Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4783.493ON1661667791e-107
Skud_16.4443.493ON1731736822e-92
Smik_16.4023.493ON1731736683e-90
YPR149W (NCE102)3.493ON1731736667e-90
CAGL0L08448g3.493ON1731735113e-66
CAGL0I10494g3.493ON1721745052e-65
NDAI0B058803.493ON1821824983e-64
KAFR0C019703.493ON1791794792e-61
NDAI0G009303.493ON1761764714e-60
NCAS0E008003.493ON1741744714e-60
TDEL0D056103.493ON1751754611e-58
YGR131W (FHN1)3.493ON1741744559e-58
KNAG0B008003.493ON1821824377e-55
KNAG0A079503.493ON1821824324e-54
Suva_7.4193.493ON1741744175e-52
Skud_7.4423.493ON1741744099e-51
Smik_6.2273.493ON1741744072e-50
KLLA0D16280g3.493ON1691734062e-50
SAKL0F02750g3.493ON1701734037e-50
KLTH0F14850g3.493ON1711743951e-48
Kpol_1017.63.493ON1871873933e-48
TPHA0D032803.493ON1841843891e-47
ZYRO0D09966g3.493ON1781783812e-46
KAFR0G037003.493ON1861773752e-45
NCAS0F035603.493ON1831833716e-45
TBLA0D029603.493ON1891733561e-42
Kwal_55.212383.493ON1701733514e-42
TBLA0C044903.493ON1861683524e-42
Ecym_12363.493ON1691733054e-35
AFR312W3.493ON1681732506e-27
Smik_10.1941.343ON84285672.6
KNAG0B038505.502ON55657654.0
Skud_15.3255.502ON54084654.4
TDEL0H00180singletonON25732628.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.478
         (166 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   304   e-107
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   267   2e-92
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   261   3e-90
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   261   7e-90
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   201   3e-66
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   199   2e-65
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   196   3e-64
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   189   2e-61
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   186   4e-60
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   186   4e-60
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   182   1e-58
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   179   9e-58
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   172   7e-55
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   171   4e-54
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   165   5e-52
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   162   9e-51
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   161   2e-50
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   160   2e-50
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   159   7e-50
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   156   1e-48
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   155   3e-48
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   154   1e-47
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   151   2e-46
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   149   2e-45
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   147   6e-45
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   141   1e-42
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   139   4e-42
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   140   4e-42
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   122   4e-35
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   100   6e-27
Smik_10.194 Chr10 complement(341089..343617) [2529 bp, 842 aa] {...    30   2.6  
KNAG0B03850 Chr2 complement(737681..739351) [1671 bp, 556 aa] {O...    30   4.0  
Skud_15.325 Chr15 complement(585740..587362) [1623 bp, 540 aa] {...    30   4.4  
TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON}                  28   8.2  

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  304 bits (779), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 152/166 (91%), Positives = 152/166 (91%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           MLAPVDNILRIINF              NTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTAIRAHSCRNQTYLASNSITQGSGNRCREAQAAVAFL 120
           FFEPLAWPLILFSLDFLNFVFTFTAIRAHSCRNQTYLASNSITQGSGNRCREAQAAVAFL
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTAIRAHSCRNQTYLASNSITQGSGNRCREAQAAVAFL 120

