Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4793.496ON21221211321e-159
Smik_16.4033.496ON2032129361e-130
Skud_16.4453.496ON2152018981e-124
YPR151C (SUE1)3.496ON2062118951e-123
TPHA0D033003.496ON1961454532e-56
Kpol_1017.43.496ON1841434313e-53
SAKL0F02618g3.496ON2531374347e-53
KNAG0A079603.496ON1771494052e-49
NDAI0B058903.496ON2781403846e-45
ZYRO0D09812g3.496ON1851443766e-45
KLTH0F14938g3.496ON2291613666e-43
KLLA0E03983g3.496ON1911363583e-42
Kwal_55.212483.496ON2221483597e-42
TDEL0D056403.496ON1241382472e-26
CAGL0L08426g3.496ON1401432292e-23
NCAS0F035703.496ON2301392292e-22
TBLA0D029403.496ON71461674e-15
Ecym_12333.496ON87441642e-14
KAFR0G037103.496ON79391467e-12
TPHA0D012908.682ON2181651547e-12
NCAS0C013108.682ON2571471541e-11
YPL159C (PET20)8.682ON2531641479e-11
Smik_6.3568.682ON2531361433e-10
ZYRO0F07480g8.682ON2361601433e-10
Suva_16.1518.682ON2531681433e-10
Skud_16.1238.682ON2551641434e-10
AFR315C3.496ON77681318e-10
TDEL0A062708.682ON2421701382e-09
KNAG0J017608.682ON2581371382e-09
Kpol_1013.98.682ON2611421338e-09
KLLA0D06061g8.682ON2491361338e-09
TPHA0G015708.682ON2551371274e-08
Kpol_1072.128.682ON2221581194e-07
KLTH0D11396g8.682ON2251361194e-07
NDAI0K013208.682ON2581391125e-06
SAKL0H06380g8.682ON219471053e-05
Kpol_1066.443.62ON4791571064e-05
ZYRO0C02244g3.62ON4601511021e-04
Kwal_26.88288.682ON22357983e-04
TDEL0E007103.62ON476135994e-04
CAGL0M02101g8.682ON267137958e-04
TBLA0B038008.682ON32432940.001
KLLA0A07447g3.62ON486148940.001
Ecym_23908.682ON227136900.003
CAGL0M03685g3.62ON493140910.004
Skud_14.423.62ON524192900.004
NDAI0A061103.62ON490150860.013
TBLA0B085103.62ON501139820.042
KAFR0H023808.682ON220137800.060
SAKL0C12342g3.62ON552149800.081
Suva_14.443.62ON525159790.11
Smik_14.363.62ON524143790.13
KLTH0A01364g3.62ON476148760.24
NCAS0A099403.62ON49438760.29
TPHA0P012603.62ON494138720.81
TDEL0F015904.38ON51286711.1
TBLA0B027208.798ON50233691.8
CAGL0M10725g6.334ON32372692.0
Kwal_23.52773.62ON470153682.8
KAFR0I013704.38ON54187665.2
SAKL0A00660g6.363ON660106656.4
TBLA0B064702.513ON44058639.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.479
         (212 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   440   e-159
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   365   e-130
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   350   e-124
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   349   e-123
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   179   2e-56
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   170   3e-53
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   171   7e-53
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   160   2e-49
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   152   6e-45
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   149   6e-45
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   145   6e-43
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   142   3e-42
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   142   7e-42
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...   100   2e-26
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    93   2e-23
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    93   2e-22
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    69   4e-15
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    68   2e-14
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    61   7e-12
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    64   7e-12
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    64   1e-11
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    61   9e-11
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    60   3e-10
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    60   3e-10
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    60   3e-10
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    60   4e-10
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    55   8e-10
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    58   2e-09
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    58   2e-09
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    56   8e-09
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    56   8e-09
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    54   4e-08
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    50   4e-07
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    50   4e-07
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    48   5e-06
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    45   3e-05
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    45   4e-05
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    44   1e-04
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    42   3e-04
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    43   4e-04
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    41   8e-04
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    41   0.001
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    41   0.001
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    39   0.003
CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa] ...    40   0.004
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    39   0.004
NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa] ...    38   0.013
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    36   0.042
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    35   0.060
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    35   0.081
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    35   0.11 
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    35   0.13 
KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly...    34   0.24 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    34   0.29 
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    32   0.81 
TDEL0F01590 Chr6 complement(291940..293478) [1539 bp, 512 aa] {O...    32   1.1  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    31   1.8  
CAGL0M10725g Chr13 (1071524..1072495) [972 bp, 323 aa] {ON} simi...    31   2.0  
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    31   2.8  
KAFR0I01370 Chr9 complement(282658..284283) [1626 bp, 541 aa] {O...    30   5.2  
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    30   6.4  
TBLA0B06470 Chr2 complement(1526025..1527347) [1323 bp, 440 aa] ...    29   9.7  

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  440 bits (1132), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 212/212 (100%), Positives = 212/212 (100%)

Query: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60
           MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF
Sbjct: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
           TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP
Sbjct: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180

Query: 181 EWKNVPSYMMRKLKPFDRALQLQAKHSSNKKK 212
           EWKNVPSYMMRKLKPFDRALQLQAKHSSNKKK
Sbjct: 181 EWKNVPSYMMRKLKPFDRALQLQAKHSSNKKK 212

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  365 bits (936), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 190/212 (89%), Gaps = 9/212 (4%)

Query: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60
           MILL +T+I+G+S         FAS+QRRT +RLVNP+RQQHQQI+KQR+SK+FKN HF+
Sbjct: 1   MILLTRTKIKGVS---------FASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFY 51

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLL +DE P 
Sbjct: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
           TEAK TEKS+HKN+ FGERGTGGIMSGGVNGTWKYNPTVPNELLP+NWWSTSSMGMEYFP
Sbjct: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171

