 bits (561), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 158/489 (32%), Positives = 240/489 (49%), Gaps = 81/489 (16%)

Query: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPD--FKKASGAQDRAKVAQVERKPMFALELIDDW 63
           VW+EF  P G++Y+YN  TK++ WD+P+  F+  + +Q      Q +  P+FA  L +DW
Sbjct: 5   VWKEFIAPNGQKYYYNLKTKKTTWDEPESLFEGNAVSQ-----GQKDESPVFAFPLFNDW 59

Query: 64  HLIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVRE-- 121
           +L+I + G KFY+N   NIS  E+ +E   Q   L+ S+DK+KLILL+GVARG+   E  
Sbjct: 60  YLVISSLGKKFYFNAVENISVLELHDELNTQ---LLQSIDKQKLILLVGVARGFIYDEYL 116

Query: 122 EDVEKIFESL----NEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQ--ANSAGLVSGY 175
           +  E+I E+L    NE  + +K+ QV V +E     +EE+ D + P    A   G+V+ Y
Sbjct: 117 QVYEEIMENLDFVKNEISNEYKELQVNVAQE-----SEESADKQDPGDLIATDNGIVNDY 171

Query: 176 GXXXXXXXXXXXXXNDDAGIIDDLNQIDSG----------DVNERGL------------- 212
                          ++  + +D  Q + G          D NE  L             
Sbjct: 172 YSSSDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKE 231

Query: 213 -FFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFXX--------------- 256
            +FQL ++Y+L+ FSTWS Q K + +DPDFY + D ++RE +F                 
Sbjct: 232 KYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSV 291

Query: 257 ----------XXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKAEIAPDCIPQDIR 306
                                             PTK+HYL+ I++KA I+PD I QDI+
Sbjct: 292 DKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFQDIK 351

Query: 307 KQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAV 366
           K  K LFK ++I +++ SKRD + F S+L+FYYK F   QR++IF+  L  ++      V
Sbjct: 352 KDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV 411

Query: 367 QSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGV-GAI-ALA-DPRYYVLGILD 423
                 V    +    L  +  +    E  LL +E   G+ G++  LA DP+YY+LGI D
Sbjct: 412 ------VEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKD 465

Query: 424 KTAGWVRWL 432
           K      +L
Sbjct: 466 KLECLKNYL 474

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  219 bits (558), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 243/462 (52%), Gaps = 52/462 (11%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPD-FKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
           W+E+KTP G +Y+YN NTK S  DKPD F+++     R+K  +V+    F + L +DW L
Sbjct: 10  WREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSF--RSKSRRVDPGVTFVVPLSNDWVL 67

Query: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125
            +C +G +F+Y   +  S+++I++E + +  +L+   DK KL+LL+  ARG+++ E DV 
Sbjct: 68  SVCENGQRFFYKSSTEESRWDIEDEESLRILSLV---DKNKLVLLLATARGFDIGERDV- 123

Query: 126 KIFESLNEEIDLFKKNQVVV----VEEKADEPNEEAGD----AETPPQANSAGLVSGYGX 177
             ++ L E+I+  K+++ V     V E A+EP+  AG+     E P QA    L+S Y  
Sbjct: 124 --YQELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRT-LISAYES 180

Query: 178 XXXXX------XXXXXXXNDDAGI---IDDLNQIDSGDVNE--RGLFFQLCDRYELDKFS 226
                             +D+ G    I+DLN   S   NE  + +F  L D Y+LD +S
Sbjct: 181 SDEDGDSSDEINAEKEVHSDNEGSNSDIEDLNAA-SHQYNEATKQMFTSLFDEYDLDPYS 239

Query: 227 TWSLQCKKIENDPDFYKVGDAAVRESLFX-------------XXXXXXXXXXXXXXXXXX 273
           TW++Q KKI ++P FY+V   A R  LF                                
Sbjct: 240 TWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQAVSSDGDGDDDD 299

Query: 274 XXXXXXXPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVS 333
                  PT++HYLA IV+KAE+AP  +P+D+R +QK LFK ++IKE +  K+ QD F+S
Sbjct: 300 TSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFKQFKIKESL-GKKQQDEFLS 358

Query: 334 QLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASV 393
           +LLFYYK  + EQR E+  + L+   +      +++ Q   ++S+      PT+  G ++
Sbjct: 359 KLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQQDL---PTS--GFAI 413

Query: 394 EDALLSIEHRCGVGAIALA---DPRYYVLGILDKTAGWVRWL 432
           E  LL +E    +  ++ A   + +YYVLGI  KT     +L
Sbjct: 414 ESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFL 455

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  216 bits (550), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 145/452 (32%), Positives = 230/452 (50%), Gaps = 53/452 (11%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPD-FKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
           W+E+KTP G +Y+YN NTK+S ++ PD F +   +  +++  +++ KP+FAL L +DW L
Sbjct: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSR--KLDAKPLFALSLFNDWAL 62