Query: 121 YFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           YFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 YFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  267 bits (682), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 142/173 (82%), Gaps = 7/173 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           MLAP DNILRIINF              NTQ  NSSR+N+CMFA AY I TDSLYGVFAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           FFEPLAWPL+LF+LDFLNFVFTFTA       IRAHSC N++Y+ SN ITQGSG RCR+A
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  261 bits (668), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 131/173 (75%), Positives = 139/173 (80%), Gaps = 7/173 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           MLA  DNILRIINF              NTQ  +SSR+NYCMFA AY I TDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F EPLAWPL+LF+LDFLNFVFTFTA       IRAHSC N +Y+ SN ITQGSG RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QAAVAFLYFSCAIFLAKTLMS+FNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  261 bits (666), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 139/173 (80%), Gaps = 7/173 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           MLA  DNILRIINF              NTQ  +SSR+NYCMFA AY I TDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F EPLAWPL+LF+LDFLNFVFTFTA       IRAHSC N +Y+ SN ITQGSG RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  201 bits (511), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 102/173 (58%), Positives = 119/173 (68%), Gaps = 7/173 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           MLA  DN+LRI+NF               T+  +SSR+NYCMFA AY I TDSLYGVFAN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           FFE LAWPLILF+LDFLNF F  TA       IRAHSC N  Y  +N I QGS  RCRE+
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QAAVAF +FS AIFLAK +MS+ N+ SNGAFG+    +RR   +VGVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  199 bits (505), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 124/174 (71%), Gaps = 10/174 (5%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+  DN+LRI+N               NT+  +SSR+N+C+FA AY I TDSLYG+FAN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNS-ITQGSGNRCRE 112
           FFEPLAWPL+LF LDFLNFVFTFTA       IRAHSC N+ YL   + I QGSG RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 172

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  196 bits (498), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 109/182 (59%), Positives = 128/182 (70%), Gaps = 16/182 (8%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+ VDNILR+IN               NTQ  NSSRIN+CMFA A+ ++TDS +GV  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FFEPLA-WPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
            F+ LA WP++LF  DFLNFVFTFTA       IRAHSC+N+ Y+ SNSITQGS NRCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----SKRR--RTG--QVGVPTIS 164
           +QAAVAF YFSC IFLAK +MS  NM SNG FGSG++    SKRR  R+G  +VGVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 165 QV 166
           QV
Sbjct: 181 QV 182

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  189 bits (479), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 102/179 (56%), Positives = 123/179 (68%), Gaps = 13/179 (7%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGN-SSRINYCMFAVAYAIVTDSLYGVFA 59
           ML   DNILR+IN               NTQ+G+ +SR+NYCMFA A+ +  DS+YG+ A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
           NFF+ LAWPL+LF+LDFLNF FTF+A       IRAHSC NQ+YL SN I +GSG RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS---FSKRRR--TGQVGVPTISQV 166
           AQA VAFLYFS AIF+AK +MS  N+  NGAF SGS    S+R++  T   GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  186 bits (471), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 118/176 (67%), Gaps = 10/176 (5%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+  DN+LR++N               NTQ G++SRINYCMF   Y ++TDS +G+ AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCREA 113
           FFE L++P ILF+LDFLNF FTF       T IR+HSC NQ+YL  N ITQGSGNRCRE+
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 166
           QA VAF YFS  IFL K  MS  +MI NGAF +   S+RRR     +VGVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  186 bits (471), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 116/174 (66%), Gaps = 8/174 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML   DN+LRI+N               NT++ N+SRINYCMF  AY + TDS+YG+FAN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCREA 113
           FF+ LA P + F LDFLNF FTF       T IRAHSC+++ Y+ SN ITQG  NRCRE+
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR-TGQVGVPTISQV 166
           QA VAF YFS AIFLAK +MS  NMI NGAF      +RRR   ++GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  182 bits (461), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 99/175 (56%), Positives = 124/175 (70%), Gaps = 9/175 (5%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           MLA VDN LR++NF              +++ G+SSR+N+CMFA A+ IVTDS YG+ AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
            +E  AWP+ILF+LDFLNF FTF+A       IR HSC+NQ YL SN+ITQGS  RCR A
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS--FSKRRRTGQVGVPTISQV 166
           QA+VAF YFS  IFLAK +MS+  +I+NG F S +   S+RR++ QVGVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  179 bits (455), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 90/174 (51%), Positives = 114/174 (65%), Gaps = 8/174 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+  DN++RIIN                TQ+ +SSR+N+CMFA  Y +VTDSLYG  AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F+  L +P IL  LDFLNF+FTF A       IR HSC+N+TYL  N I QGS +RC ++
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQVGVPTISQV 166
           QAAVAF YFSC +FL K  ++   M+ NG FGS + FS+RR   Q+G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  172 bits (437), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 94/182 (51%), Positives = 110/182 (60%), Gaps = 16/182 (8%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML   DN+LR++NF              NTQ  + SR+NYCMFA AY I TD LYG+ AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F+EPLAWPLILF+LDFLNF FT TA       IRAHSC+N  Y   N I QGS NRCR +
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS---------FSKRRRTGQVGVPTIS 164
           QAA AF +FS  IF+AK +MS  N+ SNGAF + S                   GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 165 QV 166
           QV
Sbjct: 181 QV 182

