Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4763.488ON30430416380.0
Skud_16.4423.488ON30430413930.0
YPR147C3.488ON30430413860.0
Smik_16.4003.488ON30430413360.0
TBLA0C044503.488ON3093097467e-98
TDEL0D055603.488ON3113107346e-96
NCAS0F035303.488ON3133167252e-94
CAGL0L08514g3.488ON3123127103e-92
KLTH0F14740g3.488ON3023046815e-88
Kpol_480.173.488ON3133126818e-88
TPHA0D042203.488ON3163176713e-86
Kwal_55.212193.488ON3022986572e-84
ZYRO0D10076g3.488ON3053086286e-80
SAKL0F02860g3.488ON3053066182e-78
NDAI0B058303.488ON3293305975e-75
Ecym_12413.488ON3053105095e-62
AFR306C3.488ON3192815043e-61
CAGL0L04686g3.454ON451130840.058
TDEL0F003101.530ON395167810.10
KAFR0E03110singletonON35685790.18
CAGL0F03817gna 1ON44394721.3
Kwal_27.123173.454ON435142721.5
NCAS0B022608.524ON363115721.5
SAKL0B02838g8.89ON23784692.5
Smik_12.1588.284ON39466702.6
Suva_10.1838.284ON39458692.9
Kpol_YGOB_Anc_6.2986.298ON52025693.2
YLR099C (ICT1)8.284ON39458693.6
CAGL0M11462g8.284ON38661693.6
KAFR0B03200na 1ON444149693.7
Skud_12.1678.284ON39466684.6
YGR110W (CLD1)3.454ON445131676.7
ZYRO0F04356g8.89ON23649667.0
TDEL0C011808.89ON23462657.7
Suva_7.3953.454ON451131668.1
TBLA0H035408.524ON378108668.4
ABL019W3.454ON431122659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.476
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   635   0.0  
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   541   0.0  
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   538   0.0  
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   519   0.0  
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   291   7e-98
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   287   6e-96
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   283   2e-94
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   278   3e-92
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   266   5e-88
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   266   8e-88
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   263   3e-86
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   257   2e-84
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   246   6e-80
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   242   2e-78
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   234   5e-75
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   200   5e-62
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   198   3e-61
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...    37   0.058
TDEL0F00310 Chr6 complement(48612..49799) [1188 bp, 395 aa] {ON}...    36   0.10 
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               35   0.18 
CAGL0F03817g Chr6 complement(370647..371978) [1332 bp, 443 aa] {...    32   1.3  
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...    32   1.5  
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    32   1.5  
SAKL0B02838g Chr2 complement(270015..270728) [714 bp, 237 aa] {O...    31   2.5  
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    32   2.6  
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    31   2.9  
Kpol_YGOB_Anc_6.298 s1060 complement(42505..44067) [1563 bp, 520...    31   3.2  
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    31   3.6  
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    31   3.6  
KAFR0B03200 Chr2 (661966..663300) [1335 bp, 444 aa] {ON}  YMR210W      31   3.7  
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    31   4.6  
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...    30   6.7  
ZYRO0F04356g Chr6 complement(370432..371142) [711 bp, 236 aa] {O...    30   7.0  
TDEL0C01180 Chr3 complement(202833..203537) [705 bp, 234 aa] {ON...    30   7.7  
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...    30   8.1  
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    30   8.4  
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...    30   9.9  

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/304 (100%), Positives = 304/304 (100%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120
           ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL
Sbjct: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180
           SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL
Sbjct: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180

Query: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240
           SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC
Sbjct: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240

Query: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300
           EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI
Sbjct: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300

Query: 301 NAFF 304
           NAFF
Sbjct: 301 NAFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/304 (80%), Positives = 278/304 (91%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           M +QEYTKS LPCSILNIKP+V T+NEDAPLLVWIPGNPGLL+YYQEM+ HLH KHPDWE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120
           ILG+SHAGM+ NA SNTPIFSLQDQVDHQV+VINNFSH+NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180
           S++LVGSV K+GLITPTVMDIH SEMGVKMT   HY+P LAHV+S +SYVFFYW+LSEGL
Sbjct: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180

Query: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240
           S+ +IDKFMGCG+ G +AVLSTR+ LTH+QFVRQSLGLASQE+KEITTNWEFQD+FIN+C
Sbjct: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240