Query: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125
           IICN G +F+YN ES+ S++++D+E + +   L+  LD+EKL+LL+GVA+G++  + +V 
Sbjct: 63  IICNTGLRFFYNSESHTSRWDLDDEASLE---LLAKLDREKLVLLVGVAKGFDPGDRNV- 118

Query: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYG--------- 176
             ++ L++ I   K++          +  +E  +   P       LVSGYG         
Sbjct: 119 --YQELSDSISELKEDS------NNRDFRKETAEESIPTAVPGQSLVSGYGSSDESDKDE 170

Query: 177 ------XXXXXXXXXXXXXNDDAGIIDDLNQI-DSGDVNERGLFFQLCDRYELDKFSTWS 229
                              N     +DDL  +    D +    F  L  +Y +D +STW+
Sbjct: 171 DEEEEENDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWN 230

Query: 230 LQCKKIENDPDFYKVGDAAVRESLF---------XXXXXXXXXXXXXXXXXXXXXXXXXX 280
           +Q +KI +DP FYK+ + A R+ LF                                   
Sbjct: 231 MQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSLE 290

Query: 281 PTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYK 340
           P+++HYLA IV+K++I    +P+DIR  QK LFK +RIK+ + SKR+QD F+S+LLFYYK
Sbjct: 291 PSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLLFYYK 349

Query: 341 TFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTA--ADGASVEDALL 398
             + EQR  IF+  L   ++     +++         R   IL   +   +  ++E  LL
Sbjct: 350 RMTPEQRIAIFKRFLEGKKKALKKGLKNQE-------RLSTILSTPSLPQENYAIETQLL 402

Query: 399 SIE---HRCGVGAIALADPRYYVLGILDKTAG 427
            +E      G  A    D +YYVLGI DKT  
Sbjct: 403 ILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVA 434

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  199 bits (506), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 148/437 (33%), Positives = 222/437 (50%), Gaps = 65/437 (14%)

Query: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
           VW+E++ P GK+Y++N  T E+ WD P  +K           ++  KP + + L++ W+L
Sbjct: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQ--------RELSIKPQYVIPLLNAWNL 55

Query: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125
           +ICN+G KFY N + +     +D+  + +   L++ +D+EKLILLIGVARGY+    D  
Sbjct: 56  VICNNGAKFYLNPDGD-PVLTLDDADSSE---LLSLVDREKLILLIGVARGYHCTSGD-- 109

Query: 126 KIFESLNEEIDLFK----KNQVVVVEEK--ADEPNEEAGDAETPPQANSAGLVSGYGXXX 179
           K++ S+ EEI   K     ++  + EE+   +EP E    +E  P A    LVSGYG   
Sbjct: 110 KVYNSVLEEISFLKDDLANDKAPLAEERELQEEPLETNVQSEPVPSA----LVSGYGSSS 165

Query: 180 XXXXXXXXXXNDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDP 239
                      D      D N+I          +F L   Y LDK+S WS++  KI NDP
Sbjct: 166 DGSDDEEEVPPDT-----DANRIS---------YFNLFSEYGLDKYSVWSIESLKISNDP 211

Query: 240 DFYKVGDAAVRESLFXXXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKAEIAPD 299
            F+ + D   RE +F                          PTK+HYL+QIVAK+ + P 
Sbjct: 212 RFHIISDDRQREEIFEEWCCSGVVDDSEDEGYSSGDDDLS-PTKYHYLSQIVAKSTVTPT 270

Query: 300 CIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHE 359
            I QDI++++ +LFK Y IK+++ SKR+Q++FVSQLLFYYK F+LE+R ++F + + +  
Sbjct: 271 TIFQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAE-- 327

Query: 360 RDFACAVQSLRQDVGLISRWQAILRPTA-ADGASVEDA---LLSIEHRCGVGAIALADPR 415
                            SR   +  PT+ AD A+ ED    LL +E    +    L +  
Sbjct: 328 -----------------SRTGTVPSPTSPADSATPEDIETNLLQMESH--LPPTVLDNTV 368

Query: 416 YYVLGILDKTAGWVRWL 432
           YY L I  K +   R L
Sbjct: 369 YYTLDIKTKQSVLHRML 385

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  184 bits (466), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 130/442 (29%), Positives = 219/442 (49%), Gaps = 42/442 (9%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
           W+ FK P+G  Y++N  +K S  +KP   K  G+Q +A + ++ R P+F L L + W+L+
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKP---KEFGSQ-QAGMKEL-RVPVFCLPLRNYWNLV 58

Query: 67  ICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREE-DVE 125
           IC DG+KF++N ESN+S++++      +  AL++ +D   L LLIGVARG+N+R + DV 
Sbjct: 59  ICKDGSKFFHNDESNVSQFKL---ADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVY 115

Query: 126 -KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGXXXXXXXX 184
            +I + L  ++D   K Q  + EE+    N      +    +N                 
Sbjct: 116 GEIRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILVSGYSSSSDDSGEES 175

