Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4743.483ON57257229440.0
Skud_16.4393.483ON57257228580.0
Smik_16.3963.483ON57257228490.0
YPR145W (ASN1)3.483ON57257228200.0
Smik_6.2203.483ON57257226150.0
Kpol_480.193.483ON57457125950.0
YGR124W (ASN2)3.483ON57257225940.0
Skud_7.4353.483ON57257125900.0
Suva_7.4103.483ON57257225880.0
CAGL0I10648g3.483ON57457225670.0
NCAS0F035103.483ON57557325600.0
SAKL0F02970g3.483ON57357125550.0
KAFR0G036703.483ON57257125550.0
KLLA0B10868g3.483ON57457225430.0
TDEL0D055203.483ON57357125410.0
NDAI0B058103.483ON57757625410.0
KNAG0A079203.483ON57857625220.0
Kwal_55.211873.483ON57357125170.0
KLTH0F14630g3.483ON57357225110.0
TPHA0D042003.483ON57457124960.0
TBLA0C044303.483ON58057924500.0
ZYRO0B04136g3.483ON57257224360.0
AFR303W3.483ON57157124330.0
Ecym_12443.483ON57357123610.0
ZYRO0A00528g8.875ON5121031384e-08
Kpol_455.78.875ON518941261e-06
KAFR0L021108.875ON514951198e-06
NCAS0C001908.875ON5171051181e-05
ADL350C8.875ON508891171e-05
Skud_13.468.875ON5191131171e-05
TPHA0C049508.875ON525991162e-05
NDAI0K001808.875ON522941162e-05
KNAG0J002008.875ON5151021152e-05
SAKL0D00352g8.875ON515971143e-05
Suva_13.528.875ON519991144e-05
KLLA0D10285g8.875ON5151031134e-05
TDEL0B004408.875ON516941135e-05
YML096W8.875ON525951135e-05
Smik_13.398.875ON521961091e-04
Skud_7.311singletonON8189982e-04
TBLA0C063008.875ON5181261072e-04
Kwal_27.97058.875ON515991063e-04
Ecym_81558.875ON5131201037e-04
KLTH0E16412g8.875ON51595990.002
CAGL0H06963g8.875ON51778970.004
SAKL0E13200g2.59ON152114703.1
Smik_4.2393.198ON46162723.7
KLLA0F14531g8.222ON34166697.8
YDR004W (RAD57)3.198ON46032697.9
Suva_4.2573.198ON44847698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.474
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1138   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...  1105   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1102   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1090   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1011   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1004   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1003   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1002   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1001   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...   993   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   990   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   988   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   988   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   984   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   983   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   983   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   976   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   974   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   971   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   966   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   948   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   942   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   941   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   914   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    58   4e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    53   1e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    50   8e-06
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    50   1e-05
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    50   1e-05
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    50   1e-05
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    49   2e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    49   2e-05
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    49   2e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    49   3e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    49   4e-05
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    48   4e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   5e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    48   5e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    47   1e-04
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    42   2e-04
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    46   2e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    45   3e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    44   7e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    43   0.002
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    42   0.004
SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285) ...    32   3.1  
Smik_4.239 Chr4 (434533..435918) [1386 bp, 461 aa] {ON} YDR004W ...    32   3.7  
KLLA0F14531g Chr6 (1349155..1350180) [1026 bp, 341 aa] {ON} weak...    31   7.8  
YDR004W Chr4 (455201..456583) [1383 bp, 460 aa] {ON}  RAD57Prote...    31   7.9  
Suva_4.257 Chr4 (452826..454172) [1347 bp, 448 aa] {ON} YDR004W ...    31   8.7  

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1138 bits (2944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/572 (95%), Positives = 547/572 (95%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPF          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                          NDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/572 (92%), Positives = 539/572 (94%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KHEDVHRYK KALQLSKRIRHRGPDWSGNA KNSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRI+AARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDY+AIRHSLEKAVRKRLMAEVPF          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                          NDVEPSTYD+KARHLAGVDD+GNLHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP EKMIR KEGRIEKYILRKAFDTT EP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWIDSLKD AEAVISDEMFA+PKAEWG+DIPTTKEA+WYRLKFD LFPQKTV
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1102 bits (2849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/572 (91%), Positives = 540/572 (94%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDVH YKPKALQLSKRIRHRGPDWSGNA+KNSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECP+YQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRI+AARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                          NDV+PSTYD+KARHLAGVDD+G LHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP+EKMI+PKEGRIEKYILRKAFDTT EP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKDTAE VISDEMFA+PKAEWG+DIP+TKEA+WYRLKFD LFPQKTV
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKHID
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1090 bits (2820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/572 (90%), Positives = 537/572 (93%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDVHRYKPKALQLSKRIRHRGPDWSGNA+KNSTIFVHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D +YMLCVNGEIYNHIQLREEC DY+F TLSDCEPIIPMYLKHDIDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRI+AARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDY+AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                          NDVEPSTYD+KARHLAG+DD+G LHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP+EKMI+PKEGRIEKYILRKAFDTT EP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKDTAEAVISDEMFA+PKAEWG+DIPTTKEA+WYRLKFD LFPQKTV
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/572 (84%), Positives = 517/572 (90%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+D+H +KPKALQLSKRIRHRGPDWSGNAV NSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLREEC DY+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ +YDAK+DRI+AARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DYLAIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDV-EPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPD 299
                           DV E S+ D K   LAG+DD+G+LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 420 RVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQK 479
           RVPFLD++FLQLCMNIDP +KMI+PKEG+IEKYILRKAFDTT+EP+ KPYLPEEILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478