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  171 bits (432), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 119/182 (65%), Gaps = 16/182 (8%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           MLA  D  LR++NF              NTQ G+SSRINYCMF  AY I TDS YGV AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F+EPL+WPL+L +LDFLNFVFT TA       IRAHSC+N  Y   N I QGS NRCR+A
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-------FSKRRRTGQV--GVPTIS 164
           QAAVAF +FS AIFLAK +MS+ N+ +NG FGS         FSKR+RT  V  GVP IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 165 QV 166
            V
Sbjct: 181 TV 182

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  165 bits (417), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 117/174 (67%), Gaps = 8/174 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+  DNI+RIIN               ++Q+ +SSR+N+CMFA AY ++TDS YG  AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
            +  L +P+I+F LDFLNF+FTF A       IR HSC N+TYL +N ITQGSG+RC +A
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 166
           +AAV F YFSC +FL K ++S+  M+ NG FG G+   RRR   Q+G+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  162 bits (409), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 113/174 (64%), Gaps = 8/174 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+  DN++RI++                TQ+  SSR+N+CMFA AY ++TDS YG  AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCREA 113
           F+  L +P IL  LDFLNF+FTF         IR HSC+N+TYL  N+ITQGS +RC ++
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG-SGSFSKRRRTGQVGVPTISQV 166
           QAAVAF YFSC +FL K  +SV  M+ NG FG +  + +RR   Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  161 bits (407), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 111/174 (63%), Gaps = 8/174 (4%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+  DN++RIIN               +TQ+ +SSR+N+CMF  AY +VTDSLYG  AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F+  L +P IL +LD LNF+FTF A       IR HSC+N+TYL  N ITQ S +RC ++
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 166
           QAAVAF YFSC +FL K  ++    I NG FG  S   RRR   Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  160 bits (406), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 113/173 (65%), Gaps = 11/173 (6%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+ +DN LR +NF               TQ  +SSR+N+ +FA  + IV DSLY + AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F   LAWP+IL SLDFLN+VFTF+A       IR  SC N ++ + N I +GS +RCR+A
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QA+  FLYFS AIFL K ++S+ N I++GAFG+   S  R+T QVGVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGT---SSNRKT-QVGVPTISQV 169

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  159 bits (403), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 118/173 (68%), Gaps = 10/173 (5%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+ +DN LR++NF               TQ  +S R+N+ +F  A+A+VTDS Y VFAN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
            F   AWP++L + DFLNFVFTF+A       IR HSC N++YL SN+ITQGS +RCR+A
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QA VAFLYFS  IFL K ++SV N+ S+GAFGSGS S+R     VGVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRR---ANVGVPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  156 bits (395), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (66%), Gaps = 11/174 (6%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNT-QSGNSSRINYCMFAVAYAIVTDSLYGVFA 59
           ML+ +DN LR +NF               T ++ N+ ++N+ +F  A+ ++ DSLY + A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
           NF   LAWPL++   DFLNFVFTF A       IR HSC NQ YL SN++TQGS +RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           AQA+VAFLYFS  IFLAK  +S+ N+IS GAFG+GS    RRTG VGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS---SRRTGNVGVPTISQV 171