Query: 185 XXXXXNDDAGI----IDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPD 240
                ND + I     D L  +++ ++  +  F QL +  +LD +STWS+Q K+I +DP 
Sbjct: 176 EVEEKNDPSSIDVKEEDTLPSLNNTEIESK--FIQLLNEIQLDPYSTWSIQAKRIMHDPR 233

Query: 241 FYKVGDAAVRESLFXX----------XXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQI 290
           +Y +     R+ LF                                    PTK+HYLA I
Sbjct: 234 YYLITSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEEDSDVTLEPTKYHYLAHI 293

Query: 291 VAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEI 350
           ++KA I P+ +  +I+K+ K+LFK   I + + +K++Q++F S+++ YYK     QR E+
Sbjct: 294 ISKANITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRMDNLQRTEL 352

Query: 351 FQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGV---- 406
           F++ +++  R F    + L          Q +L  T +D   +E  LL +E+   +    
Sbjct: 353 FKKMMKNKLR-FPPISEKLS---------QLMLEETPSDSFKLETQLLQLENALLILDNL 402

Query: 407 -GAIALADPRYYVLGILDKTAG 427
             +    +  YY+LGI DK A 
Sbjct: 403 QNSYMQNEIMYYILGIKDKLAA 424

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  162 bits (409), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 219/433 (50%), Gaps = 53/433 (12%)

Query: 3   RNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDD 62
           R+++W+E+  P G +Y+YN  T+E+ W KPD ++     D+    ++E KP+ A EL+  
Sbjct: 5   RSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADK----EIEIKPLVAFELLAG 60

Query: 63  WHLIICNDGTKFYYN-GESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVRE 121
           W LII +DG+K YYN  ES  S+    +    +C  L++ L+K++L+LLIG+ RGY  R 
Sbjct: 61  WALIIFSDGSKKYYNCNESQWSR----KISHPECLKLIDLLNKDRLLLLIGIIRGYRCRT 116

Query: 122 EDVEKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQ-ANSAGLVSGYGXXXX 180
            + + +   + E+ID  +++        A + +E+     T     N+   + GY     
Sbjct: 117 -NAKDLVNEIREDIDFIREDM------NAAKTSEDMKSGSTVNNLENTKNALLGY---YS 166

Query: 181 XXXXXXXXXNDDAGII---DDLNQIDSGDVNE------RGLFFQLCDRYELDKFSTWSLQ 231
                     D+  ++   D+ N ++  D+ +      +  +F L  ++EL+K+STW ++
Sbjct: 167 SDDEEEPAKRDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIE 226

Query: 232 CKKIENDPDFYKVGDAAVRESLFXXXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIV 291
            +K+  DP+FYK+ D AVRE++F                          PTK+HYL+Q+V
Sbjct: 227 SEKVSQDPEFYKIIDDAVRENIF--EEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLV 284

Query: 292 AKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIF 351
           A  ++ PD IP+    + K L K YRIK+Y  +K +Q +F+S++L +YK  SLE RK++F
Sbjct: 285 ANYDLKPDTIPE-DIIKDKKLIKKYRIKDYT-TKSEQRQFLSKMLAWYKHMSLEDRKQMF 342

Query: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411
           Q  +                D   + ++  I      D   VE  LL +E++ G+   + 
Sbjct: 343 QTYI----------------DRIPVGKYTDIDSDAQED---VESQLLELENQLGI-PTSE 382

Query: 412 ADPRYYVLGILDK 424
            D  YY + +  K
Sbjct: 383 NDLEYYCIDLRSK 395

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  157 bits (397), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 172/361 (47%), Gaps = 35/361 (9%)

Query: 1   MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELI 60
           M R ++W+E+K P G++Y+YN  TKE+ W KP  ++     D  +V        FA EL 
Sbjct: 1   MNRGKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK-------FAFELF 53

Query: 61  DDWHLIICNDGTKFYYNGESNISKYEIDEEGAGQC-AALMNSLDKEKLILLIGVARGYNV 119
           D W+L+I  DG K +Y+  +  S  E   +  G+    ++  +DKEK+ILLIG+ RG+  
Sbjct: 54  DGWYLLIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRD 113

Query: 120 REEDVEKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGXXX 179
               ++ +++ + ++I+  K+              E   DA    + N+           
Sbjct: 114 DRYHIKGVYDDIAQDINFLKQ--------------EILNDAMELERLNAEAEEE----ES 155

Query: 180 XXXXXXXXXXNDDAGIIDDLNQIDSG---DVNERGLFFQLCDRYELDKFSTWSLQCKKIE 236
                      DD  +    N  +     DV +R   F L + + LD +STWSLQ +KI 
Sbjct: 156 EKEEALPQEEQDDHTVELLNNLEEEEEEQDVKDR--LFHLFESFNLDVYSTWSLQSRKIS 213

