Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4773.491ON42342314970.0
Skud_16.4433.491ON42029110701e-143
Smik_16.4013.491ON42729310521e-140
YPR148C3.491ON43529610211e-136
TDEL0D055903.491ON3442998351e-109
SAKL0F02794g3.491ON3972966972e-87
ZYRO0D10010g3.491ON3822766866e-86
KLTH0F14806g3.491ON3582966751e-84
Kwal_55.212273.491ON3762896561e-81
NDAI0B058503.491ON4732886604e-81
KLLA0E04621g3.491ON3892876326e-78
NCAS0F035403.491ON4442656245e-76
TBLA0D029803.491ON4433035836e-70
Ecym_12383.491ON3932905743e-69
Kpol_1017.73.491ON3782795525e-66
TPHA0D032703.491ON3882895133e-60
AFR309C3.491ON3642995053e-59
CAGL0L08492g3.491ON3852515054e-59
KAFR0G036803.491ON4152715006e-58
KNAG0A079303.491ON4522724685e-53
TDEL0H022407.221ON3382451983e-16
Kwal_47.181487.221ON3232481913e-15
KLTH0A03894g7.221ON3232311861e-14
Kpol_1070.197.221ON3112321735e-13
CAGL0L00891g7.221ON3412481736e-13
KNAG0D017607.221ON3422241737e-13
ZYRO0D16522g7.221ON3582591721e-12
NDAI0A026607.221ON3642461702e-12
KAFR0I019507.221ON3302301673e-12
SAKL0F08162g7.221ON3302481674e-12
Suva_9.1597.221ON3252481631e-11
KLLA0E04511g7.221ON3022291621e-11
TPHA0C012307.221ON3052341612e-11
NCAS0A133807.221ON3292461532e-10
Smik_9.1507.221ON3262511522e-10
YIL041W (GVP36)7.221ON3262481488e-10
Kpol_478.227.221ON3502341481e-09
Skud_9.1287.221ON3292481471e-09
TBLA0D042007.221ON3312281443e-09
Ecym_43777.221ON333611443e-09
ADL115W7.221ON333621417e-09
TPHA0B027507.221ON3632381382e-08
TBLA0B015807.221ON386601274e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.477
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   581   0.0  
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   416   e-143
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   409   e-140
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   397   e-136
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   326   e-109
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   273   2e-87
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   268   6e-86
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   264   1e-84
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   257   1e-81
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   258   4e-81
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   248   6e-78
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   244   5e-76
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   229   6e-70
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   225   3e-69
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   217   5e-66
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   202   3e-60
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   199   3e-59
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   199   4e-59
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   197   6e-58
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   184   5e-53
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    81   3e-16
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    78   3e-15
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    76   1e-14
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    71   5e-13
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    71   6e-13
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    71   7e-13
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    71   1e-12
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     70   2e-12
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    69   3e-12
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    69   4e-12
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    67   1e-11
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    67   1e-11
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    67   2e-11
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    64   2e-10
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    63   2e-10
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    62   8e-10
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    62   1e-09
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    61   1e-09
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    60   3e-09
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    60   3e-09
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    59   7e-09
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    58   2e-08
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    54   4e-07

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/423 (71%), Positives = 301/423 (71%)

Query: 1   MSGYWNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSDI 60
           MSGYWNKITDSIATAAHKTQDT             DPQTRLSIKSRTRFVQESLGTVSDI
Sbjct: 1   MSGYWNKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLGTVSDI 60

Query: 61  SKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGS 120
           SKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGS
Sbjct: 61  SKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGS 120

Query: 121 KKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXXXXXXX 180
           KKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQN                
Sbjct: 121 KKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEAKKTTQ 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKL 240
                                SNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKL
Sbjct: 181 ETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKL 240

Query: 241 INEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEXXXXXXXXXXTSXX 300
           INEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKE          TS  
Sbjct: 241 INEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDNSANSTSLE 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANDDIDTXXXXXXXXXXXXXXVXXXXXXX 360
                                          ANDDIDT              V       
Sbjct: 301 EALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQPTNNQPPVEDSEENK 360

Query: 361 XXXXXXXXFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNG 420
                   FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNG
Sbjct: 361 LLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNG 420

Query: 421 MEN 423
           MEN
Sbjct: 421 MEN 423

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  416 bits (1070), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 211/291 (72%), Positives = 229/291 (78%), Gaps = 9/291 (3%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MSGY+     NKITDSIATAAHKTQDT             DP+TRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
           TVSDISKLPPQYQFLEKKSDSLEKVC+RILLVSKTFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXX 175
           GWFGS+K+E+A+KKK SNHDD FLPRSFAQAISKAAVDCE EF++L+Q+           
Sbjct: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQD----EKAGLKK 176

Query: 176 XXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNK 235
                                     SNLIKVFDSWSTCYKNIDEGKAEMDS M+KEFNK
Sbjct: 177 KSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNK 236

Query: 236 KLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKE 286
           KLEKLIN+DFKKVHELR+KVE+SRLKFDTMRYE KSKE +L+AQK ETSKE
Sbjct: 237 KLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKE 287

 Score =  102 bits (254), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (90%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVSNTT AVE MEEITDSS+IL LVKLFQNFQLVYFRQC QEVEANLKVLN +EN
Sbjct: 366 FVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLEN 420

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  409 bits (1052), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 221/293 (75%), Gaps = 7/293 (2%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MSGY+     NKITDSIATAAHKT DT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
           T+SDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXX 175
           GWFGSKK+E  +KKK SNHDD FLPRSFAQAISKAAVDCE EF+NLE +           
Sbjct: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180