Query: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300
           +E  IF WFLFSTKDHWV D+TR HLSHYY DK+KQE L+IDVTDK+PHSFVVKHAEYA+
Sbjct: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300

Query: 301 NAFF 304
           N FF
Sbjct: 301 NTFF 304

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/304 (81%), Positives = 276/304 (90%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           M+++EYTKSKLPCSILNIKPTVT   EDAPLLVWIPGNPGLL+YYQEM+HHLHLKHPDWE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120
           ILGISHAGM+ NA SNTPIFSLQDQVDHQV+VINNFS  NRKIIIMGHSVGAYIVQKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180
           SN+LVGSV KVGL+TPTVMDIH SEMG+KMT A  Y+P LAHV+S  SY+FFYW+LSEG 
Sbjct: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240
           S+ IIDKFMGCG+ G +AVLSTR+FLTHRQFVRQSLGLA+QE++EITTNWEFQD+FIN+C
Sbjct: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240

Query: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300
           EE GI  WFLFS+ DHWV+ +TR HLS YY DKVKQE L+IDVTDK+PHSFVVKHAEYAI
Sbjct: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300

Query: 301 NAFF 304
           NAFF
Sbjct: 301 NAFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/304 (77%), Positives = 270/304 (88%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           M IQEYTKSK PCSILNIKPT+T  +EDA LLVWIPGNPGLL+YYQEM+ +LH KHPDWE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120
           ILGISHAGM+ NA SNTP++SLQDQVDHQV+VINNFSH+NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180
           S+ LVG+V KVGL+TPTVMDIH SEMGVK+TTA HY+P LAHV+S  SY+FFYW+LSEG 
Sbjct: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240
           S+ IIDKFMGCG+   +AVLSTR+FLTH+QFVRQSLGLASQE++EITTNWEFQDKFIN+C
Sbjct: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240

Query: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300
           E+ G   WFLFS+ DHWV+ +TR HLSHYY DKV Q  L IDVTDK+PHSFVVKHA+YAI
Sbjct: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300

Query: 301 NAFF 304
           N FF
Sbjct: 301 NTFF 304

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  291 bits (746), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 138/309 (44%), Positives = 204/309 (66%), Gaps = 5/309 (1%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTD-NEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDW 59
           M+IQ Y  S+ P SI++  P       ED PL +WIPGNPGLL YY +M+  LH K+P W
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 60  EILGISHAGMSSNARS----NTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIV 115
           EILG+SHAGMS+  +     +T +++L +QV H+V+VINNFS   R IIIMGHSVGAY+ 
Sbjct: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120

Query: 116 QKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWV 175
           Q+V + + L+G+V K+GL+TPTV+DIH S  G+KMT AF+    L   L  +S + F  +
Sbjct: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180

Query: 176 LSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDK 235
                ++ ++   MGC      A  ++ +FLT+  FV+Q LGLAS E+K I  +W FQ +
Sbjct: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240

Query: 236 FINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKH 295
            I++C ++ + TWFLFS+ DHWV+D+TR  L ++Y    K + L + V++ +PHSFV+  
Sbjct: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300

Query: 296 AEYAINAFF 304
           +++ +N++F
Sbjct: 301 SDFTVNSYF 309

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  287 bits (734), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 207/310 (66%), Gaps = 8/310 (2%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           M+ +EY K   P SI++ K        + PL VWIPGNPGL+ YY+E +  +H +HP+WE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 61  ILGISHAGMSSNARSNTP------IFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYI 114
           +LGISHAGMS+ + S +       ++SL+ Q+DH++++I +FS  NR +IIMGHSVGAY+
Sbjct: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120

Query: 115 VQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYW 174
           VQ + LS++LVG V K+GL+TPT++DIH S+ GV +T   +++  L  +  + S + F +
Sbjct: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGF 180

Query: 175 VLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQD 234
            L   + ++++  FMGC       VL+T + L + +FV+Q+LGL+  E++EI ++W FQ 
Sbjct: 181 FLPSFILRILLSFFMGC-HRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239

Query: 235 KFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVK 294
           + I HC E+GI TW LFS  DHWV D TR+ L  +Y D  + + ++I  T K+PHSFV+ 
Sbjct: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298

Query: 295 HAEYAINAFF 304
           H++Y I+ +F
Sbjct: 299 HSKYLISEYF 308

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  283 bits (725), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 203/316 (64%), Gaps = 15/316 (4%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           MS++ Y   + P  +++I P  T   E  P+ VWIPGNPG+L YYQEM+ +LH KHP WE
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTA--EINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58