Query: 237 NDPDFYKVGDAAVRESLFXXXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIV--AKA 294
           N  D++ V D   RE +F                          PTK+HYL++I+   + 
Sbjct: 214 NQADYFLVHDDTQREEMFEDWCAMKVAQLPEDESEAEDDDYE--PTKYHYLSEIMYQLRD 271

Query: 295 EIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQEC 354
           EI  D +  DI +  + LFK Y IK+++P +R+    VS+LLFYYK F+  +R+ +F + 
Sbjct: 272 EINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDY 331

Query: 355 L 355
           +
Sbjct: 332 V 332

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  131 bits (330), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 122/229 (53%), Gaps = 15/229 (6%)

Query: 204 SGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLF-----XXXX 258
           SGD   +   + L  RY+L+ +S W  + KKI +DPDF +V D +VRE +F         
Sbjct: 227 SGD---KKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAIS 283

Query: 259 XXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRI 318
                                 PTK+HYLA IV+K+ I P  I  DI+   K+ FK Y I
Sbjct: 284 GDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNI 343

Query: 319 KEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISR 378
           K+++ SK+DQ+ FVS+LLFYYK   LE+RKE+F + L+ + +      ++L  D+  +  
Sbjct: 344 KDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIE---ENLSNDMDKVRH 400

Query: 379 WQAILRPTAADGASVEDALLSIEHRCGV-GAIA--LADPRYYVLGILDK 424
             A     + D  +VE  L  +E   G+ G ++  + +P+YY+LGI DK
Sbjct: 401 CLA-QEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDK 448

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 75/114 (65%), Gaps = 4/114 (3%)

Query: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPD-FKKASGAQDRAKVAQVERKPMFALELIDDWH 64
           +W+E+  P G++Y+YN  TK+S W KP+   +    +   +  ++E KP  ALEL   WH
Sbjct: 4   IWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWH 63

Query: 65  LIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYN 118
           L+IC+ G KFYYN E+N S + + +EG+     L+++LDK KL+ LIG+ARGY+
Sbjct: 64  LVICDTGKKFYYNVETNESAWNLPDEGSRN---LIDALDKNKLVALIGLARGYS 114

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  125 bits (314), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 133/278 (47%), Gaps = 44/278 (15%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRA--KVAQVERKPMFALELIDDWH 64
           W EF TP+G +Y+YN  TK+S  +KP     +G  D+   K  +++ KP + + L   W 
Sbjct: 5   WNEFTTPSGDKYYYNLETKQSTLEKP-----AGFDDQKSRKRQKLQHKPKYLVPLDKGWS 59

Query: 65  LIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDV 124
           L++CN GTKFY+N  +N S + +D+  +     L+  LDKEKL+LLIG++RGY     +V
Sbjct: 60  LVLCNTGTKFYHNKITNESHWTLDDPCS---IELLQQLDKEKLVLLIGISRGYYCPRRNV 116

Query: 125 EKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPP-----QANSAGLVSGYGXXX 179
              ++ +  ++   K   +   E++  EP     D E        +    GLV+GYG   
Sbjct: 117 ---YDEIINDLKFLKDKSL---EKQGVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSD 170

Query: 180 XXXXXXXXXXND----------------------DAGIIDDLNQI-DSGDVNERGLFFQL 216
                      +                      D   ID+LN + +   ++ +  F  L
Sbjct: 171 DSEDENIEEEEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKNRFTIL 230

Query: 217 CDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLF 254
            D+Y LD +S W  Q +KI  DPDFY V + + R+ LF
Sbjct: 231 FDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLF 268

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 91/157 (57%), Gaps = 13/157 (8%)

Query: 281 PTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYK 340
           PT+FHYL+ I++K+ I    I  DI+K+ KALFK +RIK  +  K+DQ+ F S+LLFYYK
Sbjct: 326 PTRFHYLSHIISKSSIEQTTIFLDIKKENKALFKTFRIKSSL-KKKDQEDFASKLLFYYK 384

Query: 341 TFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISRWQAIL--RPTAADGASVEDALL 398
              LEQRK IFQ+ L          +  +R ++  + + + I   + T AD  ++E  LL
Sbjct: 385 RMDLEQRKLIFQKLL-------LSKLDIIRSNLRNVEKLRDIATEQSTPADSYAIETQLL 437

Query: 399 SIEHRCGV-GAIAL--ADPRYYVLGILDKTAGWVRWL 432
            +E    + G ++    +  YY+LGI DKT    ++L
Sbjct: 438 MMEDCMDIHGKLSFLQGEVHYYILGIKDKTIQLKQFL 474

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  112 bits (281), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 111/235 (47%), Gaps = 28/235 (11%)

Query: 208 NERGLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFXX----------- 256
           +E   F  L DRYEL+ +S+WSLQ +K+++DP+FY + D   R  LF             
Sbjct: 85  SEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGG 144

Query: 257 -XXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKA 315
                                    P KFHYL+ IV+K+ I P  +  D++ + K LFK 
Sbjct: 145 DSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKN 204