Query: 480 EQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKT 539
           EQFSDGVGYSWID L+DTAE VISD MFANPKA+WG+DIPTTKEAYWYRLKFD  FPQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
            A+TVMRWVPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/571 (82%), Positives = 511/571 (89%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+   +KP+ALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  DY+LCVNGEIYNHIQLRE CPDY++KTLSDCEPIIP+YLKHDIDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRIIAARDPIGITTLYMGR+S SPKTV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ P+ Y AIR SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +++ + YD++ +HL G+DD+GNLHTAGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP+EKMI   EGRIEKYILRKAFDT+DEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKDTAE VISDE+F+ PK  WG DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/572 (83%), Positives = 513/572 (89%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+H +KPKALQLSK+IRHRGPDWSGNAV NSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLRE C DY+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+K+DRI+AARDPIG+ TLYMGRSS SP+TVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDV-EPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPD 299
                           D  E +  D K   LAG+DD+G+LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 420 RVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQK 479
           RVPFLD++FLQLCMNIDP+EKMI+PKEGRIEKYILRKAFDTTDEP+ KPYLPEEILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478

Query: 480 EQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKT 539
           EQFSDGVGYSWID L+DTAE  ISD MFANPKA+WG+DIPTTKEAYWYRLKFD  FPQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
            ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 539 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/571 (83%), Positives = 509/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED++ +KPKALQLSKRIRHRGPDWSGNAV NSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI S D +YML VNGEIYNHIQLRE+C  Y+F+T SDCEPIIP+YL+HDIDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYDAK+DR++AARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTP+WLDEKRIPS P+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           D +     N  + LAG+DD+G+LHT+GW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADADGDASVNN-KQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP +KMI PKEGRIEKYILRKAFDTTDEPE KPYLPEEILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID L+DTAE VISD MFANPKA+WGNDIPTTKEAYWYRLKFD  FPQKT 
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           ADTVMRWVPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 510/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+  +KPKALQLSKRIRHRGPDWSGNA+ NSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D DYML VNGEIYNHIQLRE+C DY+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+K+DR+IAARDPIG+ TLYMGR S SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +        K++ LAG+DD+G+LHT+GW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSK-LAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDP +KMI  KEGRIEKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWIDSL+DTAE VISD MFANPKA WG+DIPTTKEAYWYRLKFD  FPQKT 
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRWVPKADWGCAEDPSGRYAQIHEKH++
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/572 (81%), Positives = 505/572 (88%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH+DVH +KPKALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D DY LCVNGEIYNHIQLRE+ PDY+FKTLSDCEPIIP YL+HDIDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRI+AARDP+GITTLYMGR S+SPKTV+FASELKCLTDDCD ITAFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDW+DE RIP+TP+++  IR SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKA-RHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPD 299
                           + + +  D  A + LAG+D++G+LHTAGW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDP +KMI    GRIEKYILRKAFDT+DEP+ KPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKT 539
           EQFSDGVGYSWID LKDTAE VISD MF+NPK EWG DIPTTKEAYWYRLKFD LFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
            A TVMRW+PKADWGCAEDPSGRYA+IHE+H+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/573 (81%), Positives = 503/573 (87%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDV  YKPKALQL+KRIRHRGPDWSGN VKN+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+REEC DYQFKTLSDCEPIIP+YLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRI+AARDPIGITTLYMGR S +P+TVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTP+D  AIR +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKA-RHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPD 299
                           DV+    + +  +HL GVDDEG+LHT GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDP +KMI    G+IEKYILRKAFDTTD+PE KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKT 539
           EQFSDGVGYSWID LKDTAE VISD MF NPK  WGND+PTTKEAYWYRLKFD L+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
            ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+D
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/571 (81%), Positives = 498/571 (87%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA +KHE V  +KPKALQLSKRIRHRGPDWSGN VKN+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D DY LCVNGEIYNHI+LREE   Y FKTLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRIIAARDPIGITTLYMGRSS+SP TV+FASELKCL DDCD ITAFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVP+          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           D++P  YD++ +HLAGVDD+GNLH AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI S HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDP+EKMI   EGRIEKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKD AEA ISDE FA PK EWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/571 (81%), Positives = 505/571 (88%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDV  +K KALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQLRE+ PDY+FKTLSDCEPIIP+YL+ DIDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCD+I AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +++ S Y  +  HLAG+DDEG+L T+GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDP++K+I  KEGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKDTAE VISDEMFANPK+ WG DIPTTKEAYWYRLKFD LFPQ T 