Query: 61  ILGISHAGMSSNARS--------NTPIFSLQDQVDHQVKVINNFSHD-NRKIIIMGHSVG 111
           IL ISH GM++   S        N+ +F+L++Q+ H++K+INNF  D N  I I GHSVG
Sbjct: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118

Query: 112 AYIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHY-VPALAHVLSFISYV 170
           AY+VQK+  S+EL+G V K+GLITPT++DIH SE G  MT    +    L H+LSF+ Y+
Sbjct: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178

Query: 171 FFYWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNW 230
            F W++   L   II   MGC     +A +ST LFLT   FVRQSLGLA +E+  I  +W
Sbjct: 179 VFGWLVPGILRSYIIGYVMGCH-HDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237

Query: 231 EFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVK--QEHLRIDVTDKMP 288
           +FQ + I +C +  I   FLFS  DHWV + TRK +  +Y ++ K  +  L+IDV+D+ P
Sbjct: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297

Query: 289 HSFVVKHAEYAINAFF 304
           HSFVV+ ++Y +  +F
Sbjct: 298 HSFVVRRSKYVVEHYF 313

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  278 bits (710), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 193/312 (61%), Gaps = 8/312 (2%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           MS+Q Y  S LP  I++IKPTVT ++E +PL VWIPGNPGLL YYQE +  +H K+P WE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  ILGISHAG-------MSSNARSNTPIFSLQDQVDHQVKVINNFSHD-NRKIIIMGHSVGA 112
           ILGISHAG       +    ++  PI+ L+ Q  H++ +IN  ++D NR+++IMGHSVGA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 113 YIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFF 172
           YI Q V  S +LVG V+K+GLITPT+ DIH S  G+  T  F+Y+  +   LSFIS   F
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 173 YWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEF 232
             ++    +KL+I   MGC       +L T L LT R+ +RQ LGLA+ E+ EI  +W F
Sbjct: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240

Query: 233 QDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFV 292
           Q+  +  C++ G   W LFS  DHWV+  T+  L  +  D+  +  LR+DV   + HSFV
Sbjct: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300

Query: 293 VKHAEYAINAFF 304
           VK  +     +F
Sbjct: 301 VKDVDLVTRRYF 312

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  266 bits (681), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 195/304 (64%), Gaps = 2/304 (0%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           M I+       P SIL++K  V++   DA L V+IPGNPGL+ YY   +  +H K+PDWE
Sbjct: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60

Query: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120
           ILGISHAGM+S      P+++LQ+Q++H+V VIN+++  N+KI IMGHSVGA+I QKV  
Sbjct: 61  ILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120

Query: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180
           S  L   V +VGL+TPTV+DIH SE G+K+T      P    ++S + ++ F  +  + L
Sbjct: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180

Query: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240
           +  II  F         A  +TRL LT+ +FV+Q+LGLA++E++ I ++WE+Q  F+++C
Sbjct: 181 TSWIISHFADDPKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYC 238

Query: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300
           E KG   W+LFS  DHWV+ ETRK L  +Y      E + IDV+  + H+FV +HA+  +
Sbjct: 239 ETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVV 298

Query: 301 NAFF 304
             +F
Sbjct: 299 QHYF 302

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  266 bits (681), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 198/312 (63%), Gaps = 12/312 (3%)

Query: 3   IQEYTKSKLPCSILNIKP-TVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEI 61
           ++ +  S  P SI+++ P T     ED+PL VWIPGNPGLL YY + +  +H K+P WE+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 62  LGISHAGMS---------SNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGA 112
           LGISHAGMS         +++     +F L++QV H+V +IN FS  NR +IIMGHSVGA
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123

Query: 113 YIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFF 172
           Y+ Q+V ++N+L G + KVG +TPTV+DIH S+ G+KMT  F++   L H + +IS   F
Sbjct: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183

Query: 173 YWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEF 232
           + +L     K  I K + C +    AVL++   L +   + Q+LGLA+ E++ I  +W F
Sbjct: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242

Query: 233 QDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFV 292
             K I++C E G+ TWFLF+  DHWV   TRK +  +Y    K E++RID+ D +PH+FV
Sbjct: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301