Query: 176 XXXXXXXXXXXXXXXXXXXXXXXXXX--SNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEF 233
                                       SNLIKVFDSWSTCYKNIDEGK EMDSMMVKEF
Sbjct: 181 TKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240

Query: 234 NKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKE 286
           NKKLEKLIN+DFK+VHELR+KVE SRLKFDTMRYE K+KE QL AQK   ++E
Sbjct: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEE 293

 Score =  107 bits (268), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 50/55 (90%), Positives = 52/55 (94%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVSNTTAAVETMEEI DSSEIL L+KLFQNFQLVYFRQC QEVEANLKVLNG+EN
Sbjct: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEN 427

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  397 bits (1021), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/296 (71%), Positives = 224/296 (75%), Gaps = 10/296 (3%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MSGY+     NKITDSIATAAHKTQDT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
           TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXX 175
           GWFGSKK+E ++KKK SNHDD FLPRSFAQAISKAAVDCE EF+NLE N           
Sbjct: 121 GWFGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKES 180

Query: 176 XXXXXXXXXXXXXXXXXXXXXXXXXX-----SNLIKVFDSWSTCYKNIDEGKAEMDSMMV 230
                                          SNLIKVFDSWSTCYKNIDEGKAEMDSMMV
Sbjct: 181 IKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240

Query: 231 KEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKE 286
           KEFNKKLE LIN+DFKKVH+LR+KVEESRLKFDTMRYE K+KE +L A+K E + E
Sbjct: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGE 296

 Score =  107 bits (267), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 50/54 (92%), Positives = 52/54 (96%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422
           FVSNTTAAVETMEEITDSSEIL L+KLFQNFQLVYFRQC QEVEANLKVLNG+E
Sbjct: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  326 bits (835), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/299 (58%), Positives = 201/299 (67%), Gaps = 45/299 (15%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MSGY      NKITD++A AAHKTQDT             DPQ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
           T+ D SKLPPQYQ LEKKSD+LEK CKRILLV++TFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116

Query: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXX 175
           GWFG+KK E  +K   S+  D FLPRSF+QAISKAA DC S F NL+++           
Sbjct: 117 GWFGTKKPEK-TKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEH----------- 164

Query: 176 XXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNK 235
                                     SN+ K+FDSWS CYKNIDEGK EMDSM+ KEFN 
Sbjct: 165 ----------------GDEDEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNT 208

Query: 236 KLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKE--------EQLRAQKDETSKE 286
           KLEK+INEDFKKVH  R+KVEESRLKFDT+RYE K KE        E   A KDET  E
Sbjct: 209 KLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLKETENAKKSTETDEASKDETKTE 267

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 48/55 (87%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVSNTTAAVE M E+T+S+EIL L KLFQNFQLVYFRQC QEVEA+LK+L  +E+
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALES 341

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  273 bits (697), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 147/296 (49%), Positives = 188/296 (63%), Gaps = 33/296 (11%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MSGY+     +K+T+SI++AAHKTQD              DPQ +LS+K R  ++QE+LG
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQD--KLSTAIANIQLDDPQAKLSLKVRKHYLQETLG 58

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
            + DISKLPPQYQFLEKK DSLEK+C+R+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118

Query: 116 GWF----GSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXX 171
           G      G K     +K ++ + ++ FLPRSFAQA+SKAA D     + L+         
Sbjct: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDE------- 171

Query: 172 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVK 231
                                         ++LI +F++WS C + ID+ KAEMDS+M K
Sbjct: 172 --------------QKEPPQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAK 217

Query: 232 EFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKE-EQLRAQKDETSKE 286
           EFNKKL+KLINEDFKKVH LR+KVEESRLKFDT+RYE   KE EQ +A+  E   E
Sbjct: 218 EFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENE 273

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/55 (70%), Positives = 47/55 (85%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVS+TT AVE M EITDSSEILSLVKLF  FQL+Y RQC QE+EA+ K+L+G++N
Sbjct: 342 FVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDN 396

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  268 bits (686), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 137/276 (49%), Positives = 177/276 (64%), Gaps = 36/276 (13%)

Query: 1   MSGYWN-----KITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MS Y++      + DSIA AAH+TQD              DPQTRLSIK+RTR+++E+LG
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQD--KLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 58

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
            V +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118

Query: 116 GWFGSKKTEHASKKK---DSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXX 172
           GWFGS K +   + K   D +  D  +PRSFAQAI+KA+ +C   ++N +++        
Sbjct: 119 GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDED 178

Query: 173 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKE 232
                                         NL+++F++ S CY+NIDEGK EMD  + +E
Sbjct: 179 EDDV--------------------------NLVEMFNTLSICYRNIDEGKDEMDKSIARE 212

Query: 233 FNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYE 268
           FN KLE+L+N DFKK+H LR KVE SRLKFDTMRYE
Sbjct: 213 FNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYE 248

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (81%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVSNT+ AVETM  I + SEIL L+KLFQN QLVY+RQC QE+EA+LK LN +EN
Sbjct: 328 FVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 382

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  264 bits (675), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 181/296 (61%), Gaps = 35/296 (11%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MS Y+     NK+T+SI   AHKTQDT             DPQ +LS+K+R  ++QE+LG
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
           T+ DISKLPPQYQFLEKK DSLEKVC+R+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 116 GWFGSKKTEHASKKKDSNHD--DTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXX 173
           G FG   +    KK +   D  +  +PRSFAQAISKAA D       L+           
Sbjct: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALK----------- 167

Query: 174 XXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEF 233
                                       ++LIK+F++WS C  N+D+ KAEMD++MVKEF
Sbjct: 168 -----------TEEQKASAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEF 216

Query: 234 NKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLR----AQKDETSK 285
           N KL   + E FK    LR+KVE+SRLKFDTMRYE K  EEQ +    AQ+ E+ K
Sbjct: 217 NHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQK 272