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRW+PKADWGCAEDPSGRYAQIHEKHI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/572 (80%), Positives = 504/572 (88%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA+F++ DV  YKPKALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D  Y L VNGEIYNHI LREEC  Y FKTLSDCEPIIP+Y K+DIDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+K+DRIIAARDPIGITTLYMGRSSASPK+V+F+SELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TP+D+ A+R SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +++P  YD+    LAG+D++G+LH AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP++KMI+P EG+IEKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKD AE+ ISDE FA PKAEWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H+D
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/571 (80%), Positives = 504/571 (88%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA KHEDV  YK KALQLSKRIRHRGPDWSGN ++N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHI+LREE  DY+F TLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRIIAARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDE RIPS P+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +++   YD++ +HLAG+DD GNLH+AGW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP +KMI  +EGR+EKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKDTAE VISD++FA PK+ WG+D+PTTKEA+WYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           ADTVMRWVPKADWGCAEDPSGR+AQIH++H+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/576 (81%), Positives = 498/576 (86%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDVH +KP+ALQLSKRIRHRGPDWSGN +KN+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+RE+ PDY FKTLSDCEPIIP+YLKHDID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+KQDRIIAARDPIGITTLYMGR+S +P+TV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXX----X 236
           YDSKTD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVPF          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 237 XXXXXXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPN 296
                               D E +  +    HL GVDDEG+LH  GW+ LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILW 476
           LEARVPFLDR+FLQLCMNIDP EKMI   EGRIEKYILRKAFDT+D+PE KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFP 536
           RQKEQFSDGVGYSWID LKDTAE VISD MF NPK  WG DIPTTKEAYWYRLKFD L+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           QKT ADTVMRW+PKADWGCAEDPSGRYA+IHEKH++
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/576 (79%), Positives = 503/576 (87%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA F+HEDV  +KP+ALQLSKRIRHRGPDWSGN +KNSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  DY+L VNGEIYNHIQLREECP+YQ+K+LSDCEPIIPMYLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTP+D   IRH+LEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNK----ARHLAGVDDEGNLHTAGWTSLHSFAIGLPN 296
                           +++P  YD +      HLAG+DDEGNL +A W+ LHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILW 476
           LEARVPFLD+EFL LCMNIDP +K+I  KEGRIEKYILRKAFDT DEP+ KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFP 536
           RQKEQFSDGVGYSWID LKDTAE VISDEMFA PKA WG D+PTTKEA+WYRLKFD LFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           Q T A+TVMRW+PKADWGCAEDPSGR+A+IHE+H++
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/571 (79%), Positives = 498/571 (87%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+HEDV ++KP ALQL+KRIRHRGPDWSGN ++NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           P+ S ++DY+L VNGEIYNHIQLREE  DY FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD K+DR+IAARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D L IR+SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           ++ P  YD++ +HLAGVDD G LH+AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKDTAEA ISDE F  PKAEWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/572 (80%), Positives = 493/572 (86%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+H+ V  +KP AL+L KRIRHRGPDWSGN +KNST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           P  S D +Y+L VNGE+YNHIQLREE   Y FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D L IRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                          + ++P  YD++ +HLAGVDD GNL +AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKD AEA ISDE F  PKAEWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HID
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/571 (79%), Positives = 492/571 (86%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  +KHE+   +KP+ALQLSKRIRHRGPDWSGN VKNSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D D++LCVNGEIYNHIQ+RE+ PDYQFKTLSDCEPIIP+Y+K+  +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIIAARDPIGITTLYMGRSS SPKTVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD+ITRY+TPDW+DE RI + P+D + IRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                                +  +    L G+DD GNL ++GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDPSEKMI  KEGRIEKYILRKAFDTTDEP  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKDTAE VISDE+F NP+  WG+DIPTTKEAYWYRLKFD LFPQ T 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/579 (76%), Positives = 498/579 (86%), Gaps = 7/579 (1%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH +V+ +KP+ALQL+KRIRHRGPDWSGN VKN+T+F HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +YML VNGEIYNHIQLREE  DY++KTL DCEPIIPMYLK+D+DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+++DR+IAARDP+GITTLYMGR+S +PKTVYFASELKCL DDCD+I AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKI RYF P+W+DE  IP+TP+D   +R +LE+AVRKRLMAEVP+          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKA-------RHLAGVDDEGNLHTAGWTSLHSFAIG 293
                          ++     Y+ ++       + L G+DD GNL T  W+ LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL+AARKVA FIGS HHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEE 473
           AWGLEARVPFLDR+FL LCMNIDP++KMI+PKEG+IEKY+LRKAFDT+DEP+ KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDG 533
           ILWRQKEQFSDGVGYSWIDSLKDTAE VISDEMFANPK  WG+DIPTTKEAYWYRLKFD 
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           LFPQKT ADTVMRW+PKADWGCAEDPSGRYA+IHE+HID
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHID 579