Query: 293 VKHAEYAINAFF 304
           +K ++Y ++ +F
Sbjct: 302 IKKSKYIVDQYF 313

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  263 bits (671), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 132/317 (41%), Positives = 199/317 (62%), Gaps = 14/317 (4%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTD---------NEDAPLLVWIPGNPGLLHYYQEMIHH 51
           M+I  +  SK P SIL+IK T   D         ++ +PL VWIPGNPGLL YY+E +  
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 52  LHLKHPDWEILGISHAGMSS---NARSN-TPIFSLQDQVDHQVKVINNFSHDNRKIIIMG 107
           LH+K+P+W+ILGISHAGMSS   N + N   +++L +Q+ H++++IN F+   R++I+MG
Sbjct: 61  LHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120

Query: 108 HSVGAYIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFI 167
           HSVGA++ QKV +SN+L G V K+GL+ PTV+DIH SE G +++T  +++P L  +  ++
Sbjct: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180

Query: 168 SYVFFYWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEIT 227
           S   F   L   L K II  FM       +A  +T  FL    FV QSLGLA  E++ I 
Sbjct: 181 SEKIFGGFLPITLVKFIISFFMELNNE-NKAAHATYTFLKDSNFVEQSLGLAKYEMQIIR 239

Query: 228 TNWEFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKM 287
            +WEFQ + +  C    I  W LF+  DHWV+++TR  L   Y + V  ++    +TD++
Sbjct: 240 HDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQV 299

Query: 288 PHSFVVKHAEYAINAFF 304
           PH+FV+K++ + ++ +F
Sbjct: 300 PHAFVIKNSCHVVDNYF 316

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  257 bits (657), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 121/298 (40%), Positives = 193/298 (64%), Gaps = 10/298 (3%)

Query: 11  LPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMS 70
           LPCS+ +    + +   +APL V+IPGNPGL+ +Y+  +  +H K+P WEILGISHAGM+
Sbjct: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70

Query: 71  SNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCLSNELVGSVTK 130
           S +   +P++SL+ Q+DH++++IN +  D + IIIMGHSVGA++VQK+  S  L   V +
Sbjct: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130

Query: 131 VGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGLSK----LIID 186
           VGL+TPTV+DIH SE GVK+T+   + P+  +V+S +++  F  +L   ++K    L++D
Sbjct: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190

Query: 187 KFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIF 246
               C  A      +T L +T+ +FV+Q+LGLA++E++ I ++W +Q +F+  C+E    
Sbjct: 191 DPQSCLGA------TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTK 244

Query: 247 TWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAINAFF 304
            W+LFS KDHWV+  TR  +  +Y         +IDV+  + H+FV +HA+  I  +F
Sbjct: 245 IWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  246 bits (628), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 198/308 (64%), Gaps = 7/308 (2%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           MSI+    ++LP S+L+I     + +  +PL VWIPGNPG++ YY+E ++ LH K+  +E
Sbjct: 1   MSIRYLAGARLPTSVLHI--KPKSPSPSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58

Query: 61  ILGISHAGMSSN----ARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQ 116
           IL ISHAGM++      +    I++L DQ+ H+V++IN FS  +R +I+MGHSVGAY+ Q
Sbjct: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118

Query: 117 KVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVL 176
            V L+ +L+G V K+GLITPTV+DIH S+ G ++T AF++V  L  + +++S + F  + 
Sbjct: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178

Query: 177 SEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKF 236
           S   +  +I  FMG        V +++  + + + +RQ+LGLA+ E+++I   W FQ K 
Sbjct: 179 SIMFTDQVISLFMGVDKES-VPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237

Query: 237 INHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHA 296
           I+HC    I T F+FS  D WV++ TR+ L  +Y +  +  +L I V+  + HSF+VKH+
Sbjct: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297

Query: 297 EYAINAFF 304
           +Y ++ +F
Sbjct: 298 KYIVDEYF 305

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  242 bits (618), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 191/306 (62%), Gaps = 5/306 (1%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60
           M IQ Y+K+    S+ ++KP     N   PL V+IPGNPGL+ +Y+  +  +  KH +WE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  ILGISHAGMSSNARS---NTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQK 117
           ILGISHAGM +  +     T ++SL+DQV H++ VIN+F   NR +II GHS+GAYIVQK
Sbjct: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120

Query: 118 VCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLS 177
           + L   L+G+V K+ L+TPTV+DIH SE G K+     + P     ++  S++ F  +L 
Sbjct: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180