Query: 181 EWKNVPSYMMRKLKPFDRALQLQAKHSSNKKK 212
           EW+N+PSYM RKLKPFD+ LQ+Q KH S KK+
Sbjct: 172 EWRNIPSYMTRKLKPFDKPLQIQLKHKSKKKE 203

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  350 bits (898), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 185/201 (92%)

Query: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60
           MILLRKT+IRGL   R+RS++  A +QRRT TRLVNP+RQQHQQI+KQR+SK+FKN HF+
Sbjct: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+ SLQMLLA DE PA
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPA 120

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
            EAKATEK  HKNV FGERGTGGI SGGVNGTWKYNPTVPNELLP+NWWSTSSMGMEYFP
Sbjct: 121 AEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180

Query: 181 EWKNVPSYMMRKLKPFDRALQ 201
           EWKNVPSYMMRKLKPFD++LQ
Sbjct: 181 EWKNVPSYMMRKLKPFDKSLQ 201

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  349 bits (895), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 185/211 (87%), Gaps = 7/211 (3%)

Query: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60
           MILL++T+IRG+S +       F S+QRRT +RLVNP+RQQHQQI+KQR+SK+ KNAHF+
Sbjct: 1   MILLKRTKIRGVSVS-------FVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFY 53

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+KSLQ LL  +EK  
Sbjct: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
            EAK  ++ +HKN+ FGERGTGGIMSGGVNGTWKYNPTVPNELLP+NWWSTSSMGMEYFP
Sbjct: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173

Query: 181 EWKNVPSYMMRKLKPFDRALQLQAKHSSNKK 211
           EWKNVP YMMRKLKPFD+ALQ++  H S KK
Sbjct: 174 EWKNVPPYMMRKLKPFDKALQMRLTHKSKKK 204

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  179 bits (453), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 85/145 (58%), Positives = 106/145 (73%), Gaps = 1/145 (0%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  K +   L   + +   
Sbjct: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110

Query: 122 EAKATEKS-EHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
                +K+ E  +V  GE+GTGGIMSGGVNGTWKYNPTVP  LLPYNWWSTS MGMEY+P
Sbjct: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170

Query: 181 EWKNVPSYMMRKLKPFDRALQLQAK 205
           EW NVP   ++ LKPF+    L+ K
Sbjct: 171 EWNNVPRRFLKTLKPFEVNEPLRKK 195

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  170 bits (431), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 80/143 (55%), Positives = 104/143 (72%), Gaps = 8/143 (5%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD--KKKKSLQMLLASDEKP 119
           FRSLP+VPTTQ+LE+  LT DIL+SGYRP+ YPVKENPLFR+    K      L + E  
Sbjct: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95

Query: 120 ATEAKATEK------SEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSS 173
           + +A   ++      S+  N   G+RGTGGI SGGVNGTW++NP VP++LLPY+WWSTS 
Sbjct: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155

Query: 174 MGMEYFPEWKNVPSYMMRKLKPF 196
           MGMEY+PEWKN+P  +++ LKP+
Sbjct: 156 MGMEYYPEWKNIPRKVVKDLKPY 178

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  171 bits (434), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 1/137 (0%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKKKSLQMLLASDEKPA 120
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    ++K L    ++ ++  
Sbjct: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSAKKEYK 82

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
            EA+   + E  NV  G RGTGGI+SGGVNGTW+YNP +P +LLPYN WS+S+M MEY+P
Sbjct: 83  NEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142

Query: 181 EWKNVPSYMMRKLKPFD 197
           EW NVP  +  KLKPFD
Sbjct: 143 EWLNVPKTIANKLKPFD 159

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  160 bits (405), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 100/149 (67%), Gaps = 13/149 (8%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+  K      L +   P  
Sbjct: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNK------LMAISHPEH 85

Query: 122 EAKATEKSEHKNV------FFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMG 175
           + + TE + H++        FG    GGI + G NGTWKY P +P ++LP+NWWS SS+ 
Sbjct: 86  DTEGTEGT-HRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLA 144

Query: 176 MEYFPEWKNVPSYMMRKLKPFDRALQLQA 204
           ME +PEW +VP ++++ LKPFD  L ++A
Sbjct: 145 MEVYPEWSSVPKHVVKGLKPFDLLLGVKA 173

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  152 bits (384), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 74/140 (52%), Positives = 101/140 (72%), Gaps = 4/140 (2%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD--KKKKSLQMLLASDEKP 119
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR   KK  S     ++    
Sbjct: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTTSSS 188

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
           ++E K  ++ + K  +  E   GGIM+GG+NGTW+Y+P +PN LLP   WS S MGMEY+
Sbjct: 189 SSEKKKPQQEQMKKHYDDE--YGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYY 246

Query: 180 PEWKNVPSYMMRKLKPFDRA 199
           PEWK VP  +++ LKPFD++
Sbjct: 247 PEWKGVPFNIVKNLKPFDKS 266

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  149 bits (376), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 106/144 (73%), Gaps = 6/144 (4%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKS-LQMLLASDEKPA 120
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ +   L   L S     
Sbjct: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84

Query: 121 -----TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMG 175
                T+ +  E  E  +V  G RG GGI SGG +GTW+    +P++LLPY+WWST+SMG
Sbjct: 85  LRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWWSTTSMG 144

Query: 176 MEYFPEWKNVPSYMMRKLKPFDRA 199
           ME+FPEW+ VP +++RKLKPFDR 
Sbjct: 145 MEFFPEWEGVPRHVVRKLKPFDRG 168

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  145 bits (366), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 51  SKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQ 110
           SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++   K+ +
Sbjct: 12  SKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQR 71

Query: 111 MLLASDEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWS 170
           +     E+ A ++    +S   N   G  GTGGI SGGVNGTW+YNP +P++LLPYN WS
Sbjct: 72  L---RGERGARKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPSKLLPYNLWS 128