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/55 (63%), Positives = 45/55 (81%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVSNTT AVETM EITDS+EI++LVKLF NFQL+Y++QC Q +E ++  LN +E 
Sbjct: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEG 355

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  257 bits (656), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 173/289 (59%), Gaps = 45/289 (15%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MS Y+     NK+TD++  AAHKTQDT             DPQ  LS+K+R  ++QE+LG
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
           T+ DISKLPPQYQ LEKK DSLEK C+R+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 116 GWFGSKKTEHASKKKDSN------HDDTFLPRSFAQAISKAAVDCE---SEFKNLEQNXX 166
           G FG      +S KKD             +PRSFAQAI+KAA D     +  K+ EQ   
Sbjct: 119 GLFGL----MSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQ-- 172

Query: 167 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMD 226
                                              + LIK+F +WS C   ID+GKAEMD
Sbjct: 173 -----------------------ASADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMD 209

Query: 227 SMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQ 275
           ++M KEFN+KL  LI E FK    LRRKVE+SRLKFDTMRYE K  E+Q
Sbjct: 210 ALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQ 258

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/55 (70%), Positives = 46/55 (83%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVSNTT AVETM EITDS+E+L+LVKLF NFQLVY RQC Q++EA+L  LN +E 
Sbjct: 319 FVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEG 373

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  258 bits (660), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 143/288 (49%), Positives = 172/288 (59%), Gaps = 22/288 (7%)

Query: 6   NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSDISKLPP 65
           +KIT+SI  AA K  +T             DPQT+LSIKS+TR  QE LGT+ DISKLP 
Sbjct: 8   DKITNSIGNAAQKATNTLNNAINTAT----DPQTKLSIKSQTRLFQEQLGTIHDISKLPD 63

Query: 66  QYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKK--- 122
           QY+ LE K+DSLEK  KRILLVSKTFE+EGYDYPPNLTES SDWW++ K      KK   
Sbjct: 64  QYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKKQIS 123

Query: 123 -TEHASKKKDSNHDD--------------TFLPRSFAQAISKAAVDCESEFKNLEQNXXX 167
                    D++HD+              +FLPRSFAQAISK+A+DC   ++ L      
Sbjct: 124 VNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQETA 183

Query: 168 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDS 227
                                              NLIK F+SWS CYKNID+GK+EMDS
Sbjct: 184 TKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGKSEMDS 243

Query: 228 MMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQ 275
           MM KEFN KLE LIN +FKKV+ LR+KV +SRLKFDT+R+E K KEE+
Sbjct: 244 MMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEE 291

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVS+T +AVE M EIT+SS I+ L+KLFQNFQLVY+RQC QE+EANLK LN +++
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDH 472

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  248 bits (632), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 140/287 (48%), Positives = 174/287 (60%), Gaps = 9/287 (3%)

Query: 6   NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSDISKLPP 65
           N ITDSI+ AA +TQ+              DP+TRLSI  R   +QE+LGTV DIS+LP 
Sbjct: 8   NNITDSISNAAQRTQE--QFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDISQLPI 65

Query: 66  QYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG-SKKTE 124
           QY+FLE+KSD+LEK+CKR+LLV+KTFEVEGYDYPPNLTES +DWWS NKD  F  SKK  
Sbjct: 66  QYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSKKKA 125

Query: 125 HASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLE----QNXXXXXXXXXXXXXXXX 180
             S +     ++  LPRSFAQA+SKAA D     K L+    +                 
Sbjct: 126 EVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQKPAEE 185

Query: 181 XXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKL 240
                                 NLIK F+SW+ C  +ID+ KAEMDS+MVKEFN KL KL
Sbjct: 186 TKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNAKLSKL 245

Query: 241 INEDFKKVHELRRKVEESRLKFDTMRYEGKSK--EEQLRAQKDETSK 285
           I  DFKK HELR KV+++RL FDT+R+E K K  E+++ A  +E  K
Sbjct: 246 IETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEK 292

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 45/55 (81%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVS T+  VE + E+TDSSEI+SLVKLF NFQL++++QC + +E +L+VLN +++
Sbjct: 332 FVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDS 386

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  244 bits (624), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 165/265 (62%), Gaps = 26/265 (9%)

Query: 6   NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSDISKLPP 65
           +KIT+S+ATAA KT DT             DP T+LS++S+ R  QES+GTV DIS LP 
Sbjct: 8   DKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHDISTLPE 63

Query: 66  QYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKKTEH 125
           QY  LE ++D+LEK  +RIL+VSKTFE+EGYDYPPNL+ES SDWWSL+       +K + 
Sbjct: 64  QYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKKKKEQEKEDK 123

Query: 126 ASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXXXXXXXXXXXX 185
                       FLPRSFAQAIS +A DC   ++++                        
Sbjct: 124 KG----------FLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDEE 173

Query: 186 XXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKLINEDF 245
                            NLIK FDSW+ CYKNID+GKAEMDSMM+KEFN KLEKL+NE+F
Sbjct: 174 DEDVK------------NLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEF 221

Query: 246 KKVHELRRKVEESRLKFDTMRYEGK 270
           KKVH LR++V++SRLKFDT+RYE K
Sbjct: 222 KKVHTLRKRVKDSRLKFDTVRYELK 246

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/54 (77%), Positives = 48/54 (88%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422
           FVS+T +AVE MEEITDSSEI+ LVKLFQNFQLVY+RQC QE+EANLK LN +E
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  229 bits (583), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 175/303 (57%), Gaps = 33/303 (10%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 55
           MSGY+     +K+ DS+ +AA KTQDT             DPQTRL++ S+  ++QES+G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115
            +++ISKLP QY  LE+K+D+LEK+ KRIL+V+ TFE+EGYDYPPNL+ESIS+WW  +  
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145