Query: 178 EGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFI 237
           + +++ I+  F+G      R   + +L +T+ +FV+QSLGLA +E++++  +W FQ  F+
Sbjct: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238

Query: 238 NHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAE 297
             C+ + +   FLF+ KDHWVN +TR  L+ +Y+    ++ L ID  +K+ HSFV+   +
Sbjct: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298

Query: 298 YAINAF 303
             ++ +
Sbjct: 299 SVVDRY 304

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  234 bits (597), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 125/330 (37%), Positives = 193/330 (58%), Gaps = 27/330 (8%)

Query: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDA--PLLVWIPGNPGLLHYYQEMIHHLHLKHPD 58
           M ++ Y++SK P SI++I+     +N+ +  PL +WIPGNPG+L YYQ+ +  LH KHP 
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 59  WEILGISHAGMSSN----ARSNTPIFSLQDQVDHQVKVINNF-----SHDN----RKIII 105
           WEIL I HAGM ++       N  I+ L +Q++H+++VI  F     S D     R ++I
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120

Query: 106 MGHSVGAYIVQKVCLSNELVGSV-------TKVGLITPTVMDIHASEMGVKMTTAFHYVP 158
           MGHSVG Y++Q++ L+ E   ++        K+G ITPT++DI+ S  G+ ++       
Sbjct: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180

Query: 159 A-LAHVLSFISYVFFYWVLS--EGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQS 215
             L ++LS++SY  F  +L   + + + +I   MGC      A+  T + LT+   V+QS
Sbjct: 181 GYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLVKQS 239

Query: 216 LGLASQELKEITTNWEFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVK 275
           LGLAS E++EI  NW+ Q +F+ +C    I  W LF   DHWVN+ TR  L  +Y    K
Sbjct: 240 LGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYK 299

Query: 276 Q-EHLRIDVTDKMPHSFVVKHAEYAINAFF 304
               L+I+V+ + PHSFVV H+++ +  FF
Sbjct: 300 DISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  200 bits (509), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 178/310 (57%), Gaps = 13/310 (4%)

Query: 3   IQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEIL 62
           ++ Y +  +   IL+I    T      PLL++IPGNPGL+++Y+E +  +H ++P WE++
Sbjct: 1   METYLREDIFADILHIYSQSTPP---GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57

Query: 63  GISHAGMSSNARSNT---PIFSLQDQVDHQVKVINNF--SHDNRKIIIMGHSVGAYIVQK 117
           GI H GMSS   +N+    + +L +Q++ +VKVIN F  +  +R I ++GHS+GAY+VQK
Sbjct: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117

Query: 118 VCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLS 177
           + L   L G +  V L+TPT++DIH S  GV++T    + P        +  V F W+L 
Sbjct: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177

Query: 178 EGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFI 237
               + I  K +  G +    + S +  ++  +FV+Q+LGLA  E+ ++   W+FQD+FI
Sbjct: 178 TSWIEWIARKLI--GGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFI 235

Query: 238 NHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKV---KQEHLRIDVTDKMPHSFVVK 294
           + C+   I   FLFS  DHWV+ +T K +   Y  K    +++ L I +   + HSFVVK
Sbjct: 236 SFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVK 295

Query: 295 HAEYAINAFF 304
                +N +F
Sbjct: 296 DTTKVVNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  198 bits (504), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 101/281 (35%), Positives = 164/281 (58%), Gaps = 9/281 (3%)

Query: 31  LLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARSN--TPIFSLQDQVDH 88
           +L+++PGNPGL+++Y+E +  +H K+P WEI+GISH GMS+         +++L +QV+H
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100

Query: 89  QVKVINNF--SHDNRKIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVMDIHASEM 146
           +VK IN+F  +  N  + ++GHS+GAY+ QKV +   L  +V  VGL+TPT++DIH S  
Sbjct: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160

Query: 147 GVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFL 206
           GV++T    + P     +S +  V   W+L       +  K +G   +    + S    +
Sbjct: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG--GSDECVLQSAEKLV 218

Query: 207 THRQFVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHL 266
            +  +VRQ+LG+A  E+ ++   W+FQ++FI  C+E+    W LFS  DHWV+ +T K +
Sbjct: 219 KNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDI 278

Query: 267 SHYYHDKV---KQEHLRIDVTDKMPHSFVVKHAEYAINAFF 304
             +Y  K        LRI + + + HSFVVK     +N +F
Sbjct: 279 VEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 52/130 (40%), Gaps = 10/130 (7%)