Query: 171 TSSMGMEYFPEWKNVPSYMMRKLKPFDRALQLQAKHSSNKK 211
            +SM MEY PEW  VP  ++ KL+PF+   +  A+ S++ K
Sbjct: 129 CTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCK 169

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  142 bits (358), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 99/136 (72%), Gaps = 2/136 (1%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+  K K L++    +     
Sbjct: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQ-AKVKELEVEREKNGGGKL 70

Query: 122 EAKATEKSEHKNVFF-GERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
           ++KA   SE ++ F  G  GTGGI+SGGVNGTW+YNP +PN+LL    WS+S+MGME++P
Sbjct: 71  KSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130

Query: 181 EWKNVPSYMMRKLKPF 196
           EW +VP+ +   LKP+
Sbjct: 131 EWNDVPNKVSASLKPY 146

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  142 bits (359), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 107/148 (72%), Gaps = 5/148 (3%)

Query: 51  SKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQ 110
           SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++   K+ +
Sbjct: 12  SKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQR 71

Query: 111 MLLASDEKPATEAKATEKSEH-KNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWW 169
           +     E+P ++   T   E  KN   G +GTGGI SGGVNGTW+YNP +P++LLP++ W
Sbjct: 72  LR----EEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLW 127

Query: 170 STSSMGMEYFPEWKNVPSYMMRKLKPFD 197
           S++SM MEY PEW  VP  ++ KL+PF+
Sbjct: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFN 155

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 99.8 bits (247), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 75/138 (54%), Gaps = 48/138 (34%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121
           FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF    K              T
Sbjct: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTK--------------T 76

Query: 122 EAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLP-YNWWSTSSMGMEYFP 180
           EA A+ +S                                  LP Y+ WST++MG+E FP
Sbjct: 77  EAPASLESN---------------------------------LPRYDLWSTTTMGLERFP 103

Query: 181 EWKNVPSYMMRKLKPFDR 198
           EW NVP  ++RKL+PFDR
Sbjct: 104 EWSNVPREVVRKLRPFDR 121

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 92.8 bits (229), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 25/143 (17%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK-------SLQMLLA 114
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL      +       S   L  
Sbjct: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67

Query: 115 SDEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSM 174
            DE+P  E           + +G  G GGI + GV      +P+     L Y     S M
Sbjct: 68  KDEEPVNE-----------LLYGPEGRGGISTMGVRRMA--DPSKVKLGLSY-----SIM 109

Query: 175 GMEYFPEWKNVPSYMMRKLKPFD 197
           GMEY+PEW+ VP  +++++KP++
Sbjct: 110 GMEYYPEWEKVPRDVVKRIKPYE 132

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 92.8 bits (229), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 75/139 (53%), Gaps = 36/139 (25%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+ K K+              
Sbjct: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQE------------- 164

Query: 122 EAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPE 181
           +AK    +E       +R  G  +S    G                 WSTS +G++ +PE
Sbjct: 165 DAKRENGNE-------KRALGSSVSHKYKGI----------------WSTSILGLQDYPE 201

Query: 182 WKNVPSYMMRKLKPFDRAL 200
           W NVP   ++ LKPFD  L
Sbjct: 202 WNNVPWNNIKNLKPFDEEL 220

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
           YPR151C
          Length = 71

 Score = 68.9 bits (167), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK 107
            R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+ + K
Sbjct: 16  LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
           Ashbya gossypii AFR315C
          Length = 87

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 105
            R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 10  LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
           Anc_3.496 YPR151C
          Length = 79

 Score = 60.8 bits (146), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 63  RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 101
           ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 9   KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 74/165 (44%), Gaps = 40/165 (24%)

Query: 38  VRQQHQQISKQRNSKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKE 97
           V  +  Q+S   + K   +    D+  LPKVP T  +  RE+T + LYSGYR        
Sbjct: 68  VATKGLQMSGGLSGKSLADKKVLDYSWLPKVPQTSSITHREITTNSLYSGYR-------- 119

Query: 98  NPLFRDKKKKSLQMLLASDEKPATEAKATEKSEHKNVF-FGERGTGGIMSGGVNGTWKYN 156
            PLF D KK +L            +  +T +  + +++ F  +                 
Sbjct: 120 -PLFIDNKKGTL----------LGDVNSTAQDANSSIYEFAMK----------------- 151

Query: 157 PTVPNELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPFDRALQ 201
               NEL   + W  S+ G+E + EW  VPS +++KLKP+D +++
Sbjct: 152 ---LNELSEPSPWMMSATGLESYSEWDYVPSKVIKKLKPYDLSIK 193

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 64/147 (43%), Gaps = 29/147 (19%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKP 119
           FD+ +LPKV     L   E++ DILYSGYRP+    K+               L +  + 
Sbjct: 85  FDYSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD---------------LENSSRK 129

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
           A    +   + ++     +  +   +SG  +  +              W STS+ GME F
Sbjct: 130 AEFGNSNNSTLYEIAMKLDDLSPEAISGSTSSNF--------------WHSTSATGMEVF 175

Query: 180 PEWKNVPSYMMRKLKPFDRALQLQAKH 206
            EW NVP+ +++ LKPF   ++    H
Sbjct: 176 DEWDNVPNSILKNLKPFQAPVKKNLTH 202

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 61.2 bits (147), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 79/164 (48%), Gaps = 49/164 (29%)

Query: 37  PVRQQHQQISKQRNSKLFKNAHF----FDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 92
           P+ +Q++ I+K+ +S + + +H      DF  LP+VP+T +L+  ++T ++LYSGYRP+ 
Sbjct: 72  PLIKQNKTITKKEHSDV-RGSHLKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRPLF 130

Query: 93  YPVKENPLFRDKKKKSLQMLLASDEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGT 152
                NP   D K K                                 TG  +       
Sbjct: 131 I----NP--NDPKLK-------------------------------EDTGSTL------- 146