Query: 116 GWFGSKKTEHASKKKDSNHDDT-----------FLPRSFAQAISKAAVDCESEFKNLEQN 164
            +       +   K +SN  DT           FLPRSF  AISKA+ D  +   NL  N
Sbjct: 146 AFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNN 205

Query: 165 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAE 224
                                                  LIKVFDSWS C KNID+ K +
Sbjct: 206 EKLEFAKTKTEDEEYEDDEDIQL----------------LIKVFDSWSLCNKNIDKSKFQ 249

Query: 225 MDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYE-GKSKEEQLRAQKDET 283
            D +++K+FNKKL  L++ +FK V  LR KV+++RLKFDTMRYE  K+ E ++RA++++ 
Sbjct: 250 RDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAEENDK 309

Query: 284 SKE 286
             E
Sbjct: 310 PVE 312

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (90%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGM 421
           FVS+T+AAVETMEEIT+SS+IL L+KLFQNFQL++++QC +EVE N+K+L  +
Sbjct: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  225 bits (574), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 132/290 (45%), Positives = 167/290 (57%), Gaps = 45/290 (15%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXX-----DPQTRLSIKSRTRFV 50
           MS Y+     +KI  +I TAAHKTQ                    DPQT LS+++R   +
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 51  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 110
           QE+LGT+ DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 111 --SLNKDG--W-FG-------SKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEF 158
             S  KDG  W FG       +K  + +S +K SN  + ++P SFAQAISKAA D  +  
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSN--EGYIPPSFAQAISKAADDSITIL 178

Query: 159 KNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNI 218
           K L +                                       +L+ + ++W+    NI
Sbjct: 179 KELNE---------------------EQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNI 217

Query: 219 DEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYE 268
           DE K +MD  M+ EFNKKL+ L+N DF KV  LR+KVEESRLKFDT+RYE
Sbjct: 218 DEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYE 267

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 41/53 (77%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGM 421
           FVSNTT AV  M +ITDS  + +LVKLF NFQL+Y ++C QE++A+L V+N +
Sbjct: 333 FVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  217 bits (552), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 125/279 (44%), Positives = 160/279 (57%), Gaps = 31/279 (11%)

Query: 1   MSGY-WNKITDSIATAAHKTQDTXXXXXXXXXXXX----XDPQTRLSIKSRTRFVQESLG 55
            SG+  +K+TDSI+  A KTQ+                  DP T+LSIKS+ RF+QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 56  TVSD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 114
           T++D  SKLPP Y  LE K+D++EK  KR+L V+KT+E EGYDYPPNLTES+SDWW+ N 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWT-ND 120

Query: 115 DGWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXX 174
           D    + + +   +   S     FLPRSFAQAIS A+ D  S   ++             
Sbjct: 121 DNVTNTDENDENIQSNKS-----FLPRSFAQAISNASFDAASNVNSV------------- 162

Query: 175 XXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFN 234
                                      S+L K+F+S   CY+NID GK EMD ++V EFN
Sbjct: 163 ------TNTIKLNHKDDEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFN 216

Query: 235 KKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKE 273
            KL+ LIN +FK VH+LR+ VE SRLKFDTMRYE K KE
Sbjct: 217 NKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKE 255

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 50/54 (92%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422
           FVSNT  AVE MEE+TD+S+I++LVKL+QNFQLVY++QC QE+E+NLK+LNG+E
Sbjct: 324 FVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  202 bits (513), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/289 (42%), Positives = 161/289 (55%), Gaps = 26/289 (8%)

Query: 6   NKITDSIATAAHKTQDTXXXXXX----XXXXXXXDPQTRLSIKSRTRFVQESLGTVSD-I 60
           +K+TDSI+  A KTQ+                  DP T+LSI++R+R++QE LGT+ D I
Sbjct: 8   DKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTLDDEI 67

Query: 61  SKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGS 120
           SKLP QY  LE K+DS+EK+ KR+LLV+ TF  EGYDYPPNLTESISDWW+         
Sbjct: 68  SKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--------- 118

Query: 121 KKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXXXXXXX 180
                   + ++  +  FLPRSFAQA++KA  D +      E+N                
Sbjct: 119 --------EDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKDEN 170

Query: 181 XXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKL 240
                                + L K F + S  + NID GK EMD+M+V EFNKKLE L
Sbjct: 171 PEAGAEEEVEADDDEEDEDLVT-LGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHL 229

Query: 241 INEDFKKVHELRRKVEESRLKFDTMRYEGKSKE---EQLRAQKDETSKE 286
           +  +FK+V +LRR VE SRLKFDTMRY+ K KE   EQ  A++  T KE
Sbjct: 230 LEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKE 278

 Score = 86.3 bits (212), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (88%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422
           FVSNT++AVE MEE+TDS++IL LVKLFQNFQLVY+RQC QE+E NLK ++ +E
Sbjct: 332 FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  199 bits (505), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 162/299 (54%), Gaps = 42/299 (14%)

Query: 1   MSGYW-----NKITDSIATAAHKTQDTXXXXXXXXXXXXX-----DPQTRLSIKSRTRFV 50
           MS Y+     +K+ +++  AA KTQ                    DP+T LS+K+R R +
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 51  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 110
           QE+LG+  DIS+LPPQY FLE+K D++E+VCK+IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 111 SLN-------KDGWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQ 163
           + +       K G  G+ K +   +K+ +   D   P SFA A+ +AA   +        
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSD---PPSFAHALHRAAKGSQG------- 170

Query: 164 NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKA 223
                                                  +LIK+F +W+    N+D  K 
Sbjct: 171 ---------------IIQELKEQAEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKR 215