Query: 316 YRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGL 375
           + I E  P K++Q +FVS LLFYYK  S ++R EIF+  L             ++ ++  
Sbjct: 205 FNIDETHP-KQEQRQFVSSLLFYYKKKSSKERVEIFKNLLD----------TKVKHEINN 253

Query: 376 ISRWQAIL--RPTAADGASVEDALLSIEHRCGVGAIALA---DPRYYVLGILDKT 425
             + Q IL       D   +E  L+++E   G+         D +YYV+G+ DKT
Sbjct: 254 EDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKT 308

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  104 bits (260), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 102/217 (47%), Gaps = 11/217 (5%)

Query: 213 FFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFXX--XXXXXXXXXXXXXX 270
            + L +R ELD +S W  +  KI  D  FY VGD   R+ LF                  
Sbjct: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNAVLED 159

Query: 271 XXXXXXXXXXPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDR 330
                     PT+FHYLA IV+K+ + PD +  D+R++ K LF    +   +  K++Q R
Sbjct: 160 GEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD--ILDKKEQRR 217

Query: 331 FVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADG 390
           FV+ LLFYYK      R E+F++ L  H      A   L  D  L    +    P   D 
Sbjct: 218 FVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAF--LENDAQLRELLEYDELPQ--DS 273

Query: 391 ASVEDALLSIEHRCGV-GAIA--LADPRYYVLGILDK 424
            S+E  L  +E   G+ GA++   ++ +YYVLG+ DK
Sbjct: 274 YSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDK 310

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 6  VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRA 44
          VW+  K+  GK Y+YN  T E+ WDKPD  + S  ++R 
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEERG 40

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 84/142 (59%), Gaps = 6/142 (4%)

Query: 6   VWQEFKTPAGKRYFYNKNTKESRWDKP-DFKKASGAQDRAKV---AQVERKPMFALELID 61
           +W+E+KTP GK+Y+YN  TK+S W+KP  F K +      K       E +  FA +L++
Sbjct: 11  IWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLLN 70

Query: 62  DWHLIICNDGTKFYYNGESNISKYEI--DEEGAGQCAALMNSLDKEKLILLIGVARGYNV 119
           +W+LI+ +DG+KFYYN  SN S  ++  D+E       LM  LDK  LI LIG+ RGYN 
Sbjct: 71  EWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYND 130

Query: 120 REEDVEKIFESLNEEIDLFKKN 141
              D++ ++E +   I   K++
Sbjct: 131 PSIDIKGLYEEIVANIGFLKQD 152

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 111/245 (45%), Gaps = 39/245 (15%)

Query: 213 FFQLCDRYELDKFSTWSLQCKKIENDPD-FYKVGDAAVRESLFX---------------- 255
           FF+L D+ +LD +STWS+Q ++I   P  FY + + + RE +F                 
Sbjct: 259 FFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGLYSSN 318

Query: 256 --------XXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKA--EIAPDCIPQDI 305
                                            PTK+HYL++++ K    I    I QDI
Sbjct: 319 VKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSIFQDI 378

Query: 306 RKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACA 365
           ++Q K+LFK YRIK+++P K++ ++ VS LLFYYK  S ++R + FQE +  H   +   
Sbjct: 379 KRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKH---YGEK 435

Query: 366 VQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEH---RCG------VGAIALADPRY 416
           ++   +++  I    +     A     +E  +L IE+   R G        A+      Y
Sbjct: 436 IKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPGLEY 495

Query: 417 YVLGI 421
           Y++G+
Sbjct: 496 YIIGL 500

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 106/249 (42%), Gaps = 35/249 (14%)

Query: 190 NDDAGIIDDLNQIDSGD---VNERGLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGD 246
           N+D  + + L  ID+ +    N+   FF+L DR  +D +S W L+ KKI +DP FY +  
Sbjct: 49  NEDDVLKELLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPT 108

Query: 247 AAVRESLFXXXXXXXXXXXXXXXXXXXXXXXXXXPTKFHYLAQIVAKAEIAPDCIPQDIR 306
              RE LF                             +H LA+++   +I  + I +DIR
Sbjct: 109 DVEREKLF----EQWCYGKLHSREEETTQPQLALALPYHDLAEMICCFDIQSNTIYKDIR 164

Query: 307 KQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAV 366
           K  K + +  +I E + SK +Q++F ++LL   K       + +F++ L ++  D     
Sbjct: 165 KANKKMVR--QIDEKI-SKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVD----- 216

Query: 367 QSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGA--IALADPRYYVL-GILD 423
              R DV            T AD       L+ +E R G+        D RY+ L     
Sbjct: 217 ---RVDVNTSF-------ETLAD-------LVDLERRMGITTENSVSRDARYFCLRNASR 259

Query: 424 KTAGWVRWL 432
           + AG  RW+
Sbjct: 260 RFAGLERWV 268

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 9/86 (10%)