Query: 153 WKYNPTVPNELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           +++   + +   P + W +S+ G+E+F EW+N+PS +++ LKPF
Sbjct: 147 YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 44/136 (32%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           DF  LPKVP+T +L+  ++T ++LYSGYRP+      NP   D K K             
Sbjct: 99  DFSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI----NP--NDPKLK------------- 139

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
                               TG  +       +++   + +   P + W +S+ G+E+F 
Sbjct: 140 ------------------EDTGSTL-------YEFAMKLEDLNEPLSPWISSATGLEFFS 174

Query: 181 EWKNVPSYMMRKLKPF 196
           EW N+PS ++R LKPF
Sbjct: 175 EWDNIPSELLRNLKPF 190

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 69/160 (43%), Gaps = 43/160 (26%)

Query: 39  RQQHQQISKQRNSKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKEN 98
           R QH Q   + +S+  K   + D+  LP+VP+T YL  R+++  ILYSGYRP        
Sbjct: 63  RTQHIQKKPEMDSQSGKPKKY-DYSWLPRVPSTNYLRPRDMSSKILYSGYRP-------- 113

Query: 99  PLFRDKKKKSLQMLLASDEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPT 158
                       + L  DE   ++                   GG      NG   Y   
Sbjct: 114 ------------LFLNPDELKTSQ------------------DGG---NANNGARLYEFA 140

Query: 159 VP-NELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPFD 197
           +   EL   + W++S+ G E +PEW  VP  + RKLKPF+
Sbjct: 141 MKLEELGEQSLWTSSATGQEIYPEWDYVPMEVQRKLKPFN 180

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 49/168 (29%)

Query: 33  RLVNPVRQQHQQISKQRNSKLFKNAHFF----DFRSLPKVPTTQYLEARELTRDILYSGY 88
               P+ +Q + I+K  ++ + + +H      DF  LP+VP+T +L+  ++T ++LYSGY
Sbjct: 68  ECTTPLIEQSEAIAKTDSTNI-RASHSRKKRRDFSWLPRVPSTSHLKHSDMTTNVLYSGY 126

Query: 89  RPVMYPVKENPLFRDKKKKSLQMLLASDEKPATEAKATEKSEHKNVFFGERGTGGIMSGG 148
           RP+      NP   D K K                                 TG  +   
Sbjct: 127 RPIFI----NP--NDPKLK-------------------------------EDTGSTL--- 146

Query: 149 VNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
               +++   + +   P + W +S+ G+E+F EW+N+PS +++ LKPF
Sbjct: 147 ----YEFAMKLDDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 49/164 (29%)

Query: 37  PVRQQHQQISKQRNSKLFKNAH----FFDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 92
           P+ +Q +QI+K  +S   + +H      DF  LP+VP+T +L+  ++T ++LYSGYRP+ 
Sbjct: 72  PLIKQSEQIAKN-DSTSIRASHPRKKRRDFSWLPRVPSTSHLKHTDMTTNVLYSGYRPLF 130

Query: 93  YPVKENPLFRDKKKKSLQMLLASDEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGT 152
                NP   D K K                                 TG  +       
Sbjct: 131 I----NP--NDPKLK-------------------------------EDTGSTL------- 146

Query: 153 WKYNPTVPNELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           +++   + +   P + W +S+ G+E+F EW+N+PS +++ LKPF
Sbjct: 147 YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR151C
           (SUE1)
          Length = 77

 Score = 55.1 bits (131), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 5/68 (7%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121
           FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R  ++ +L   LA    PA 
Sbjct: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR--RRPALLSFLAD---PAE 61

Query: 122 EAKATEKS 129
             K  + S
Sbjct: 62  STKRDDGS 69

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 77/170 (45%), Gaps = 44/170 (25%)

Query: 28  RRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSG 87
           RR++ +  + V +  Q+      S   +     D+  LP+VP+T  L+ R+++  +LYSG
Sbjct: 59  RRSVFKADDEVERSQQKKMTVEISGRGRKQQRHDYSWLPRVPSTGNLKPRDMSMKVLYSG 118

Query: 88  YRPVMYPVKENPLFRDKKKKSLQMLLASDE-KPATEAKATEKSEHKNVFFGERGTGGIMS 146
           YRP+      NP                DE K ++E                 GTGG + 
Sbjct: 119 YRPLFI----NP----------------DEIKTSSEGS---------------GTGGTL- 142

Query: 147 GGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
                 +++   +  EL   + W TS+ G+EY+ EW ++P  + +KLKPF
Sbjct: 143 ------YEFAMKL-EELGDQSPWVTSATGLEYYREWDSIPGELQKKLKPF 185

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 59/137 (43%), Gaps = 33/137 (24%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKP 119
           + +  LP VP+TQ++EA ++  ++LYSGYR         PLF D       +L A ++  
Sbjct: 91  YRYHPLPSVPSTQHIEANDMCTELLYSGYR---------PLFLDSTALERGLLAAKEQAS 141

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
            T+                       S    G+  Y   +  E  P   W+ S+ G+E +
Sbjct: 142 FTQ-----------------------SASPTGSTFYEIAMKLE-DPACIWANSATGLEKY 177

Query: 180 PEWKNVPSYMMRKLKPF 196
            EW N+P  +   LKPF
Sbjct: 178 TEWDNIPYSVANSLKPF 194

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 58/142 (40%), Gaps = 51/142 (35%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKP 119
            D+  LPKVP+T+ L  RE+    LYSGYRP+                            
Sbjct: 107 LDYSWLPKVPSTENLNHREIRTSALYSGYRPI---------------------------- 138

Query: 120 ATEAKATEKSEHKNVFFGERGTG-----GIMSGGVNGTWKYNPTVPNELLPYNWWSTSSM 174
                          +   +G+G     G M  GVN T+     +  +L   + W +S+ 
Sbjct: 139 ---------------YINSKGSGKNKLSGTMKNGVNSTFY---EIAMKLENPSPWMSSAT 180