Query: 224 EMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDE 282
           EMD  MVKEFN+KL+ L+  +FKK H LRRKVEESRL FDT++YE   ++  L  ++DE
Sbjct: 216 EMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDE 274

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (75%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422
           FVSNT  AVE M  I D+++++SLVKLFQNFQLVY R+C QE+E +L  L  +E
Sbjct: 308 FVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  199 bits (505), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 144/251 (57%), Gaps = 52/251 (20%)

Query: 36  DPQTRLSIKSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEG 95
           DP+T+LSIK++TRF+QE++G   DISKLPPQY  LEKK DS+EKV KRIL+V+KT+E+EG
Sbjct: 26  DPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEG 85

Query: 96  YDYPPNLTESISDWWSLNKDGWFG---------------SKKTEHASKK---KDSNHDDT 137
           YDYPPN++ES+S WW   +  WF                 K    ASK    K+ +H+  
Sbjct: 86  YDYPPNISESLSSWWQTKE--WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG- 142

Query: 138 FLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 197
             P SFA AI++A  D +  F+++E                                   
Sbjct: 143 --PPSFASAIARAGKDSQLIFESIE-----------------------------TKDEDE 171

Query: 198 XXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEE 257
                 L+K+F  WS C+  I + K EMD MM+KEFN KLE  + ++F+K+H LR KVEE
Sbjct: 172 KEDIDELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEE 231

Query: 258 SRLKFDTMRYE 268
           SRL FDTMRYE
Sbjct: 232 SRLNFDTMRYE 242

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423
           FVSNTT AVE M E++++SE+LSL+KLFQ FQL Y + C + +E +LK LN ++N
Sbjct: 331 FVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  197 bits (500), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 119/271 (43%), Positives = 157/271 (57%), Gaps = 33/271 (12%)

Query: 5   WNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSD--ISK 62
           ++KIT+SI+TAA   Q               D QT+L  K   RF QE +G + D  ISK
Sbjct: 7   FDKITNSISTAAQSAQ-----QKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEISK 61

Query: 63  LPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKK 122
           LP  Y  LE K D+LEK+ KR+L+V+KT+E+EGYDYPPNL+ES++DWW      W   KK
Sbjct: 62  LPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW------WSDLKK 115

Query: 123 TEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXXXXXXXXXXXXXX 182
           ++   +K       +F+  SF  AISKAA D +S   +L++                   
Sbjct: 116 SKKHQEK------SSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEEEVEEE 169

Query: 183 XXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKLIN 242
                               NL++VF+S S CYKNID+ KAEMD+M+VKEFN KLE LIN
Sbjct: 170 DDDEFL--------------NLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLIN 215

Query: 243 EDFKKVHELRRKVEESRLKFDTMRYEGKSKE 273
            DFKKV +LR KV++SRL+FDT+R+E K KE
Sbjct: 216 NDFKKVSKLRTKVQDSRLEFDTLRHEIKLKE 246

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 47/54 (87%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422
           FVSNT AAVE M E+T++SE+++LVKLFQNFQL++++QC QE+E N+K L+ +E
Sbjct: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  184 bits (468), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 151/272 (55%), Gaps = 25/272 (9%)

Query: 6   NKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSD--ISKL 63
           +K+T +I  AA   QDT             D QT+L     TR+ QE +GT+S+  I+KL
Sbjct: 8   DKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISEDEIAKL 62

Query: 64  PPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKKT 123
           P  YQ L++KS+++EKV KR+L+V+KTFE+EGYDYPPN+TES++ WW  N+D        
Sbjct: 63  PEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED-------- 112

Query: 124 EHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXXXXX--------XXXXX 175
           E+  KK     D + L RSFA AI KA +D +    +L++                    
Sbjct: 113 ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKREEEAEA 172

Query: 176 XXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNK 235
                                     +N+I  F  WS CYKNID+ KAEMDSM+VKEFN+
Sbjct: 173 AEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQ 232

Query: 236 KLEKLINEDFKKVHELRRKVEESRLKFDTMRY 267
           KL  ++  DFK VH+L  +V++SRL+FDT+R+
Sbjct: 233 KLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 47/54 (87%)

Query: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422
           FVSN TAAVE M E+TDSSE++SLVKLFQN QLV++RQC QE+EA++K L+ +E
Sbjct: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 111/245 (45%), Gaps = 47/245 (19%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ + +  L V+  +E E YDYP  +T
Sbjct: 38  QSTQRLVQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVT 97

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNH-----DDTFLPRSFAQAISKAAVDCESEF 158
           ES++D+   +K      ++  HAS   ++ +          PR+   A+SK ++   SE+
Sbjct: 98  ESVNDF---SKIVAHKVQELSHASSASEAQNILITPTPAKEPRTLNYALSKVSL-ISSEY 153

Query: 159 KNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNI 218
            N                                         + +  V   +S     +
Sbjct: 154 LN----------------------------------HIGDHDEAQVASVLLKYSDLQAKV 179

Query: 219 DEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR---YEGKS-KEE 274
            + + + D+M+   FNK+L+  +  +FKK  + R+ VE  RL++D  R    + K  KE 
Sbjct: 180 AQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVARSNLAQAKPEKEA 239

Query: 275 QLRAQ 279
            LR Q
Sbjct: 240 SLRVQ 244

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 109/248 (43%), Gaps = 53/248 (21%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R +QE LG V+DIS+LP  Y  LE K D ++ V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVR 116

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL--------PRSFAQAISKAAVDCE 155
           +S++++ S+      G+K  E  S+   +N   + L        P++   A+SK A+   
Sbjct: 117 DSVNEFSSI-----VGTKLHE-LSRATSTNEAQSVLISPGPHKDPKTLNYALSKVAL-TS 169