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  155 bits (393), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 116/187 (62%), Gaps = 21/187 (11%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+  DNI+R INF               T+ G+SSR+NYCMF   +A+VTDS YG+ AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FFE-PLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
            +  P AWP+ILF+ DFLNF FTFTA       IR HSC+N+ Y+ +N I QGS +RCR+
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG--SGSFSKRRR-----------TGQVG 159
           AQA++AF YFS  IF  K +MS  N++SNGA G  + S  +RR            + QVG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 160 VPTISQV 166
           VP ISQV
Sbjct: 181 VPNISQV 187

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  154 bits (389), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 113/184 (61%), Gaps = 18/184 (9%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML   DNILR +NF               TQ+ +SSR+NYC+F   +A+VTD+ YG  AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FFE-PLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
            +  PLAWP+ILF  DFLNF FTFTA        R HSC NQ+YL SN+ITQGS +RCR+
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----------SKRRRTGQVGVPT 162
           AQAA AF YFS  IFLAK +MS  N+ +NGA GS SF               + Q+GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 163 ISQV 166
           ISQV
Sbjct: 181 ISQV 184

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  151 bits (381), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 115/178 (64%), Gaps = 12/178 (6%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQS-GNSSRINYCMFAVAYAIVTDSLYGVFA 59
           MLA  DNILR +NF               ++  G++SR+N+CMFA A+ IV DS YG+ A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
           N F P A+P+ILF LDFLNFVFTFTA       IR HSC N+ YL SN ITQGS +RCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGA----FGSGSFSKRRRTGQVGVPTISQV 166
           AQA VAF YF+  IFL K +MS  +++SNGA     G  S  +R +   VGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  149 bits (375), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/177 (52%), Positives = 112/177 (63%), Gaps = 13/177 (7%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSG-NSSRINYCMFAVAYAIVTDSLYGVFA 59
           MLA  DN LR++NF              NT+ G NS+R+NYCMFAVA+ I+TDS+YG+FA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
           NFFE LAWP+ILF  DFLNFVF FTA       IRAH+C N+ Y  SN I +GS  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNG-----AFGSGSFSKRRRTGQVGVPTIS 164
           AQAAVAF YFS AIFL K + S+   IS G     +       ++RR+   GVPT S
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTS 177

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  147 bits (371), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 116/183 (63%), Gaps = 17/183 (9%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+ VDN LR  N               +TQ+  SSR+NYCMFA A+ ++TDS +G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FFEPLA-WPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112
             + L+ WP+ILF  DFLNFVFTFTA       IR HSC N+ YL SN I QGSG RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---------TGQVGVPTI 163
           +QAAVAF YF+  +FLAK +MS  +M SNGAFGSGSF  RR+         T   GVPTI
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 164 SQV 166
           S+V
Sbjct: 181 SEV 183

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  141 bits (356), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 98/173 (56%), Gaps = 18/173 (10%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGN-SSRINYCMFAVAYAIVTDSLYGVFA 59
           ML   DN+ RI NF              NT+ G+ SSR+NYCMF  A+ +V+DS YG+ A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFF-EPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCR 111
           N   EP A+P ILF+ DFLNFVFTFTA       IR HSC N+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 112 EAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG---------SFSKRRRT 155
           EAQA +AF YFS  +FL K L+++    + G  G           SF +R RT
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRT 173

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  139 bits (351), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 108/173 (62%), Gaps = 10/173 (5%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+ +DN LR  NF               T+  N+ ++N+ +FA A+ ++ D+LY + AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F   LAWPL++   DFLNFVFTF A       IR HSC N  Y+ +N +TQGS +RCR+A
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QA+VAFLYF+  +FL K  +S+ N+ S GAF +   S  R++  VGVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFST---SSGRKSANVGVPTISQV 170