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/572 (77%), Positives = 487/572 (85%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+H DV  Y+P ALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI SP  +Y LCVNGEIYNHIQLREEC DY F++LSDCEPIIP+YLK+ +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMG+SS SPKT +FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVP+          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +++P  YD++ +HLAG+D +GNLHT GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDR+FL LCM +DP+EKMI+P+EGRIEKYILRKAFDTTDEP  KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKD AE  ISDEM A P+ EWG+D PTTKEAYWYRLKFD  FP K+ 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572
           A+TVMRW+PKADWGC  DPSGR+A+IHE+HID
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  941 bits (2433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/571 (77%), Positives = 488/571 (85%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ +D+  +KP AL+LSKR+RHRGPDWSGN +KN TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI SPD +Y+LCVNGEIYNHI LREEC DY+F +LSDCEPIIP+YLK+D++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD ++DRI+AARDPIG+TTLYMG+SS+SP+T YFASELKCL D+CD ITAFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS P+DY A+R +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +      D K  HLAG+DD G LHT GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVYADGK--HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP+EKMI P++GRIEKYILRKAFDT+DEP   PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID LKD AE  ISDE FANP   WG+DIPTTKEA+WYRLKFD LFPQ T 
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWVPKADWGCAEDPSGRYA+IH++HI
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/571 (74%), Positives = 481/571 (84%)

Query: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ + +  +KP ALQLSKRIRHRGPDWSGN VKN TIFVHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI S D +Y+LCVNGEIYNHI LR+ C DY F TLSDCEPIIP++ K+ ++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK DRI+AARDPIG+TTLYMG+ S SP+T YFASELKCL ++CD I +FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD+ITRYF P WL +   P+ P+DY  +R  LEKAVRKRLM EVP+          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300
                           +++   YD++ R+L GVDDE +LH +GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480
           VPFLDR+FL+LCMNIDP EKMI+PKEG+IEKYILRKAFDT+DEP+ +PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540
           QFSDGVGYSWID+LKD AE  ISDE FA PK EWG+DIP+TKEAYWYR+KFD LFPQ T 
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWVPKA+WGC+EDPSGR+A+IHEKHI
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRK 456
           A G+E R PFLDR  ++  M   P          +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIPI-------NWKINKLILRK 471

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 74/170 (43%), Gaps = 29/170 (17%)

Query: 69  YMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHD----IDAPKYLDGMFAWTL 124
           Y+L  NGE+YN             + L +    +   L++D     +   +L+G FA+T+
Sbjct: 88  YILQFNGELYNE------------EILDNDTSFVASLLENDKMSVFEVISFLEGEFAYTI 135

Query: 125 YDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPG--HVYD 182
           YD  + ++   RD IG  +L   R   +   +Y AS    +T   +  T    G  ++YD
Sbjct: 136 YDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVAS----VTGQQEGFTDCLAGIVYIYD 190

Query: 183 SKTDKITRYFTPDWLDEKRIPSTPI----DYLAIRHSLEKAVRKRLMAEV 228
            +   + +   P  +  + + S  I    ++  I H+L + ++  ++  V
Sbjct: 191 VEDKSLNQQMLP--ILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFAN-KSIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRK 456
           FLD E +Q  ++  P          ++ K ILRK
Sbjct: 450 FLDEEVIQYSVSQIPISY-------KVNKGILRK 476

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 90/214 (42%), Gaps = 28/214 (13%)

Query: 27  IRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQPITSP----DEDYMLCVNGEIYNHIQ 82
           I  RGP++S   V       H       + S  QP T      DE Y+L  NGE+YN  +
Sbjct: 50  IVSRGPNYSSLRVNRE----HGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYNS-E 104

Query: 83  LREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPIGIT 142
           +      Y    L  C+  +       +   + LDG FA+T+YD K+  I   RD IG  
Sbjct: 105 ISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLKEGNIYFGRDTIGKR 157

Query: 143 TLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHVYDSKT-----DKITR--YFTPD 195
           +L       S + ++ +S         D +      + YD+KT      K+ R  Y   D
Sbjct: 158 SLCYSIDENSGE-LFISSVTGTRGTFVDCLGGVI--YTYDTKTHTLDDTKVIRDKYVVTD 214

Query: 196 WLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVP 229
             DE    S  ++ L    +L ++V+KR+++  P
Sbjct: 215 MTDELENESQYMELLY--GTLYESVKKRVLSIHP 246