Query: 156 SEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCY 215
           SE+ N                                         S+L+K    +S   
Sbjct: 170 SEYLN------------------------------KSPGAEDSEVSSSLLK----YSDVQ 195

Query: 216 KNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYE----GKS 271
             I + +   D+++  +FNKKL   + +D  +  + R+ VE  RL++D  R         
Sbjct: 196 AKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIARANLANARPE 255

Query: 272 KEEQLRAQ 279
           KE  LR Q
Sbjct: 256 KEASLRVQ 263

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 99/231 (42%), Gaps = 49/231 (21%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE K D +  V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVR 116

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL--------PRSFAQAISKAAVDCE 155
           +S++++ S+       + K    S+   +N   + L        P++   A+SK A+   
Sbjct: 117 DSVNEFSSV------VAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNYALSKVAL-TS 169

Query: 156 SEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCY 215
           SE+ N                                         S +      +S   
Sbjct: 170 SEYLN----------------------------------KSVGGDDSEVSNALLKYSDVQ 195

Query: 216 KNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR 266
             + + + + D+++   FNKKL  ++  D  +  + R+ VE  RL++D  R
Sbjct: 196 AKVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIAR 246

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 103/232 (44%), Gaps = 53/232 (22%)

Query: 45  SRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTE 104
           S  R VQE LG V+DIS+LP +Y  LE++ D+++ V +  L ++  +E E YDYP  +++
Sbjct: 38  STQRLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSD 97

Query: 105 SISDWWSLNKDGWFGSKKTE--HASKKKDSNH-----DDTFLPRSFAQAISKAAVDCESE 157
           S++D+  +     F +K TE  HA+  +++ +          PR+   A+SK A++    
Sbjct: 98  SVNDFSKV-----FANKVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNSSES 152

Query: 158 FKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDS---WSTC 214
              L                                         N   V D+   +S  
Sbjct: 153 LAQL--------------------------------------ADPNEGPVADALLKFSDV 174

Query: 215 YKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR 266
              I + +   D+++  +FNK+L + +  D  K  + R+ V+  RL++D  R
Sbjct: 175 QAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVAR 226

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 110/248 (44%), Gaps = 52/248 (20%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ V +  L V+  +E E YDYP  ++
Sbjct: 38  QSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVS 97

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL--------PRSFAQAISKAAVDCE 155
           ES+++ +S N      + K +  SK   +      L        P++   A+SK A++  
Sbjct: 98  ESVNE-FSKNM-----AAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNA- 150

Query: 156 SEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCY 215
           SE+ N                                         + L KV  ++S   
Sbjct: 151 SEYLN---------------------------------HSFDDPMDAKLSKVLLNYSDVQ 177

Query: 216 KNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKS---- 271
             + + + + D+ +  +FNK + + + E   + ++ R+ V+  RL++D  R   ++    
Sbjct: 178 TKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPE 237

Query: 272 KEEQLRAQ 279
           KE  LR Q
Sbjct: 238 KEAGLRVQ 245

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 98/224 (43%), Gaps = 40/224 (17%)

Query: 48  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 107
           R VQE LG V+DIS+LP +Y  LEK+ D+L+ V +  L V+  +E E YDYP  + +S++
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVN 101

Query: 108 DWWSLNKDGWFGSKKTEHASKKKDSNH-----DDTFLPRSFAQAISKAAVDCESEFKNLE 162
           +W   ++       +  H S   ++ H          P++   A+SK A++      NL+
Sbjct: 102 EW---SRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLVDNLD 158

Query: 163 QNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGK 222
                                                  S L++    +S     + + +
Sbjct: 159 ----------------------------APRTPRETQLSSGLLE----FSGVEAELAQAR 186

Query: 223 AEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR 266
            E D+ +  +FN+KL   ++ +  +    R++V + RL++D  R
Sbjct: 187 LEQDAAVKAQFNEKLRGQLSGEIARAAAARKEVFQKRLQYDVAR 230

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 112/259 (43%), Gaps = 58/259 (22%)

Query: 42  SIKSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPN 101
            I    R++QE LG  +DIS++P +Y  L  K D+++ +    L V++ ++ E YDYP  
Sbjct: 31  GIPVTHRYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKY 90

Query: 102 LTESISDWWSLNKDGWFGSKKTE--HASKKKDSNHDDTFL--------PRSFAQAISKAA 151
           + ESI+++         GSK  E  HAS   +++   + L        P++   A+S+ +
Sbjct: 91  INESINEF-----SRTVGSKIQELSHASSAHEAH---SILSAPGPSKDPKTLNYALSRVS 142

Query: 152 VDCESEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSW 211
           +      ++L  +                                     S L+K    +
Sbjct: 143 LVSSECMEHLSTH-------------------------------DDALLASYLMK----Y 167

Query: 212 STCYKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYE--- 268
           S     + + +   DS++   FN KL + I+ + K+ H +RR VE  RL +D  R     
Sbjct: 168 SDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASRTHLEK 227

Query: 269 -GKSKEEQLRAQKDETSKE 286
               KE QLR Q  ET++E
Sbjct: 228 AKPEKEAQLRVQM-ETAEE 245

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 105/246 (42%), Gaps = 40/246 (16%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ V    L V+ TFE + YDYP    
Sbjct: 41  QSTQRMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVAR 100

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDS------NHDDTFLPRSFAQAISKAAVDCESE 157
           ES+ ++   +K      ++  HA+   ++      N +    P++   A+SKA++    +
Sbjct: 101 ESVIEF---SKSAVSKVEELSHATSASEAQQILTNNSNQIKEPKTLNYALSKASLISSEQ 157