Query: 16  LNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARS 75
           L I+P     N+    L+++ G    L +Y +   HL L    W I  I   G   ++R 
Sbjct: 119 LVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRM 178

Query: 76  NTPIFSLQDQ--------VDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCLSNELVGS 127
           + P    +D         +     +      D    I+M HS+GAY++      N+   S
Sbjct: 179 DFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM--AFYLNKYPDS 236

Query: 128 VTKVGLITPT 137
           V K+ + +P 
Sbjct: 237 VKKMVMCSPA 246

>TDEL0F00310 Chr6 complement(48612..49799) [1188 bp, 395 aa] {ON}
           Anc_1.530 YJR075W
          Length = 395

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 64/167 (38%), Gaps = 42/167 (25%)

Query: 7   TKSKLPCSILNIKPTVTTDNEDAPLLVWIPG----NPGLLH------YYQEMIHHLHLKH 56
           TK K P  I  IKP   +D+ED  +LVW       NPG +H        + ++ H +   
Sbjct: 124 TKRKFPAYIWQIKPNFDSDSED--ILVWERNWDDKNPGFVHEITNEDMAETLVRHFYSSI 181

Query: 57  PD----WEIL------------------GISHAGMSSNARSNTPIFSLQDQVDHQVKVIN 94
           PD    +E L                  G   A M +N     P +  ++   H++ +I 
Sbjct: 182 PDVLEAYESLPSKVLKVDFFKYLILLARGGVFADMDTNPLQPVPNWIPENIEPHKIGIIV 241

Query: 95  NFSHDN-----RKIIIMGHSVGAYIVQKV---CLSNELVGSVTKVGL 133
              HD      R   I     G +I+Q      +  E+V  +T+V L
Sbjct: 242 GVEHDASSPDWRSRYIRRLQFGTWIIQSKPGHPIIREVVAKITEVTL 288

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 31  LLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARSNTPIFSLQDQVDHQV 90
           L + IPG  G L  ++ ++  +   + ++  + +   G S +  SN  +  +   +D  +
Sbjct: 82  LFLCIPGLGGNLEQFEPLVRLIDASNKNFLAIDLPGFGKSEDY-SNYSMTHIATLIDQML 140

Query: 91  KVINNFSHDNRKIIIMGHSVGAYIV 115
           + +   + DN KI +MGHS+G ++ 
Sbjct: 141 ETVIGTAPDNYKINVMGHSMGTHLA 165

>CAGL0F03817g Chr6 complement(370647..371978) [1332 bp, 443 aa] {ON}
           similar to uniprot|Q03649 Saccharomyces cerevisiae
           YMR210w
          Length = 443

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 6/94 (6%)

Query: 26  NEDAPLLVWIPGNPGLLH--YYQEMIHHLHLKHPDWEILGISHAGMSSNARSNTPIFS-- 81
           N+  PLL+ + G  G  H  Y + M+  L  K+ D+E   ++  G  ++A +   +++  
Sbjct: 139 NDSKPLLIALHGLTGGSHESYVRSMVRTLQNKY-DFEACVLNSRGCCNSAITTAQLYNGG 197

Query: 82  LQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIV 115
             + + H VK +    + NRK  ++G S+GA I+
Sbjct: 198 WTNDIRHCVKELREM-YPNRKFYMIGFSLGASIL 230

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 16  LNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARS 75
            NI+PT    ++    L+ + G    L ++ +   +L+L + +W I  I   G   ++R 
Sbjct: 128 FNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP 187

Query: 76  NTPIFSLQDQVDHQVKVI--NNFSH--DNRKII-------IMGHSVGAYIVQKVCLSNEL 124
             P F + D    QV+    + F    + R ++       ++ HS+GAY+      +N+ 
Sbjct: 188 PFP-FKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT--ALYANKH 244

Query: 125 VGSVTKVGLITPTVMDIHASEM 146
            G   K+ + +P  +   A EM
Sbjct: 245 PGHFKKLVMCSPAGVCHSAPEM 266

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 26  NEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARS---NTPIFSL 82
           N+  PL ++I G  G L  ++ ++   HLK   +  L +   G S    S    + I ++
Sbjct: 78  NDGHPLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSVIETI 137