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKA 457
           FLD   +Q       S + I P   ++ K ILRK 
Sbjct: 447 FLDHNVVQF------STQEI-PINYKVNKLILRKV 474

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 15/122 (12%)

Query: 27  IRHRGPDWSGNAV--KNSTIFVHERLAIVGLDSGAQPITSPDEDYMLCVNGEIYNHIQLR 84
           I +RGP++S   +  K  T +    LA+  L    Q +   D  Y+L  NGE+YN  +++
Sbjct: 46  IANRGPNYSSLRLSEKYHTAWFSSVLAL-RLPFTKQSLCVEDR-YVLQFNGELYNK-EIK 102

Query: 85  EECPDYQF--KTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPIGIT 142
           ++  D QF    LS    +I    +        LDG FA+T+YD ++ +I   RD IG  
Sbjct: 103 QDQNDTQFIASLLSSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIGKR 154

Query: 143 TL 144
           +L
Sbjct: 155 SL 156

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 9/105 (8%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMAWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRK 456
               G+E R PFLD E ++          M  P   ++ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFST-------MEIPINYKVNKMILRK 475

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 27  IRHRGPDWSGNAV--KNSTIFVHERLAIVGLDSGAQPITSP----DEDYMLCVNGEIYNH 80
           I  RGP++S   V  K  T +    L++       QP T      +E Y+L  NGE+YNH
Sbjct: 48  ISARGPNYSSLRVSKKYKTAWYSSVLSL------RQPFTCQSIEIEERYVLQFNGELYNH 101

Query: 81  IQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPIG 140
            ++      Y    L +  P IP  +K        L+G FA+++YD +       RD +G
Sbjct: 102 -EIVHNDTQYIVGLLKESAPSIPAIIKK-------LNGEFAYSIYDIQNGTFYFGRDTVG 153

Query: 141 ITTL 144
             +L
Sbjct: 154 KRSL 157

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFAN-KSTEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDREFLQLCMNIDPS---EKMIRPKEGR 448
           FLD + ++  + +  S   +KMI  K  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 58/113 (51%), Gaps = 12/113 (10%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKA---FDTTDEPETKP 468
            R PFLD    +  +N+   E    P   ++ K ILRK    F   DE   +P
Sbjct: 448 VRYPFLD----EYVINLSTLEI---PINYKVNKLILRKVASLFLKLDEIAEEP 493

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 72/164 (43%), Gaps = 18/164 (10%)

Query: 27  IRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQPIT----SPDEDYMLCVNGEIYNHIQ 82
           I  RGP++S   V    I  H+      + S  +P T    + D+ Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREECPDYQFKTLSDCEPIIPMY-LKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPIGI 141
             +E  D+   +L     +  +   ++ +D  + L+G +A+T+YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHVYDSKT 185
            +L    S      +Y AS    +    D I     G  +D++T
Sbjct: 158 RSL--SYSVTLNNELYVASVTGAVEGFQDCIGGVVYG--FDTRT 197

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILR 455
           +E R PFLD E++     ++ S K I P   +I K ILR
Sbjct: 446 IEVRYPFLD-EYV-----VNFSTKEI-PINYKINKKILR 477

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 25/128 (19%)

Query: 27  IRHRGPDWSGNAVKNSTIFVHERLA-IVGLDSGAQPITSP----DEDYMLCVNGEIYNHI 81
           I  RGP++     +   +F  E+++    + S  +P T      ++ Y+L  NGE+YN+ 
Sbjct: 47  IARRGPNY-----QMFRVFKSEQISWYSSILSLRKPFTKQSIEVNDRYILQFNGELYNN- 100

Query: 82  QLREECPDYQFKTLSDCEPII-----PMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAAR 136
                    +   +SD    +      +  K  I+  + L+G FA+T++D+K+  +   R
Sbjct: 101 ---------EIHGISDTTYFVNCLKTALDEKDIINILRTLEGEFAYTIFDSKKKLVYFGR 151

Query: 137 DPIGITTL 144
           D IG  +L
Sbjct: 152 DTIGKRSL 159

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRK 456
           FLD + ++       +E++  P   +I K ILRK
Sbjct: 455 FLDIDVIKF-----STEEL--PINYKINKLILRK 481

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 78/166 (46%), Gaps = 15/166 (9%)

Query: 69  YMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAK 128
           Y++  NGE+YN  +++     Y  + L + + II        D  + LDG FA+T+YD +
Sbjct: 91  YVVQFNGELYND-EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQ 141

Query: 129 QDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLT--DDCDTITAFP-PGHVYDSKT 185
                  RDPIG   L     + + + +Y +S   C T   DC   T +     + +  T
Sbjct: 142 NRMFYFGRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCIAGTIYKYDCQLKELNT 200

Query: 186 D-KITR-YFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVP 229
           D KI++ ++  + LD++ +     +   +   L  +V KR+++  P
Sbjct: 201 DSKISKPFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (51%), Gaps = 9/102 (8%)