Query: 175 GMEYFPEWKNVPSYMMRKLKPF 196
           GME + EW +VP  +++ LKPF
Sbjct: 181 GMELYSEWDHVPLDVLKDLKPF 202

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 57/136 (41%), Gaps = 50/136 (36%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           D+  LP+VPTT+++   E   D+LYSGYRP++   K       K+ K +Q  +  +    
Sbjct: 108 DYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDK-----NAKENKLMQFAMKLE---- 158

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
                                            K +  VP        W +S+ G E+F 
Sbjct: 159 ---------------------------------KLSEPVP--------WVSSATGQEFFS 177

Query: 181 EWKNVPSYMMRKLKPF 196
           EW NVPS +++ LKPF
Sbjct: 178 EWDNVPSEIIKDLKPF 193

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 53/137 (38%), Gaps = 41/137 (29%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKP 119
           FD+ SLPK PTT +L + E   D+ YSGYRP+   V +              L +  E P
Sbjct: 101 FDYSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQ--------------LASEQENP 146

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
            T  + +                  +S  +         V   L     W  S+ G E +
Sbjct: 147 CTCYEIS------------------LSMDI---------VKKNLKVSTPWLFSATGSELY 179

Query: 180 PEWKNVPSYMMRKLKPF 196
            EW N+P  ++  LK F
Sbjct: 180 KEWDNIPKSVLDNLKCF 196

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 62/158 (39%), Gaps = 45/158 (28%)

Query: 41  QHQQISKQRNSKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPL 100
           Q  Q++K  N+    N    D+  LPKVP+ + L  +++T DI YSG+RP+     E   
Sbjct: 73  QKLQLNKYNNNTQLNNDLVVDYSWLPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTE--- 129

Query: 101 FRDKKKKSLQMLLASDEKPAT--EAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPT 158
                      L   DE  +T  E   T  S              +   G N        
Sbjct: 130 -----------LENKDEDSSTWYEVSLTLDSP-------------VPPSGHNSI------ 159

Query: 159 VPNELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
                     W++S+ GME + EW +VP  ++  L PF
Sbjct: 160 ----------WTSSATGMERYREWHSVPEEVINSLTPF 187

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 58/136 (42%), Gaps = 48/136 (35%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           DF  LPK P+T +L+ R+++  +LYSGYRP                     +L S E+  
Sbjct: 81  DFSWLPKAPSTDHLKHRDVSTTLLYSGYRP--------------------FVLNSSEQKQ 120

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
           T++   E                         +        + LP   W +S+ G E++ 
Sbjct: 121 TDSTLYE-------------------------FAMKLEALGDPLP---WISSATGTEFYG 152

Query: 181 EWKNVPSYMMRKLKPF 196
           EW N+P+ +++KL+PF
Sbjct: 153 EWDNIPADVIKKLRPF 168

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 54/139 (38%), Gaps = 41/139 (29%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKP 119
            +F  LPK+     L  ++++  +LYSGYRP+  P   N  F+  +K +   L       
Sbjct: 89  LNFSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQGQKNNGSTLYE----- 140

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
               K  E  + KN                                   W TS+ G+E F
Sbjct: 141 -FAMKLDEFKKDKNSTI--------------------------------WDTSATGVETF 167

Query: 180 PEWKNVPSYMMRKLKPFDR 198
            EW NVP  ++R LKPF +
Sbjct: 168 TEWDNVPESVIRNLKPFQK 186

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 46  SKQRNSKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 92
           SK+R           D+  LPK P+T++L+ RE++ D+ YSGYRP+ 
Sbjct: 64  SKKRTQVELSGKKRHDYSWLPKAPSTEHLKLREISTDVFYSGYRPIF 110

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (78%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ G E++ EW NVP+ +++KLKPF
Sbjct: 139 WVSSATGTEFYGEWDNVPTEVIKKLKPF 166

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 25/157 (15%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLAS--------- 115
           LP+VP+T+ +   E+  D L++GYRP+   +   P+   +K   L   LAS         
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF--LGNCPIDDAEKGSELDRFLASFSDLKLLNN 131

Query: 116 DEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMG 175
           ++  + E K  +  E  ++    R       G  + T K  P VP        W  S  G
Sbjct: 132 EDSDSKEVKIEDILE--DIQNDIRNATNEDIGDNSRTRK--PVVP--------WDASISG 179

Query: 176 MEYFPE-WKNVPSYMMRKLKPFDRALQLQAKHSSNKK 211
           + Y    +KN+P+ ++ KLKPF + +  + K  SNK+
Sbjct: 180 LIYNDRPFKNIPNEVVSKLKPF-KLIVFERKIESNKQ 215

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPATEAK 124
           +P+VP T Y+ A E+  + L++GYRP+   +  +P+        L     S        +
Sbjct: 58  VPRVPPTDYISAPEIQTEGLFAGYRPLF--LGNSPINDKNGSTPLDNFFTSFANLKVVEE 115

Query: 125 ATEKSEHKNVFFGERGTGGIMSGGVNGTWKYN--PTVPNELLPYNWWSTSSMGMEYFPE- 181
           +    E       E    GI SG ++ +   N  P +P        W  S  GM Y  + 
Sbjct: 116 SEVVGEVNVQEVIEDLRRGIPSGQMSNSKGKNRKPIIP--------WDASISGMVYNDDP 167

Query: 182 WKNVPSYMMRKLKPFDRALQLQAKHSSNKKK 212
           +K+VP+ ++ KLKPF + ++L+ K   N K+
Sbjct: 168 FKHVPNNVVSKLKPF-KMVRLEKKSDKNVKQ 197

