Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.4513.455ON1218121860850.0
Smik_16.3713.455ON1208121848680.0
Skud_16.4123.455ON1208121848130.0
YPR122W (AXL1)3.455ON1208121847560.0
NCAS0A116303.455ON1201120729810.0
NDAI0A046503.455ON1199122528660.0
KAFR0A053703.455ON1201122328170.0
Kpol_1050.883.455ON1213121627180.0
ZYRO0C06336g3.455ON1189121826120.0
TDEL0F034003.455ON1170117425640.0
SAKL0F06886g3.455ON1183121624960.0
TBLA0C054503.455ON1202119824840.0
KNAG0A077403.455ON1197119224300.0
Ecym_44043.455ON1196121023930.0
AGR251C3.455ON1193116022660.0
Kwal_55.204643.455ON1189117422070.0
TPHA0D040603.455ON1201116122080.0
KLTH0E05104g3.455ON1185117022040.0
KLLA0D15631g3.455ON1170118119610.0
CAGL0D04686g3.455ON1181122914910.0
TBLA0I029404.246ON9654013624e-34
KLLA0E05105g4.246ON10042253572e-33
ZYRO0B12320g4.246ON9942253511e-32
Skud_12.4744.246ON10222263501e-32
TDEL0E012504.246ON9952323492e-32
NCAS0J014704.246ON9952493492e-32
CAGL0H06457g4.246ON10082253447e-32
NDAI0J022404.246ON9992253375e-31
YLR389C (STE23)4.246ON10272263357e-31
KAFR0A059704.246ON10112323331e-30
Kwal_23.42374.246ON10012383322e-30
Smik_12.4764.246ON10252263303e-30
Suva_10.5064.246ON10232263303e-30
KLTH0D14278g4.246ON10012453285e-30
KNAG0B060804.246ON9962253285e-30
SAKL0H03124g4.246ON10062393286e-30
AER053C4.246ON10132253286e-30
Kpol_1055.834.246ON10202293278e-30
TPHA0B022604.246ON10412253278e-30
Ecym_32734.246ON10232252939e-26
TBLA0A080504.246ON9951942741e-23
Kwal_56.226883.93ON1040921030.002
CAGL0I07535g3.93ON102192990.007
SAKL0C09504g3.93ON106992930.031
AFR334W3.93ON102987920.038
SAKL0G05236g5.541ON986102900.070
KLTH0C09570g3.93ON104292900.070
Ecym_35853.93ON1032130890.11
TBLA0A069405.541ON99189870.16
TPHA0C024508.376ON469180860.18
TPHA0P010403.93ON103892860.22
YOL098C3.93ON103796850.33
NCAS0F011405.541ON988117840.41
ZYRO0B06490g3.93ON102893830.56
Kpol_1004.325.541ON98889810.75
NCAS0C049503.93ON103292810.76
Kwal_47.185775.541ON98787800.98
Skud_15.553.93ON1038112801.0
TBLA0B082403.93ON103292801.1
SAKL0H14718g8.359ON908131801.2
Smik_15.583.93ON1038112791.4
NDAI0G042803.93ON103492791.4
ZYRO0D12870g5.541ON986116791.6
KLLA0F27071g3.93ON103792791.7
KLLA0B00957g5.541ON98284782.1
KNAG0C031705.541ON99486763.0
ADR184W5.541ON990128763.1
TDEL0D053103.93ON1035183763.2
CAGL0F07183gsingletonOFF41447753.5
Cgla_YGOB_ABC16.133ON54947744.6
NCAS0B001608.869ON22240724.9
KLTH0G04092g5.541ON99087745.7
CAGL0F03157g5.541ON990128745.7
Smik_2.677.488ON137757746.1
Suva_15.673.93ON1038104738.2
Skud_4.7055.541ON98976738.3
Smik_4.7045.541ON98976728.5
Suva_2.6065.541ON98961729.4
KAFR0D002601.25ON447112719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.451
         (1218 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...  2348   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...  1879   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...  1858   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...  1836   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...  1152   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...  1108   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...  1089   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...  1051   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...  1010   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....   992   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...   966   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   961   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   940   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...   926   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   877   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...   854   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   855   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...   853   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   759   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   578   0.0  
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   144   4e-34
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   142   2e-33
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   139   1e-32
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   139   1e-32
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   139   2e-32
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   139   2e-32
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   137   7e-32
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   134   5e-31
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   133   7e-31
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   132   1e-30
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   132   2e-30
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   131   3e-30
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   131   3e-30
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   130   5e-30
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   130   5e-30
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   130   6e-30
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   130   6e-30
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   130   8e-30
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   130   8e-30
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   117   9e-26
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   110   1e-23
Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL09...    44   0.002
CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa] ...    43   0.007
SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa] ...    40   0.031
AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic...    40   0.038
SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {...    39   0.070
KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa] ...    39   0.070
Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} simila...    39   0.11 
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    38   0.16 
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    38   0.18 
TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3...    38   0.22 
YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}...    37   0.33 
NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {O...    37   0.41 
ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} simil...    37   0.56 
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    36   0.75 
NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]...    36   0.76 
Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430...    35   0.98 
Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON...    35   1.0  
TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON} Anc_...    35   1.1  
SAKL0H14718g Chr8 complement(1277222..1279948) [2727 bp, 908 aa]...    35   1.2  
Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON...    35   1.4  
NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON} Anc_...    35   1.4  
ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]...    35   1.6  
KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa...    35   1.7  
KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON...    35   2.1  
KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.5...    34   3.0  
ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic ...    34   3.1  
TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3....    34   3.2  
CAGL0F07183g Chr6 (702000..703244) [1245 bp, 414 aa] {OFF} highl...    33   3.5  
Cgla_YGOB_ABC1 Chr6 (701085..701366,701877..703244) [1650 bp, 54...    33   4.6  
NCAS0B00160 Chr2 (11885..11890,11989..12651) [669 bp, 222 aa] {O...    32   4.9  
KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {...    33   5.7  
CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {...    33   5.7  
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    33   6.1  
Suva_15.67 Chr15 complement(105988..109104) [3117 bp, 1038 aa] {...    33   8.2  
Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {...    33   8.3  
Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {...    32   8.5  
Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {...    32   9.4  
KAFR0D00260 Chr4 (34896..36239) [1344 bp, 447 aa] {ON} Anc_1.25 ...    32   9.9  