Query: 4  NEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDW 63
          N+ W+  K   G+ Y+YN NTKESRWD+P   + S   D +            LE I  W
Sbjct: 8  NDPWRSAKDANGRTYYYNINTKESRWDRPASMEGSTNNDDS--------DKMLLEQI-GW 58

Query: 64 HLIICNDGTKFYYNGESNISKYEIDE 89
             + N+G  +YYN ++  S++++++
Sbjct: 59 KSNVTNEGKVYYYNLKTGESRWDVND 84

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPD----FKKASGAQDRAKVAQVERKPMFALEL--I 60
          W++ K P G+ Y+YN  TKESRWD P       K+   + +  V + E K    LE   +
Sbjct: 5  WKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLEFLKL 64

Query: 61 DDWHLIICNDGTKFYYNGESNISKYE 86
            W      +G  +YYN ++  S+++
Sbjct: 65 HGWRTAQTKEGRIYYYNVDTKESRWD 90

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQD 42
           W+  +T  G+ Y+YN +TKESRWD P+  K +  ++
Sbjct: 67  WRTAQTKEGRIYYYNVDTKESRWDPPNLPKNTSLKN 102

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 21/90 (23%)

Query: 1  MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELI 60
          M    +W+E K  +G+ Y+YN  T ES+W+KP                  R+ +   ELI
Sbjct: 1  MSSESLWKEAKDTSGRIYYYNAKTGESKWEKP------------------RELLSEQELI 42

Query: 61 ---DDWHLIICNDGTKFYYNGESNISKYEI 87
               W     +DG  +YYN ++  S++E+
Sbjct: 43 LAKHGWKSSKTSDGKLYYYNAQTKTSRWEL 72

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRW---DKPDFKKASGAQD 42
          W+  KT  GK Y+YN  TK SRW   D P+FKK    +D
Sbjct: 48 WKSSKTSDGKLYYYNAQTKTSRWELPDLPEFKKEVKKED 86

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 3  RNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPM 54
          R+  W   KT  GK Y+YN  TKESRWD P  +KA+  + + K  Q+++  +
Sbjct: 42 RDAGWNVAKTKEGKVYYYNVKTKESRWDNPLAEKAT--EKKTKTGQIKKTTI 91

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 15/80 (18%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
          W++     GK Y+YN  TKESRWDKP        +D   + Q  R           W++ 
Sbjct: 5  WKKATDSNGKVYYYNTVTKESRWDKP-------VEDTTDLKQKLRDA--------GWNVA 49

Query: 67 ICNDGTKFYYNGESNISKYE 86
             +G  +YYN ++  S+++
Sbjct: 50 KTKEGKVYYYNVKTKESRWD 69

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
           {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 23/117 (19%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKP------------DFKKASGAQDRAKV-AQVERKP 53
           W+  K   G+ Y+YN  TKES+W+KP              + ++ + + AK   ++E+  
Sbjct: 14  WRSAKDAKGRIYYYNLITKESKWEKPKELLPITAATSTTVRTSTISTNNAKTNIKIEKDD 73

Query: 54  MFALELIDDWHLIICNDGTKFYYN---GESN------ISKYEIDEEGAGQCAALMNS 101
              +E I  W   +  DG  +YYN   GES       I +Y+   +  GQ   +++S
Sbjct: 74  ASIMENI-GWKSNVTADGKTYYYNLKTGESRWDISALIKQYKEKSQTKGQNQQVLSS 129

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 15/84 (17%)

Query: 4  NEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDW 63
          +++W+E K   G+ Y+YN  T ESRW+KP        +  +K  Q+ +K        + W
Sbjct: 2  SDIWKEAKDNNGRVYYYNSKTGESRWEKP-------VEAPSKQEQLLKK--------NGW 46

Query: 64 HLIICNDGTKFYYNGESNISKYEI 87
           +     G  +YYN ++  S +E+
Sbjct: 47 SIGKSKAGKIYYYNTKTGESSWEL 70

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDF 34
          W   K+ AGK Y+YN  T ES W+ P F
Sbjct: 46 WSIGKSKAGKIYYYNTKTGESSWELPKF 73

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDF 34
          W+  +T  GK Y+YN  TKESRW+KP F
Sbjct: 48 WKSSRTAEGKIYYYNSITKESRWEKPIF 75

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKP 32
          W+E     G+ Y+YN    ESRW+KP
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKP 32

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAK 45
          W   +T  GK Y+YN +T ESRW+ P F+ A+    R K
Sbjct: 46 WGVARTKDGKLYYYNSSTGESRWEAPKFEDATTEVSRGK 84

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 17/86 (19%)

Query: 1  MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELI 60
          M  + +W+  K   GK Y+YN  T  S+W+KP              A +E          
Sbjct: 1  MGADSLWRTAKDSNGKVYYYNTKTGVSQWEKPGVS-----------ADIETLKQHG---- 45