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  140 bits (352), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 99/168 (58%), Gaps = 14/168 (8%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQS-GNSSRINYCMFAVAYAIVTDSLYGVFA 59
           ML+   N+LRIINF               ++   +S R+NYCMFA  +A+VTDS Y + A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFFE-PLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCR 111
           NF+  P AWP++L+S DFLNF FTFTA       IR HSC N+ YL SN ITQGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 112 EAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAF-----GSGSFSKRRR 154
            AQA++AF YFS  I+L + + S   M  NG F     G  SF   RR
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  122 bits (305), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (59%), Gaps = 11/173 (6%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+ +DN LR  NF              N Q+ + SR+N+ +F   +A++ DSLY V AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCREA 113
           F   LAWP++L + D LN +FTF        AI  HSC N  +L  N I++G   RCR+ 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QA+  FL+FS  IFLAK ++S  N++S GAF SGS    R+TG  GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGS---GRKTGG-GVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  100 bits (250), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 99/173 (57%), Gaps = 12/173 (6%)

Query: 1   MLAPVDNILRIINFXXXXXXXXXXXXXXNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60
           ML+ +DN LR +NF              + Q  + SR+N+ +F   +A+VTDS Y + AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113
           F    AWP+I  +LD LN +FTF A       I AHSC N+ +L  N+I++ S +RCR+ 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166
           QA+  FL+FS  IFLAK + S  N+ S     SG+FS        GVPTISQV
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNIFS-----SGAFSSGGSKRGGGVPTISQV 168

>Smik_10.194 Chr10 complement(341089..343617) [2529 bp, 842 aa] {ON}
           YJL047C (REAL)
          Length = 842

 Score = 30.4 bits (67), Expect = 2.6,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 4/85 (4%)

Query: 46  AYAIVTDSLYGVFANFFEPLAWPLILFSLDFLNFVF----TFTAIRAHSCRNQTYLASNS 101
           A  I T SLY +F N   P    +I    +F NF      + T I+   C N+       
Sbjct: 20  ANTISTSSLYHLFNNEKNPKYQKMIAELHEFFNFTLSETISVTDIKELECDNEKVATFRR 79

Query: 102 ITQGSGNRCREAQAAVAFLYFSCAI 126
           I     N CRE      ++ F+  +
Sbjct: 80  IMPRMLNNCRELTQRKTYISFNLGL 104

>KNAG0B03850 Chr2 complement(737681..739351) [1671 bp, 556 aa] {ON}
           Anc_5.502 YOR161C
          Length = 556

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 106 SGNRCREAQ-AAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVP 161
           SG  C  A+   +  L F C  ++++ + +V +M  +G FGS  +  +   G    P
Sbjct: 285 SGGNCSHAKLIGILVLVFFCGYYISEVIRNVIHMTVSGVFGSWYYMFKSDQGMPKWP 341

>Skud_15.325 Chr15 complement(585740..587362) [1623 bp, 540 aa] {ON}
           YOR161C (REAL)
          Length = 540

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 79  FVFTFTAIRAHSCRNQTYLASNSITQGSGNRCREAQ-AAVAFLYFSCAIFLAKTLMSVFN 137
           F F F+A+   +       +SNS    SG  C  ++   V  + F C  ++++ + +V +
Sbjct: 242 FGFLFSAVIVATYVKYDPSSSNSGCDVSGGGCSHSKLIGVLVVVFFCGYYISEVIRNVIH 301

Query: 138 MISNGAFGSGSFSKRRRTGQVGVP 161
            + +G FGS  +  +   G    P
Sbjct: 302 CVISGVFGSWYYMSKSDQGMPRWP 325

>TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 108 NRCREAQAAVAFLYFSCAIFLAKTLMSVFNMI 139
           +RCREA+AA+A   F+  ++ A   + V N +
Sbjct: 122 SRCREAKAAIAMCAFNMVLYAASLTLLVLNCV 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,656,704
Number of extensions: 463392
Number of successful extensions: 1306
Number of sequences better than 10.0: 39
Number of HSP's gapped: 1264
Number of HSP's successfully gapped: 39
Length of query: 166
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 65
Effective length of database: 41,900,133
Effective search space: 2723508645
Effective search space used: 2723508645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)