Query: 83  QDQVDHQVKVINNFSHDNR-KIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITP 136
           +  VD       +   + + K+I+ GHS+G Y+      +      + K+ L++P
Sbjct: 138 RSVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>SAKL0B02838g Chr2 complement(270015..270728) [714 bp, 237 aa] {ON}
           highly similar to uniprot|Q12483 Saccharomyces
           cerevisiae YPL002C SNF8 Component of the ESCRT-II
           complex which is involved in ubiquitin-dependent sorting
           of proteins into the endosome appears to be functionally
           related to SNF7 involved in glucose derepression
          Length = 237

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 10/84 (11%)

Query: 179 GLSKLIIDKF-----MGCGTAGRRAV-LSTRLFLTHRQFVRQSLGLASQELKEITTNWEF 232
           GL+   +DK      +G G  GR+A  L  +L +    F  + +  A +  KE+  N EF
Sbjct: 8   GLAAFDVDKENKYEDVGTGILGRQAQELKDQLAV----FQERLITFAKEHNKELRENPEF 63

Query: 233 QDKFINHCEEKGIFTWFLFSTKDH 256
           + KFI  C   GI    LF    H
Sbjct: 64  RGKFIRMCSSIGIDPLSLFDKDRH 87

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 6/66 (9%)

Query: 82  LQDQVDHQVKVINNFSHDN--RKIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVM 139
           L+   ++ V  I  +  DN  RKI ++GHS G YI  K  L  +   S+ K+ LI+P  +
Sbjct: 154 LEQYENYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYAL--KYPNSIDKLCLISPLGV 211

Query: 140 D--IHA 143
           +  IHA
Sbjct: 212 ENSIHA 217

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 90  VKVINNFSHDN--RKIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVMD--IHA 143
           V  I  +  DN  RKI ++GHS G YI  K  L  +   S+ K+ LI+P  ++  IHA
Sbjct: 162 VDRIEQWRKDNNLRKINVVGHSFGGYISFKYAL--KYPNSIDKLCLISPLGVENSIHA 217

>Kpol_YGOB_Anc_6.298 s1060 complement(42505..44067) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 91  KVINNFSHDNRKIIIMGHSVGAYIV 115
           ++ NN++  NRK +++GHS+GA IV
Sbjct: 157 RIENNYALTNRKSVLIGHSMGAQIV 181

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 90  VKVINNFSHDN--RKIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVMD--IHA 143
           V  I  +  DN  RKI ++GHS G YI  K  L  +   S+ K+ LI+P  ++  IHA
Sbjct: 162 VDRIEQWRKDNKLRKINVVGHSFGGYISFKYAL--KYPDSIEKLCLISPLGVENSIHA 217

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 82  LQDQVDHQVKVINNFSHDNR--KIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVM 139
           LQ   D+ V+ I  +  +N   K  ++GHS G Y+  K  L  +   SV K+ L++P  M
Sbjct: 142 LQQYEDYYVESIEQWRKENNLDKFNLVGHSFGGYLSYKYAL--KYPESVNKLCLLSPLGM 199

Query: 140 D 140
           +
Sbjct: 200 E 200

>KAFR0B03200 Chr2 (661966..663300) [1335 bp, 444 aa] {ON}  YMR210W
          Length = 444

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 66/149 (44%), Gaps = 19/149 (12%)

Query: 27  EDAPLLVWIPGNPGLLH--YYQEMIHHLHLKHPDWEILGISHAGMSSNARSNTPIFS--L 82
           +D P+L+ I G  G  H  Y + ++H L   H  +E   I+  G   +  +   +++   
Sbjct: 138 DDKPMLIAIHGLTGGSHESYVRTIVHKLTTLH-GFEACVINSRGCCQSKITTPQLYNGGW 196

Query: 83  QDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVMD-- 140
            + V H VK + +    NRK  +MG S+GA I+    +  E   S  +  ++     D  
Sbjct: 197 TNDVRHCVKELRSL-FPNRKFYMMGFSLGASILTNY-IGEEGARSDIECCIVLGNPWDLL 254

Query: 141 -----IHASEMGVKMTTAFHYVPALAHVL 164
                I+AS  G K+     Y P +A+ L
Sbjct: 255 RSSYFINASTFGSKI-----YSPTMANNL 278

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 6/66 (9%)

Query: 82  LQDQVDHQVKVINNFSHDN--RKIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVM 139
           L+   ++ V  I  +  DN  R+I ++GHS G YI  K  L  +   S+ K+ LI+P  +
Sbjct: 154 LEQYENYFVDRIEQWRKDNKLRRINVVGHSFGGYISFKYAL--KYPNSIDKLCLISPLGV 211