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 43  QQISKQRNSKLFKNAHF-FDFRSLPKVPTTQYLEARELTRDILYSGYRP-VMYPVKE 97
           +Q SK+R +   K      DF  LPK P+T +L+ R+++  +LYSGYRP V+ P  +
Sbjct: 62  EQSSKKRVAVELKGKQLKTDFSWLPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPADQ 118

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ G E++ EW  VP+ ++++L+PF
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPF 168

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 64/135 (47%), Gaps = 13/135 (9%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLAS--DEKPATE 122
           LP+VP+T Y+   E+  + L++GYRP+   +  + L  + +  +L     S  + K  +E
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF--LGNSSLRPETRTNALDNFFTSFANLKVTSE 132

Query: 123 AKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPE- 181
           +K + + E ++V    +     ++   +      P +P        W  S  GM Y    
Sbjct: 133 SKNSAEEEVQDVIEELKRDSAQLNLKNSKGKNRKPIIP--------WDASISGMVYNDHS 184

Query: 182 WKNVPSYMMRKLKPF 196
           +K+VP  ++ KLKPF
Sbjct: 185 FKDVPKSVVSKLKPF 199

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 55/137 (40%), Gaps = 46/137 (33%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKP 119
           +D+ +LP+V      + + ++ ++LYSGYRP         LF D + K+ Q         
Sbjct: 111 YDYSTLPRVEQISDTKLKNMSTEVLYSGYRP---------LFFDVEPKNSQ--------- 152

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
             E K   +   K   F E                        + P   W +S+ G E +
Sbjct: 153 --EGKTLYEFAMKLEEFQE-----------------------AMSP---WVSSATGSEMY 184

Query: 180 PEWKNVPSYMMRKLKPF 196
            EW NVP  +++ LKPF
Sbjct: 185 AEWDNVPGDVIKDLKPF 201

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
            D+  LPKVPT + L+ R++  ++LYSGYRP+
Sbjct: 162 IDYSWLPKVPTLKNLKQRDVMTNVLYSGYRPL 193

 Score = 35.0 bits (79), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 3/35 (8%)

Query: 162 ELLPYNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           E+ P   W +S+ G+E + EW ++P  +++KLKP 
Sbjct: 231 EIFP---WMSSAAGLEVYSEWDSIPIEVLKKLKPL 262

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 12/148 (8%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPATEAK 124
           +P+VP+T YL   +L  + L++GY+P+   +  +PL  +     L  L +S  K      
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPLESNNNDVLLDGLFSSIRKLKN--- 144

Query: 125 ATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPE-WK 183
           A   SE+  V   E     ++        +Y     +E  P   W  S  G+ Y  E +K
Sbjct: 145 AQINSENNTV---EIDVSDMLDDLKKDNQEYQRL--HEKAPKIPWDASISGLVYNDEPFK 199

Query: 184 NVPSYMMRKLKPFDRALQLQAKHSSNKK 211
            VP  ++ KLKPF + ++++ K+S +K+
Sbjct: 200 GVPRSVVSKLKPF-KLVRVEKKNSKDKE 226

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 50/136 (36%), Gaps = 48/136 (35%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
           D+   P  P T++L+  ++  D+LYSGYRP+    + +P     K   L M L + E P 
Sbjct: 85  DYSWFPVAPKTEHLKEGDIAVDLLYSGYRPLSLR-RADPKEAQSKIYELAMRLEAVEDP- 142

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
                                                      LP   W  ++ G   + 
Sbjct: 143 -------------------------------------------LP---WVKNATGRVLYD 156

Query: 181 EWKNVPSYMMRKLKPF 196
           EW NVP  ++R L+P+
Sbjct: 157 EWDNVPQSVIRNLRPY 172

>CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|P48564 Saccharomyces
           cerevisiae YNL295w
          Length = 493

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 64/140 (45%), Gaps = 29/140 (20%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPV----MYPVKENPLFRDKK---KKSLQMLLASDE 117
           +P V +T +L  +E+  + L++G +P+    +  +K  P F D      K+ +++ ASD+
Sbjct: 94  VPSVSSTDHLTDQEIHLEGLFAGSKPLFLGKLASMKSMPSFFDNGVLLSKNFRVINASDD 153

Query: 118 KPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGME 177
                              GE+     +    +  W  + +   +++P   W  S  G+E
Sbjct: 154 G------------------GEKSLDEFLESVKDNDWNIDNSEQKKVIP---WQASISGIE 192

Query: 178 YFPE-WKNVPSYMMRKLKPF 196
           Y  + + N+P +++ KL+P+
Sbjct: 193 YEDKSFSNIPKHVLSKLRPY 212

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 31/192 (16%)

Query: 35  VNPVRQQHQQISKQRNS--KLF-KNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
           V+ ++Q +Q +     S  K+F  N H      +PKV +T+Y+  +E+  + L++GYRP+
Sbjct: 82  VSALQQMNQSVDNVGTSRPKMFGSNLHLL----VPKVASTEYIPIKEVHTEGLFAGYRPL 137

Query: 92  MYPVKENPLFRDKKKKSLQMLLASDEKPATEA-KATEKS---EHKNVFFGERGTGGIMSG 147
                 N  F    +K        D  P  +   A+EK    + + +    + T  I + 
Sbjct: 138 FLG---NSSFSSDMRKGKNFHALDDGLPNIQVIDASEKDGKLDVQEIIEDLQKTSLIENV 194

Query: 148 G----VNGTWKYNPTVPNELLPYNWWSTSSMGMEY--FPEWKNVPSYMMRKLKPFDRALQ 201
                 + + K  P +P        W  S  GM Y   P +K VP  ++ K+KPF + ++
Sbjct: 195 SDKEQFSSSHKRKPVIP--------WDASISGMVYNDMP-FKYVPKNVISKMKPF-KLMR 244

Query: 202 LQAK-HSSNKKK 212
           ++ K H+ N KK
Sbjct: 245 IERKSHAKNSKK 256

>NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa]
           {ON} Anc_3.62 YNL295W
          Length = 490