Query: 355 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 414 AWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILR 455
           + G+E R PFLD   ++       +E +  P   +I K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFS-----TEDL--PINYKINKLILR 473

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 56/125 (44%), Gaps = 22/125 (17%)

Query: 27  IRHRGPD---WSGNAVKNSTIFVHERLAIVGLDSGAQPITSP----DEDYMLCVNGEIYN 79
           I  RGP+   W G+A + ST +    L++       QP T      D  Y+L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSA-EYSTAWFSSVLSL------RQPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  HIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPI 139
             ++      Y    L+  E  IP       D    LDG FA+T+YD +  +    RD I
Sbjct: 100 D-EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAI 151

Query: 140 GITTL 144
           G  +L
Sbjct: 152 GKRSL 156

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 10/97 (10%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILR 455
            R PFLD + +Q    +        P   ++ K ILR
Sbjct: 445 VRYPFLDEKVVQFSTEL--------PINYKVNKKILR 473

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 84/171 (49%), Gaps = 29/171 (16%)

Query: 27  IRHRGPDWSGNAVKNSTIF-VHERLAIVGL-DSGAQPITSPDEDYMLCVNGEIYNH-IQL 83
           I +RGP+++  +++NS+ + +    +I+ L D   +     ++ ++L  NGE+YN  IQ 
Sbjct: 49  IINRGPNYA--SIRNSSKYGISWFSSILSLRDPLTRQSVKINDRFVLQYNGELYNSSIQH 106

Query: 84  REECPDYQFKTLSDCEPIIPMYLKHDIDAPKY---LDGMFAWTLYDAKQDRIIAARDPIG 140
                       +D   I  +  ++  D PK    ++G FA+T++D + +++   RD IG
Sbjct: 107 ------------NDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGRDTIG 154

Query: 141 ITTLYMGRSSASPKTVYFASELKCLT---DDCDTITAFPPGHVYDSKTDKI 188
             +L     S + K   F S +   +   +DC+  T +    +YDSKT  +
Sbjct: 155 KRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNL 199

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKA 457
            R PFLD   ++    +D       P   +I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA-VDI------PINFKINKLILRNV 479

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 74/167 (44%), Gaps = 26/167 (15%)

Query: 27  IRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQPIT----SPDEDYMLCVNGEIYNHIQ 82
           I  RGP++S   V  +    ++      + S  QP T    S D+ Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYNK-E 101

Query: 83  LREECPDYQFKTLSDCEPIIPMYLKHD---IDAPKYLDGMFAWTLYDAKQDRIIAARDPI 139
           + ++  D Q+         +   L  D   ID  + L+G +A+T+YD K  +    RDPI
Sbjct: 102 ISDDDNDSQYIAS------LLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRDPI 155

Query: 140 GITTLYMGRSSASPKT-VYFASELKCLTDDCDTITAFPPGHVYDSKT 185
           G  +L     S +P   +Y AS    +    D I     G VY+  T
Sbjct: 156 GRRSL---SYSVTPNNELYVASATGAIEGFQDCIG----GIVYEYDT 195

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 10/103 (9%)

Query: 353 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 412
           S+     G+ M  SG G+DE++GGY  F+   S  E   E  +++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSN-KSNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 413 MAWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILR 455
              G+E R PFLD   +Q  +++        P   ++ K+ILR
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDL--------PLNYKVNKHILR 473

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 8/77 (10%)

Query: 69  YMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDID-APKYLDGMFAWTLYDA 127
           Y+L  NGE+YN   + E C        SD E I  +  KH ++   +   G FA+ + D 
Sbjct: 90  YLLQYNGELYNDDTV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDL 142

Query: 128 KQDRIIAARDPIGITTL 144
           ++ ++   RD IG  +L
Sbjct: 143 QERKVYFGRDSIGKRSL 159

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLAN-KSPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRK 456
           FLD + ++       +E++  P   ++ K ILR+
Sbjct: 449 FLDHDVIKF-----STEEI--PINYKVNKMILRR 475

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 99/220 (45%), Gaps = 35/220 (15%)

Query: 27  IRHRGPDWSGNAV--KNSTIFVHERLAIVGLDSGAQPITSPD----EDYMLCVNGEIYNH 80
           I+ RGPD+S   V  ++ST +    L++       +P TS        ++L  NGE+YN 
Sbjct: 47  IKSRGPDYSSLRVSSEHSTAWYSSVLSL------REPFTSQSVKVGNRFILQFNGELYNQ 100

Query: 81  IQLREECPDYQFKTLSDCEPIIPMYLKHDI-DAPKYLDGMFAWTLYDAKQDRIIAARDPI 139
            ++     D QF      E        HD+    + L G FA+TLYD +Q +    RD +
Sbjct: 101 -EITAHDNDTQFIVSKLQEGY------HDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNV 153