Query: 158 FKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKN 217
                                                       S L+K    +S     
Sbjct: 158 LN-----------------------KQFSTDDDNNSNSDFKLVSSILLK----FSDIQAK 190

Query: 218 IDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYE----GKSKE 273
           I + + + D ++ ++FN  L   +N  F++  ++R+ V+  RL++D  R         KE
Sbjct: 191 IAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVARTNLLNAKPEKE 250

Query: 274 EQLRAQ 279
             LR Q
Sbjct: 251 ASLRVQ 256

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 98/230 (42%), Gaps = 46/230 (20%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LEKK DS++ + +  L V+  +E E YDYP  + 
Sbjct: 38  QSTQRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIK 97

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL-------PRSFAQAISKAAVDCES 156
           +S++D+          +K T+ +     S   +  +       P++   A+SK ++   S
Sbjct: 98  DSVNDF-----SKTMAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTA-S 151

Query: 157 EFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYK 216
           E  N                                         S L      +S    
Sbjct: 152 EVIN---------------------------------QVGSTPNESALSSKLLEFSNVQS 178

Query: 217 NIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR 266
            I + + + D+++  +FNK L   ++    K ++ R++V+  RL++D  R
Sbjct: 179 KIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 102/248 (41%), Gaps = 54/248 (21%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE + D +  V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVR 116

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL--------PRSFAQAISKAAVDCE 155
           +S+      N+     S K    S    ++     L        P++   A+SK A+   
Sbjct: 117 DSV------NEFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVAL-TS 169

Query: 156 SEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCY 215
           SE+                                           + L+K    +S   
Sbjct: 170 SEY-------------------------------LSKSGHEDETIATALLK----YSDVQ 194

Query: 216 KNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRY----EGKS 271
             I + + + D+++  +FNKKL + +  D  K  + R++VE  RL++D  R         
Sbjct: 195 AKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLANAKPE 254

Query: 272 KEEQLRAQ 279
           KE  LR Q
Sbjct: 255 KEASLRVQ 262

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 106/248 (42%), Gaps = 52/248 (20%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL-------PRSFAQAISKAAVDCES 156
           ES++++ S        SK TE       S   +  +       P++   A+SK A++  S
Sbjct: 93  ESVNEFSS-----SLASKLTELTHATSASQAQNILVAPGPIKEPKTLNYALSKVALNS-S 146

Query: 157 EFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYK 216
           E  N                                         S+L++    +S    
Sbjct: 147 ECLN------------------------------KMFPTEEQPLASSLLQ----FSDVQA 172

Query: 217 NIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRY-----EGKS 271
            I + + + D+++  +FNKKL + ++ +  K  + R++V   RL++D  R      +   
Sbjct: 173 KIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVARTNLANNKKPE 232

Query: 272 KEEQLRAQ 279
           KE  LR Q
Sbjct: 233 KEASLRVQ 240

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 98/229 (42%), Gaps = 53/229 (23%)

Query: 45  SRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTE 104
           S  R +QE LG V+DIS+LP +Y  LE + ++++ + +  L V+K +E E YDYP N+ E
Sbjct: 45  STQRMLQEKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKE 104

Query: 105 SISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL-------PRSFAQAISKAAVDCESE 157
           S+ ++  L      G K  + +         +  L       P++   A+SK A+     
Sbjct: 105 SVDEFSKL-----VGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEH 159

Query: 158 FKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKN 217
            ++                                          +L      +S     
Sbjct: 160 VED-----------------------------------------ESLANFLAKYSDSQTK 178

Query: 218 IDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR 266
           I + + + D+M+  +FNK +++ + +D +   + R+ VE+ RL++D +R
Sbjct: 179 IAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 103/234 (44%), Gaps = 50/234 (21%)

Query: 42  SIKSRT-RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPP 100
           SI S T R VQE LG V+DIS+LP +Y  LEK+ D+++ V +  L ++  ++ E YDYP 
Sbjct: 34  SIASSTQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPK 93

Query: 101 NLTESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL--------PRSFAQAISKAAV 152
            +++S++D+  L     F S K E  S+   +      L        PR+   A+SK A+
Sbjct: 94  YVSDSVNDYSKL-----FQS-KIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVAL 147

Query: 153 DCESEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWS 212
                   L+                                       S L+K    +S
Sbjct: 148 TSSESLNQLQ-------------------------------DPNVSAVASTLLK----FS 172

Query: 213 TCYKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR 266
                I + + + D+++  + NK +++ ++   +K  + RR V+  RL++D  R
Sbjct: 173 DMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKSRRDVQYKRLQYDVAR 226

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 102/246 (41%), Gaps = 47/246 (19%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE K DS++++    L VS  +E + YDYP    
Sbjct: 38  QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAK 97

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL------PRSFAQAISKAAVDCESE 157
           ES+ ++   +K      ++  HAS   ++ +  T        P++   A+SK A+     
Sbjct: 98  ESLIEF---SKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEH 154

Query: 158 FKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKN 217
                 N                                     S L+    ++S     
Sbjct: 155 LNQFNDN------------------------------EAFKSSASALL----NFSNIQAK 180

Query: 218 IDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYE----GKSKE 273
           I + + + D ++ ++FN  L   +  +  K  ++R++V+  RL++D  R         KE
Sbjct: 181 IAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKE 240

Query: 274 EQLRAQ 279
             LR Q
Sbjct: 241 ASLRVQ 246

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 102/251 (40%), Gaps = 58/251 (23%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL-------PRSFAQAISKAAVD--- 153
           ES++++          SK TE       S   +  +       P++   A+SK A++   
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSE 147

Query: 154 CESEFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWST 213
           C ++    E+                                        L      +S 
Sbjct: 148 CLNKMLPTEEQP--------------------------------------LASALLQFSD 169