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 64/150 (42%), Gaps = 26/150 (17%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMY---PVKENPLFRDK--------KKKSLQMLL 113
           +P+V  T ++   E+  + L++GY+P+      +     F D         +   L++L 
Sbjct: 67  VPRVGETDHIPVNEVQTEGLFAGYKPLFLGNSSISTQNRFYDNELHLKLLPQLSDLKLLG 126

Query: 114 ASDEKPATEAKATEK--SEHKNV--FFGERGTGGIMSGGVN--GTWKYNPTVPNELLPYN 167
           A+ E   TE+ +     S+  N+     E     I S  +N  G     PT+P       
Sbjct: 127 ANAENFITESSSLHDTLSQKNNIQDIIEELKNATIHSQDINSDGEGITKPTIP------- 179

Query: 168 WWSTSSMGMEYFPE-WKNVPSYMMRKLKPF 196
            W  S  GM Y    +K VP+ ++ KLKPF
Sbjct: 180 -WDASISGMLYKDRPFKAVPNSVVTKLKPF 208

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 15/139 (10%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPATEAK 124
           +P+V +T+ + + E+  D L++GYRP+   + E+ + R +K   L     S E   T  +
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPLF--LGESSIKRRRKASPLDKFFHSVE-THTRNR 146

Query: 125 ATEKSEH------KNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEY 178
            + KS         N+          +    +   K  P  P  ++P   W  S  G+ Y
Sbjct: 147 ESGKSTLGIQDIIDNLRKDHEEENLEIEEHSDKNTKVEPRKP--VIP---WDASVSGIFY 201

Query: 179 FPE-WKNVPSYMMRKLKPF 196
             + +KNVP ++M KLKP+
Sbjct: 202 KDQSFKNVPKHVMNKLKPY 220

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 52/137 (37%), Gaps = 51/137 (37%)

Query: 60  FDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKP 119
           + + +LP+VP+T  ++ ++L  ++L+S YRP                  L M L SD   
Sbjct: 86  YKYSALPRVPSTSNMDRKQLNTELLFSAYRP------------------LSMDLKSDSST 127

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
             E                     +M+             P++    + W      +   
Sbjct: 128 MYEF--------------------LMA-------------PDQSTTSSPWGRPFSRLHDH 154

Query: 180 PEWKNVPSYMMRKLKPF 196
             W+NVPS+ +RKLKPF
Sbjct: 155 RAWRNVPSHTVRKLKPF 171

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 35.4 bits (80), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 62/149 (41%), Gaps = 16/149 (10%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPATEAK 124
           +P VP T Y+   E+  + L++GY+P+      N    +K+   L  L  S  K      
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLFL---GNSSLDEKRADVLDGLFTSLTKIKKGTS 217

Query: 125 ATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEY--FPEW 182
           A     +      +      M      + K  P +P        W  S  GM Y   P +
Sbjct: 218 APNGEINVQEILDDLQKDDTMETLKEKSHK-KPVIP--------WDASISGMVYNDLP-F 267

Query: 183 KNVPSYMMRKLKPFDRALQLQAKHSSNKK 211
           K+VP  ++ KLKPF + L+++ ++  + K
Sbjct: 268 KDVPRNVVGKLKPF-KLLRIERRNKKDGK 295

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 24/159 (15%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVM-----YP--VKENPLFRDKKK--KSLQMLLAS 115
           +PKV +T ++  +E+  + L++GYRP+      +P  V++   F D  +   ++Q++ AS
Sbjct: 112 VPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLPNIQLVDAS 171

Query: 116 DEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMG 175
           ++      +   +   +      R +   M    + + K  P +P        W  S  G
Sbjct: 172 EKDGKLNVQEIIEDLQRTSL---RESISNMEQS-SSSHKRRPVIP--------WDASISG 219

Query: 176 MEY--FPEWKNVPSYMMRKLKPFDRALQLQAKHSSNKKK 212
           M Y   P +K++P  ++ KLKPF      +  +S N KK
Sbjct: 220 MVYNDMP-FKHIPKNVVSKLKPFKLVRVERKSNSKNGKK 257

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 24/143 (16%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK---------SLQMLLAS 115
           +PKV +T +++ +E+  + L++GYRP+       P    K K          ++Q++ AS
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFPSDARKGKNFHELGDVLPNIQVIDAS 170

Query: 116 DEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMG 175
           ++      +   +  HK+     R +   M    + + K  P +P        W  S  G
Sbjct: 171 EKDGKLNMQEIIEDLHKSSL---RDSIHNMEQH-SSSHKRKPVIP--------WDASISG 218

Query: 176 MEY--FPEWKNVPSYMMRKLKPF 196
           M Y   P +K+VP  ++ ++KPF
Sbjct: 219 MVYNDMP-FKHVPKSVVLRMKPF 240

>KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 476

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 71/148 (47%), Gaps = 17/148 (11%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLAS--DEKPATE 122
           +PKV +T +++  E+  + L++G +P+   + E  L   +   +L  +  +    K AT+
Sbjct: 86  VPKVHSTDHIKQDEIHTEGLFAGNKPLF--LGELSLSFKRPSGALDGIFGTLTKIKRATD 143

Query: 123 AKATEKSEHKNVFFG-ERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPE 181
               ++ + + +    + G   I SG  +   +  P +P        W  S  GM Y  +
Sbjct: 144 DGGDQEIDVQGIINDLQTGDKDISSGEKSAAKR--PVIP--------WDASISGMVYNDQ 193

Query: 182 -WKNVPSYMMRKLKPFDRALQLQAKHSS 208
            +K VP  ++ KLKPF + L+++ K+ S
Sbjct: 194 PFKQVPRGVVNKLKPF-KLLKIERKNKS 220