Query: 140 GITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHVYDSKTDKI-------TRYF 192
           G  +L    S+ + + +Y +S    +    D I      +VYD+++  +       ++YF
Sbjct: 154 GKRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYF 210

Query: 193 TPDWLDEKRIPSTPIDYLA--IRHSLEKAVRKRLMAEVPF 230
               LDE+    T +D     +   L  AVRKR+++  P 
Sbjct: 211 ITKKLDEEL---TCLDSTVEQLYGMLSLAVRKRVLSIHPL 247

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKA 457
           FLD   ++L      S   I P   ++ K ILRK 
Sbjct: 452 FLDEYVIKL------STAEI-PINFKVNKLILRKV 479

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 57/124 (45%), Gaps = 16/124 (12%)

Query: 27  IRHRGPDWSG-NAVKNSTIFVHERLAIVGLDSGAQPIT----SPDEDYMLCVNGEIYN-H 80
           I  RGP++S   AVK   I     +      S  QP T    + D+ Y L  NGE+YN  
Sbjct: 47  IAARGPNYSSLRAVKAYRISWFSSVL-----SLRQPFTKQSINVDDRYFLQFNGELYNKE 101

Query: 81  IQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPIG 140
           I   +    Y    L + +  + +     ID  K L+G +A+T+YD    ++   RDPIG
Sbjct: 102 ISQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEGEYAYTIYDVNSSKLYFGRDPIG 156

Query: 141 ITTL 144
             +L
Sbjct: 157 RRSL 160

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  +++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKA 457
           PFLD   ++          +  P   ++ K ILRK 
Sbjct: 451 PFLDEYVIKFST-------VEIPINYKVNKLILRKV 479

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 75/171 (43%), Gaps = 26/171 (15%)

Query: 27  IRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQPIT----SPDEDYMLCVNGEIYNHIQ 82
           I  RGP++S       T+  +       + S  +P T    + D+ Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNK-E 101

Query: 83  LREECPD--YQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPIG 140
           +     D  Y    L D E    +     ID  K L+G +A+T+YD K  +    RDPIG
Sbjct: 102 VSHWGNDSLYIASLLKDLEDDGSV-----IDVIKSLEGEYAYTVYDVKSAKFYFGRDPIG 156

Query: 141 ITTLYMGRSSASPKTVYFAS---ELKCLTDDCDTITAFPPGHVYDSKTDKI 188
             +L    S  +   +Y AS    ++C   DC   T +     YD++T  +
Sbjct: 157 RRSL--SYSVTANNELYVASVTGAVECF-HDCIGGTVYE----YDTQTKSL 200

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 14/89 (15%)

Query: 102 IPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASE 161
           +P YL+ DIDAPK+L+ MFA++    ++              ++ G S    +T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDTITAFPPGHVYDSK 184
             L C    LT  CD   +F PG V+DS+
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 22  QLSKRIRHRGPDWSG-NAVKNSTIFVHERLAIVGLDSGAQPITSPDEDYMLCVNGEIYNH 80
            L K I  RGP+++    +K+  I +   +  +      Q +   D  Y+L  NGE+YN 
Sbjct: 43  NLMKLISARGPNFASLRTLKDHRISLFSSVLSLREPFCKQSVLVEDR-YVLQFNGELYND 101

Query: 81  IQLREECPDYQF--KTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIIAARDP 138
             +     D QF  K L + E       K  I   K LDG FA+++YD K  R+   RDP
Sbjct: 102 EIIHN---DTQFIVKLLLNTE----QNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDP 154

Query: 139 IGITTL 144
           IG  +L
Sbjct: 155 IGKRSL 160

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 423 FLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRK 456
           FLD   ++   +  P          +I K ILRK
Sbjct: 451 FLDEHVIKYSTHDIPINY-------KINKLILRK 477

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 10/99 (10%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILR 455
           +E R PFLD   ++    +        P   ++ K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQL--------PINYKVNKMILR 472

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  +++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNN-KSPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MAWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILR-------KAFDTTDEPE 465
              G+E R PFLD E + L  ++        P   +  K ILR       +  D  +EP+
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL--------PINYKTNKNILRLLATNKLQLMDIGEEPK 486

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 48/95 (50%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKA 457
           FLD + +     +        P   ++ K ILRK 
Sbjct: 448 FLDDQVVAFSTQL--------PINYKVNKMILRKV 474

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 15/82 (18%)

Query: 66  DEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAP---KYLDGMFAW 122
           ++ ++L  NGEIYN              + +D + I  M L    D P   + L G FA+
Sbjct: 88  EDRFVLQYNGEIYN-----------SSISHNDTQYIAEMLLNAK-DIPSVIRTLSGEFAY 135