Query: 140 D--IHA 143
           +  IHA
Sbjct: 212 ENSIHA 217

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 11/131 (8%)

Query: 18  IKPTVTTDNE-DAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARSN 76
           I+P  T+  E D   LV+I G    L ++ +    + L   +W I  I   G   ++R  
Sbjct: 128 IRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPK 187

Query: 77  TP-------IFSLQDQVDHQVKV---INNFSHDNRKIIIMGHSVGAYIVQKVCLSNELVG 126
            P       I S+QD    ++       N  +   K I+M HS+G+Y++       +   
Sbjct: 188 FPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESP 247

Query: 127 SVTKVGLITPT 137
           S  K+ L +P 
Sbjct: 248 SFKKLILCSPA 258

>ZYRO0F04356g Chr6 complement(370432..371142) [711 bp, 236 aa] {ON}
           highly similar to uniprot|Q12483 Saccharomyces
           cerevisiae YPL002C SNF8 Component of the ESCRT-II
           complex which is involved in ubiquitin-dependent sorting
           of proteins into the endosome appears to be functionally
           related to SNF7 involved in glucose derepression
          Length = 236

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%)

Query: 211 FVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIFTWFLFSTKDHWVN 259
           F  + +G A +   EI  N EF+ KF+  C   GI    LF    H  N
Sbjct: 40  FQERLVGFAKKHNSEIQANPEFRSKFVRMCLSIGIDPLSLFDKDKHLFN 88

>TDEL0C01180 Chr3 complement(202833..203537) [705 bp, 234 aa] {ON}
           Anc_8.89 YPL002C
          Length = 234

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 6/62 (9%)

Query: 211 FVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYY 270
           F  + L  A +   EI  N EF+ KF+  C   GI    LF   +H  N      L+ +Y
Sbjct: 40  FQERLLQFAKKHNSEIKANPEFRSKFMRMCTSIGIDPLSLFDKNEHLFN------LNDFY 93

Query: 271 HD 272
           ++
Sbjct: 94  YE 95

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 11/131 (8%)

Query: 18  IKPTVTTDNE-DAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARSN 76
           I P V +  E D   LV+I G    L ++ +    + L + +W +  I   G   ++R  
Sbjct: 134 IYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPK 193

Query: 77  TP-------IFSLQDQVDHQVKV---INNFSHDNRKIIIMGHSVGAYIVQKVCLSNELVG 126
            P       I S+QD    ++       N  +   K I+M HS+G+Y++       E   
Sbjct: 194 FPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSP 253

Query: 127 SVTKVGLITPT 137
           S  K+ L +P 
Sbjct: 254 SFKKLILCSPA 264

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 48/108 (44%), Gaps = 8/108 (7%)

Query: 16  LNIKPTVTTDNE---DAPLLVWIPGNPGLLHYYQEMIHHLHLKHP-----DWEILGISHA 67
           LNI+      +E   + P+ V++PG  G L  Y+ ++  + + +      D    G S  
Sbjct: 78  LNIRSCNNVGSEVLTNKPIYVFLPGLGGSLDQYEPLLRLMDILNEKFIGFDLPGFGGSEE 137

Query: 68  GMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIV 115
             S    +   +  + ++    +   N  + D  ++ ++GHS+G Y+V
Sbjct: 138 DTSEGGYNMIKVCHIINEALQSIITQNYSTRDTIELRLVGHSMGCYLV 185

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 46/122 (37%), Gaps = 20/122 (16%)

Query: 18  IKPTVTTDNEDAPL--LVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARS 75
           I+P    +N  A    L++I G    L ++ +   HL L    W I  I   G   + R 
Sbjct: 121 IRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRC 180

Query: 76  NTPIFSLQDQVDHQVKVINNFSHDN--------------RKIIIMGHSVGAYIVQKVCLS 121
             P     D   H V+ +  + H+                + ++M HS+GAY+      S
Sbjct: 181 QFPF----DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQS 236

Query: 122 NE 123
            +
Sbjct: 237 RQ 238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,269,868
Number of extensions: 1449252
Number of successful extensions: 3977
Number of sequences better than 10.0: 50
Number of HSP's gapped: 4048
Number of HSP's successfully gapped: 50
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)