Query: 61 DDWHLIICNDGTKFYYNGESNISKYE 86
            W +    DG  +YYN  +  S++E
Sbjct: 46 --WGVARTKDGKLYYYNSSTGESRWE 69

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 8/88 (9%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKP-------DFKKASGAQDRAKVAQVERKPMFALEL 59
          W++ + P G+ Y++N+ T++S+W+KP       D   A+G     KV +  +       +
Sbjct: 4  WEQARDPQGRVYYFNRETRKSQWEKPAEWEVTDDGAVAAGGAPTKKVEKATQGSS-GEPV 62

Query: 60 IDDWHLIICNDGTKFYYNGESNISKYEI 87
             W      DG  ++YN  +  S + +
Sbjct: 63 KGTWKSAKTKDGKVYFYNSATGKSSWTL 90

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 6  VWQEFKTPAGKRYFYNKNTKESRWDKP 32
           W+  KT  GK YFYN  T +S W  P
Sbjct: 65 TWKSAKTKDGKVYFYNSATGKSSWTLP 91

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
           YKL012W
          Length = 556

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 38/151 (25%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
           W+  K P G+ Y+YN  TK+S W+KP   K     D+                 +DW   
Sbjct: 4   WKAAKDPKGRIYYYNTVTKKSTWEKP---KNFAEPDQPSA--------------NDWKTG 46

Query: 67  ICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVEK 126
              DG  +YYN ++  S++ +  E        M   +KE+       AR      +D EK
Sbjct: 47  KTKDGKTYYYNVKTRESRWTLPPE--------MKQEEKEE-------ARP----NKDSEK 87

Query: 127 IFESLNEEIDLFKKNQVVVVEEKADEPNEEA 157
           I E+L    D +K +  ++    A  P E+A
Sbjct: 88  IVENLTSSNDKYKNDSKIL--NVASLPKEQA 116

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDF---KKASGAQDRAKVAQVERKPMF 55
          W+  +T  GK Y+YN+++ ESRW+ P F   +K    +   +VAQ   +P+ 
Sbjct: 45 WKTGETEGGKLYYYNESSGESRWEVPTFESDEKEEAVESTQEVAQDITQPVL 96

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
          W E   P G+ Y+YN  + E+ WDKP          R   +++E      LE    W   
Sbjct: 4  WNEAHDPEGRVYYYNSESGETTWDKP----------RELYSELE----LQLE-KHGWKTG 48

Query: 67 ICNDGTKFYYNGESNISKYEI 87
              G  +YYN  S  S++E+
Sbjct: 49 ETEGGKLYYYNESSGESRWEV 69

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 15/81 (18%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
          W+E     G+ Y+YN ++ E+ WDKP          R    Q+E K    LE    W   
Sbjct: 4  WKEANDAEGRVYYYNADSGETTWDKP----------RELFTQLELK----LE-KHGWKTG 48

Query: 67 ICNDGTKFYYNGESNISKYEI 87
            ++G  +YYN E+  S +EI
Sbjct: 49 KTDEGQVYYYNQETGKSCWEI 69

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASG 39
          W+  KT  GK Y+YN +T+++ W  P F K +G
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIPAFDKKTG 77

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPD 33
          W+E K   G+ Y+YN  TK+S W+KP+
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPE 30

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 15/82 (18%)

Query: 6  VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
          +W+E K  +G+ Y+YN  TK+S W+KP          +  ++Q E      L   + W  
Sbjct: 3  IWKEAKDASGRIYYYNTLTKKSTWEKP----------KELISQEE-----LLLRENGWKA 47

Query: 66 IICNDGTKFYYNGESNISKYEI 87
              DG  +YYN  +  + + I
Sbjct: 48 AKTADGKVYYYNPTTRETSWTI 69

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 1  MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKK-----ASGAQDRAKVAQV 49
          + R   W+  KT  GK Y+YN  T+E+ W  P F+K     A    D    AQV
Sbjct: 39 LLRENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKKVEPIAEQKHDTVSHAQV 92

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 16/81 (19%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
          W+E   P G+ Y+YN +  E+ W KP  K+     D             A+ L   W + 
Sbjct: 4  WKETIDPEGRVYYYN-SKGETTWHKP--KEMEVVLD-------------AILLKQGWKVA 47

Query: 67 ICNDGTKFYYNGESNISKYEI 87
             DG  +YYN  +N S +E+
Sbjct: 48 STEDGKVYYYNKNTNESTWEL 68

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKP 32
          W+   T  GK Y+YNKNT ES W+ P
Sbjct: 44 WKVASTEDGKVYYYNKNTNESTWELP 69

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 16/81 (19%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
          WQE K P G+ Y+YN +T ++ W+KP+              + ERK      L   W   
Sbjct: 3  WQETKDPQGRVYYYN-DTGQTTWEKPE----------ELFTEFERKL-----LKYGWKTA 46

Query: 67 ICNDGTKFYYNGESNISKYEI 87
          +  DG  +YY  ++  + + +
Sbjct: 47 LAEDGRVYYYKSDTGETTWNV 67

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKA 37
          W+   T  G  Y+YN+ T ESRW+KP+ + A
Sbjct: 44 WKVATTEDGNVYYYNRETGESRWEKPELEPA 74