Query: 214 CYKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRY-----E 268
               I + + + D+++  +FNK L + ++ +  K  + R+ V   RL++D  R      +
Sbjct: 170 VQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVARTNLANNK 229

Query: 269 GKSKEEQLRAQ 279
              KE  LR Q
Sbjct: 230 KPEKEASLRVQ 240

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 99/248 (39%), Gaps = 52/248 (20%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL-------PRSFAQAISKAAVDCES 156
           ES++++          SK TE       S   +  +       P++   A+SK A++  S
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNS-S 146

Query: 157 EFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYK 216
           E  N                                           L      +S    
Sbjct: 147 ECLN----------------------------------KMFPTEEQPLASALLQFSDVQA 172

Query: 217 NIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRY-----EGKS 271
            I + + + D+++  +FNK L + ++ +  K  + R+ V   RL++D  R      +   
Sbjct: 173 KIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPE 232

Query: 272 KEEQLRAQ 279
           KE  LR Q
Sbjct: 233 KEASLRVQ 240

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 96/234 (41%), Gaps = 46/234 (19%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R V+E LG V DIS LP +Y  LE K D+ + V +  L ++  +E E YDYP   +
Sbjct: 33  QSTHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFS 92

Query: 104 ESISDWWSL--NKDGWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNL 161
           ES++++     NK   F +  +   S  K         PR+   A+SK ++    +F+ L
Sbjct: 93  ESVNEFTDSIGNKMYEFSNGVSTEGSSGK--------TPRTLNYAVSKVSMGASEQFQKL 144

Query: 162 EQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEG 221
                                                     +  +  +      +I E 
Sbjct: 145 HDTDDK-----------------------------------RIANLLTNVGNAEASIAEA 169

Query: 222 KAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQ 275
           +   D  +  +FN +L + I +  ++  + R++V   RLK+D  R E  SK E+
Sbjct: 170 RLLQDHSIQAKFNFQLREEIAQSIERASKYRKEVYHKRLKYDIAR-EKYSKHEK 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 100/248 (40%), Gaps = 52/248 (20%)

Query: 44  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 103
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 104 ESISDWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL-------PRSFAQAISKAAVDCES 156
           ES++++          SK TE       S   +  +       P++   A+SK +++  S
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNS-S 146

Query: 157 EFKNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYK 216
           E  N                                           L      +S    
Sbjct: 147 ECLN----------------------------------KMFPAEEQPLASALLQFSDVQA 172

Query: 217 NIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRY-----EGKS 271
            I + + + D+++  +FNKKL + ++ +  K  + R+ V   RL++D  R      +   
Sbjct: 173 KIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPE 232

Query: 272 KEEQLRAQ 279
           KE  LR Q
Sbjct: 233 KEASLRVQ 240

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 94/228 (41%), Gaps = 49/228 (21%)

Query: 48  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 107
           R  QE LG ++DIS++P +Y  LE + D+L+   + +L V++ +E   YD+P +  ES+ 
Sbjct: 41  RLAQEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQ 100

Query: 108 DWWSLNKDGWFGSKKTEHASKKKDSNHDDTFL---------PRSFAQAISKAAVDCESEF 158
           DW         GS + +  S+   ++     L         PR+   A+S+A++   +  
Sbjct: 101 DW-----SRAIGS-RVQELSRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAVST-- 152

Query: 159 KNLEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNI 218
                                                      S LI    ++S     +
Sbjct: 153 ----------------------------LTSSNMPGPNGEGLSSGLI----AYSDTQAKL 180

Query: 219 DEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR 266
            + +   D+ +  +FNK+L +++N    K ++ R+ V+  R+ +D  R
Sbjct: 181 AQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIAR 228

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 43/61 (70%)

Query: 48  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 107
           R VQE LG ++DIS++P +Y  +EK+ D +  + +  L V++ +E E YDYP +++ES++
Sbjct: 61  RMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVN 120

Query: 108 D 108
           +
Sbjct: 121 E 121

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 43/62 (69%)

Query: 48  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 107
           R VQE LG V+DIS++P +Y  LE++ D  + +    L VS+ +E E YDYP ++++S++
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 108 DW 109
           D+
Sbjct: 121 DF 122

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 99/238 (41%), Gaps = 47/238 (19%)

Query: 48  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 107
           R ++E LG   DIS LP +Y  LE K D+++++ +  L V+  +E E YDYP    ES  
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFW 96

Query: 108 DWWSLNKDGWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNXXX 167
           ++     + +     +EH +K K        +P++   A+    +    + K L +    
Sbjct: 97  EFTDSVGEKFSALNISEHNNKVK--------IPKTLNYALHNVFLTANEKVKLLHE---- 144

Query: 168 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLIKVFDSWSTCYKNIDEGKAEMDS 227
                                             ++L +   S S    +I E +   DS
Sbjct: 145 -------------------------------PLDNSLSETLASLSETEADIAEARLHQDS 173

Query: 228 MMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMR--YEGKSKEEQ--LRAQKD 281
           ++    N +L++ ++++F++  + R+ V   R  +D  +  +E    E+Q  L AQ D
Sbjct: 174 LVKSRINYQLKEELSQNFERAAKYRKAVHHKRFNYDVAKTNFEHAKPEKQATLSAQAD 231

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (66%)

Query: 50  VQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDW 109
           +QE  G V+DIS LP +Y  LE++ DS++ V    L ++  +E E YDYP ++ +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,750,850
Number of extensions: 1182555
Number of successful extensions: 5491
Number of sequences better than 10.0: 114
Number of HSP's gapped: 5648
Number of HSP's successfully gapped: 178
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)