Query: 123 TLYDAKQDRIIAARDPIGITTL 144
           T+YD     +   RDPIG  +L
Sbjct: 136 TIYDKLTGEVFFGRDPIGRRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFLDREFLQL 431
           + G+E R PFL  E ++ 
Sbjct: 442 SNGVEVRYPFLAEEVVEF 459

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 74/169 (43%), Gaps = 38/169 (22%)

Query: 1   MCGIFAA--------------FKHEDVHR--YKPKALQLSKRIRHRGPDW-SGNAVKN-S 42
           MCGI                 F  ++V R  Y      + K +R RGP++ S   +K+ +
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 43  TIFVHERLAIVGLDSGAQPITSPD----EDYMLCVNGEIYNHIQLREECPDYQFKT--LS 96
           +I++   L++       QP T         Y+L  NGE+YN  ++ E   D QF +  L 
Sbjct: 61  SIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPMYLKHDI-DAPKYLDGMFAWTLYDAKQDRIIAARDPIGITTL 144
            C        + DI +    LDG FA+T+ D + + I   RD IG  +L
Sbjct: 114 KCIS------EDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285)
           [459 bp, 152 aa] {ON} highly similar to uniprot|Q07648
           Saccharomyces cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr)
           deacylase functions in protein translation may affect
           nonsense suppression via alteration of the protein
           synthesis machinery ubiquitous among eukaryotes
          Length = 152

 Score = 31.6 bits (70), Expect = 3.1,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 39/114 (34%), Gaps = 14/114 (12%)

Query: 452 YILRKAFDTTDEPETKPYLPEEILWRQKEQFSDGVGYSWIDSLKDTAEAVISDEMF---- 507
           Y+L     T D  E    L ++I     + F D  GY W  S+KD    ++S   F    
Sbjct: 27  YMLLVGISTEDNTEDAEKLSKKI--ASLKVFDDDTGYGWKKSIKDVEGEILSVSQFTLMA 84

Query: 508 -----ANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTVADTVMRWVPKADWGCA 556
                  P        PT KE Y    KF  L  Q    D V      A   CA
Sbjct: 85  RTKKGTKPDFHMAQKGPTAKELY---EKFLDLLKQDLGEDRVKDGAFGAMMSCA 135

>Smik_4.239 Chr4 (434533..435918) [1386 bp, 461 aa] {ON} YDR004W
           (REAL)
          Length = 461

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 40  KNSTIFVHERLAIVGLDSGAQPITSPDEDYMLC------VNGEIYNHIQLREECPDYQFK 93
           KNSTI   +  ++ G ++    I S DEDYML       VN   Y +   ++  P  + K
Sbjct: 304 KNSTILYRQMNSLFGANANNDEILSDDEDYMLIERVVNGVNDRSYEYSLRKKNSPISKNK 363

Query: 94  TL 95
           TL
Sbjct: 364 TL 365

>KLLA0F14531g Chr6 (1349155..1350180) [1026 bp, 341 aa] {ON} weakly
           similar to uniprot|Q02775 Saccharomyces cerevisiae
           YDR088C SLU7 Protein involved in 3' splice site choices
           acts in concert with Prp18p during the 2nd step of
           splicing
          Length = 341

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 14/66 (21%)

Query: 29  HRGPDWSGNAVKNSTIFVHERLAI----VGLDSGAQPITSPDEDYMLCVNGEIYNHIQLR 84
           H+GPD S   +    I   ERL +    VG D+  QP++ P E          YN ++LR
Sbjct: 151 HKGPDTSHREMDEVQIQEMERLGLKPEDVGFDA-TQPLSGPKEK---------YNPVRLR 200

Query: 85  EECPDY 90
           E+   Y
Sbjct: 201 EDKAAY 206

>YDR004W Chr4 (455201..456583) [1383 bp, 460 aa] {ON}  RAD57Protein
           that stimulates strand exchange by stabilizing the
           binding of Rad51p to single-stranded DNA; involved in
           the recombinational repair of double-strand breaks in
           DNA during vegetative growth and meiosis; forms
           heterodimer with Rad55p
          Length = 460

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 40  KNSTIFVHERLAIVGLDSGAQPITSPDEDYML 71
           KNSTI   +  +++G  S    I S DEDYML
Sbjct: 304 KNSTILYRQMNSLLGASSNNDEILSDDEDYML 335

>Suva_4.257 Chr4 (452826..454172) [1347 bp, 448 aa] {ON} YDR004W
           (REAL)
          Length = 448

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 40  KNSTIFVHERLAIVGLDSGAQPITSPDEDYMLC------VNGEIYNH 80
           KNSTI   +  +++G ++    I S DEDYML       V+G  Y +
Sbjct: 291 KNSTILYRQMNSLLGANANNDEILSDDEDYMLIERVLKGVDGRAYKY 337

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,894,326
Number of extensions: 2603413
Number of successful extensions: 5565
Number of sequences better than 10.0: 51
Number of HSP's gapped: 5629
Number of HSP's successfully gapped: 69
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)