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 16/83 (19%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66
          W+E +   G+ Y+YN +  E+ W+KP+               VE +P   LE    W + 
Sbjct: 4  WKEAQDSTGRVYYYN-SKGETSWNKPN------------DTPVELEP--RLEECG-WKVA 47

Query: 67 ICNDGTKFYYNGESNISKYEIDE 89
             DG  +YYN E+  S++E  E
Sbjct: 48 TTEDGNVYYYNRETGESRWEKPE 70

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 6  VWQEFKTPAGKRYFYNKNTKESRWDKP 32
          +W+E K   G+ Y+YN  TK+S W+KP
Sbjct: 3  IWKEAKDANGRVYYYNSLTKKSTWEKP 29

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 1  MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKK 36
          + R   W+  KT  GK Y+YN  T+E+ W  P F+K
Sbjct: 39 LLRENGWRAAKTKEGKVYYYNPATRETSWTIPVFEK 74

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 19/96 (19%)

Query: 6  VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65
           W+E K   G+ Y+YN  T E+ W KP          +   +++ER+      L   W +
Sbjct: 5  TWKEAKDLQGRIYYYNTATSETTWTKP----------QELYSELERRL-----LAHGWKV 49

Query: 66 IICNDGTKFYYNGESNISKYEI----DEEGAGQCAA 97
                  +YYN  S  S++E+    D+E   Q  A
Sbjct: 50 GSTAGKQTYYYNEASGESRWELPVLPDQEQDVQAKA 85

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 7  WQEFKTPAGKRYFYNKNTKESRWDKP 32
          W+E K   G+ Y+YN  TK+S W+KP
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKP 29

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 32.7 bits (73), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 5/49 (10%)

Query: 117  YNVREEDVEKIFESLNEEIDLFKKNQVVVVEEKADEPN-EEAGDAETPP 164
            +NV E+DVEK    + EE ++ K N V V E + D P  ++ GDA TPP
Sbjct: 2895 FNVSEKDVEK---RIKEEENITKLNYVPVEEPQIDMPQIKDLGDA-TPP 2939

>SAKL0G14520g Chr7 complement(1253028..1253516) [489 bp, 162 aa]
          {ON} similar to uniprot|P22696 Saccharomyces cerevisiae
          YJR017C ESS1 Peptidylprolyl-cis/trans-isomerase
          (PPIase) specific for phosphorylated serine and
          threonine residues N-terminal to proline
          Length = 162

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 5  EVWQ-EFKTPAGKRYFYNKNTKESRWDKPD 33
          E W   F     + YF+N +TKES WD P+
Sbjct: 8  EPWSIRFSKSKRREYFFNPDTKESHWDAPE 37

>Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {ON}
           YER125W (RSP5) - Rsp5p encodes a hect (homologous to
           E6-AP C terminus) and encodes a ubiquitin-protein ligase
           (E3 enzyme) [contig 210] FULL
          Length = 787

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/81 (19%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFAL-ELIDDWHL 65
           W++  TP G+ YF + NT+ + W  P  ++       A    ++++P+  L  L   W +
Sbjct: 315 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTT-IQQQPVSQLGPLPSGWEM 373

Query: 66  IICNDGTKFYYNGESNISKYE 86
            + N    ++ +  +  + ++
Sbjct: 374 RLTNTARVYFVDHNTKTTTWD 394

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/81 (19%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFAL-ELIDDWHL 65
           W++  TP G+ YF + NT+ + W  P  ++       A    ++++P+  L  L   W +
Sbjct: 317 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPASTT-IQQQPVSQLGPLPSGWEM 375

Query: 66  IICNDGTKFYYNGESNISKYE 86
            + N    ++ +  +  + ++
Sbjct: 376 RLTNTARVYFVDHNTKTTTWD 396

>KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {ON}
           highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125W RSP5 Ubiquitin-protein ligase
           involved in ubiquitin-mediated protein degradation plays
           a role in heat shock element (HSE)-mediated gene
           expression and multivesicular body sorting contains a
           hect (homologous to E6-AP carboxyl terminus) domain
          Length = 791

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/81 (19%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFAL-ELIDDWHL 65
           W++  TP G+ YF + NT+ + W  P  ++       A    ++++P+  L  L   W +
Sbjct: 319 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTT-IQQQPVSQLGPLPSGWEM 377

Query: 66  IICNDGTKFYYNGESNISKYE 86
            + N    ++ +  +  + ++
Sbjct: 378 RLTNTARVYFVDHNTKTTTWD 398

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,938,174
Number of extensions: 1914389
Number of successful extensions: 6136
Number of sequences better than 10.0: 58
Number of HSP's gapped: 6157
Number of HSP's successfully gapped: 87
Length of query: 452
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 339
Effective length of database: 40,524,141
Effective search space: 13737683799
Effective search space used: 13737683799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)