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPV-----MYPVKE 97
           +PKVPTT Y+ + E+  + L++GY+P+     + PVK+
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKK 107

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 32.3 bits (72), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 57/138 (41%), Gaps = 15/138 (10%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLAS-----DEKP 119
           +PKV +T  L + E+  + L++GYRP+   +  + L  + K   L     S        P
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLF--LGNSSLETNSKLDVLDNFFTSFANLKVSAP 146

Query: 120 ATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYF 179
            +E  +    + K+V          +  G+    + +        P   W  S  GM Y 
Sbjct: 147 ESETDSYNSGQIKDVI-------DDLQNGLESEQEQSSLTRENRKPIIPWDASIGGMVYS 199

Query: 180 PE-WKNVPSYMMRKLKPF 196
            + +K++P  ++ KL PF
Sbjct: 200 DKAFKDLPKSVVSKLSPF 217

>TDEL0F01590 Chr6 complement(291940..293478) [1539 bp, 512 aa] {ON}
           Anc_4.38 YLR314C
          Length = 512

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 10/86 (11%)

Query: 56  NAHFFDFRSLPKVPTTQYLEA-RELTRDILYSGYRPV----MYPVKENPLFRDKKKKSLQ 110
           NA+  D  +L  +  +QYLE  RE T ++LY  YR      +   ++N +F++   +S Q
Sbjct: 366 NANHCDLVNLRDLLISQYLEELRERTSNVLYENYRSEKLSKLGIKQDNSVFKEFDPESRQ 425

Query: 111 MLLASDEKPATEAK-ATEKSEHKNVF 135
                +EK   EAK A  ++E K+VF
Sbjct: 426 ----KEEKQLHEAKLAKLEAEMKSVF 447

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSG--YRPVM 92
           +  LP +P T YL A+ L +DI+ SG  Y P+ 
Sbjct: 273 YNHLPSLPDTLYLNAKNLGQDIISSGPLYSPIF 305

>CAGL0M10725g Chr13 (1071524..1072495) [972 bp, 323 aa] {ON} similar
           to uniprot|P53727 Saccharomyces cerevisiae YNR027w
          Length = 323

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%)

Query: 3   LLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFFDF 62
           LLR  E   LS A  +S  +  SV +RT  + +     + Q     ++ KL +    F  
Sbjct: 247 LLRDRESTKLSQAVAKSQWMIGSVLQRTYEQALKSGELKDQDSPVIKDLKLIQCRELFRL 306

Query: 63  RSLPKVPTTQYL 74
             +P++P T ++
Sbjct: 307 HDIPEIPITGHI 318

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 71/153 (46%), Gaps = 19/153 (12%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPV----MYPVKENPLFRDKKKKSLQMLLASDEKPA 120
            PKV +T +L+  E+  + L++G +P+    + P  + P        +L+ +  +  K  
Sbjct: 80  FPKVHSTDHLKQDEVHTEGLFAGNKPLFLGDLSPGPKRP------NNALEGIFGTLTKIK 133

Query: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180
              +ATE S+ + +   +     + S       K +      ++P   W  S  GM Y  
Sbjct: 134 ---RATEDSKGQEINI-QSILKDLQSEDPEVPAKDSDIAEKAVIP---WDASISGMVYND 186

Query: 181 E-WKNVPSYMMRKLKPFDRALQLQAKHSSNKKK 212
           E +K+VP  ++ KLKPF +  +++ K ++  KK
Sbjct: 187 EPFKHVPRAVVSKLKPF-KLFRIERKSTAGSKK 218

>KAFR0I01370 Chr9 complement(282658..284283) [1626 bp, 541 aa] {ON}
           Anc_4.38 YLR314C
          Length = 541

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (52%), Gaps = 10/87 (11%)

Query: 55  KNAHFFDFRSLPKVPTTQYLEA-RELTRDILYSGYRP---VMYPVK-ENPLFRDKKKKSL 109
           +N++  DF  L  +   QYLE  RE T ++LY  YR    +   +K +N +F++      
Sbjct: 393 ENSNHSDFTLLRDLLIKQYLEELRERTANVLYENYRSEKLIKLGIKQDNSVFKEFDPNMR 452

Query: 110 QMLLASDEKPATEAKATE-KSEHKNVF 135
           Q     +E+   EAK T+ ++E KNVF
Sbjct: 453 Q----EEERKLHEAKLTKLEAEMKNVF 475

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 19  STMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFFDFRSLPKVPTTQYLEAR- 77
           ST + AS  +  L  L+  +RQ+  Q+S++ NS   +N   +DF+   ++   Q +    
Sbjct: 3   STTVTAS--QSKLNDLLEAIRQEFAQVSQEANSYRLQNQKDYDFKINQQLAEMQQIRNTV 60

Query: 78  ---ELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120
              ELT   +   Y   +  +K   L  +++ + L  L A+ ++PA
Sbjct: 61  YELELTHRKMKDAYEEEINRLK---LELEQRDRQLASLAAAQQQPA 103

>TBLA0B06470 Chr2 complement(1526025..1527347) [1323 bp, 440 aa]
           {ON} Anc_2.513 YHR001W
          Length = 440

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 7/58 (12%)

Query: 74  LEARELTRDILYSGY-----RPVMYPVKENPLFRDKK--KKSLQMLLASDEKPATEAK 124
           L A+   +++ YS +     +P ++P+KE   +  +K  K+ +Q L  SD++ ATE K
Sbjct: 292 LRAKNAKKNVFYSTHTDKPLKPKVHPLKEQDEYESRKLWKEVVQALANSDQETATEEK 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,423,177
Number of extensions: 956410
Number of successful extensions: 3199
Number of sequences better than 10.0: 78
Number of HSP's gapped: 3230
Number of HSP's successfully gapped: 100
Length of query: 212
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 107
Effective length of database: 41,441,469
Effective search space: 4434237183
Effective search space used: 4434237183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)