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score = 2348 bits (6085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1153/1218 (94%), Positives = 1153/1218 (94%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILA                     HNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KFGDISLKNDIKGSNFSIKAG           QDASK                   KISD
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
            TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
            LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
            FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN
Sbjct: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540

Query: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600
            LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK
Sbjct: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600

Query: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660
            LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF
Sbjct: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660

Query: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720
            EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG
Sbjct: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720

Query: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780
            FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI
Sbjct: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780

Query: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840
            VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF
Sbjct: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840

Query: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900
            TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE
Sbjct: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900

Query: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960
            NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI
Sbjct: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960

Query: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNG 1020
            NEYLSYLEFQVLNNFTESTFRTMLLEP              TLSGPSNLLNEIVANVQNG
Sbjct: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIVANVQNG 1020

Query: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080
            DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR
Sbjct: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080

Query: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140
            QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN
Sbjct: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140

Query: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200
            LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP
Sbjct: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200

Query: 1201 IVPLRELPGPDVFRKYAF 1218
            IVPLRELPGPDVFRKYAF
Sbjct: 1201 IVPLRELPGPDVFRKYAF 1218

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1879 bits (4868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 909/1218 (74%), Positives = 1037/1218 (85%), Gaps = 10/1218 (0%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREV+NYE+ F+IPLSY NR HKICKLPNGILA                     HNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
             DIPGLAHLCEHMIL+AGSKKYPDPGLFH LIAKNNGSQNA+TTGEQTTFYFELPNTQ+N
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GE AFES LDVFASFFK+PLFNPLLI KEIYAIQSEHEGN+SSTTKIFYHAAR+LAN+DH
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGNIHSLSS+P L+KIN+K+SLNTYF++NF+GEN+TLC+RGSQSVNILTKLAIS
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KFGD+  K+ +K  +FSI  G            ++ K                   KI D
Sbjct: 241  KFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYRNLEDF----------KILD 290

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
            TVWE+KY +  CF++  + NSIFINS+K P++RFLFPVSD+NTRFTK+DIK+YSHLW EL
Sbjct: 291  TVWEKKYQNTMCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCEL 350

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDESPGSLSHYLVS+GW T  FAF SEFAIG+IGL+LELELT +GW+S+++I TTIFS+
Sbjct: 351  FGDESPGSLSHYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSE 410

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
            LLPSF  KNIDHL+ FL+EQNLID+ARFLYQ+SE+LPMEECS+LS  LQENLECLTP N+
Sbjct: 411  LLPSFYVKNIDHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNV 470

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
            FKGFKSLIEI+DPNIEKYE  K NV+WWTGQAIKFQNFLKS M H+NTR+LLLGDIKSH 
Sbjct: 471  FKGFKSLIEIDDPNIEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHK 530

Query: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600
            +F  IE++SEI T+FFYEFEYY G VHL+E++KY+ +S YEFNFP  N FLPD+++DPLK
Sbjct: 531  IFHIIENKSEIRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFNFPKSNLFLPDYISDPLK 590

Query: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660
            L+QL+LECSLKSKFATLRPQI SEP    PQLVS+NLNYEMW+LKEDPNF S+N SVVSF
Sbjct: 591  LRQLFLECSLKSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSF 650

Query: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720
            EV+GLGIKPSPEATIHLEVLAQ+LFI TSS+LYPALR GYTYEIASSSKG+VTLRFTISG
Sbjct: 651  EVLGLGIKPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISG 710

Query: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780
            F EGVFKI K FVDTLKLI TDPTF SKD LRKARI VRSKYESASSDN VKLASIGLLI
Sbjct: 711  FPEGVFKIVKTFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLI 770

Query: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840
            VLEE++WTLQDRI+ALELT+MES K FCSLFWKNPKQL LL+QG+LDYADEINHYLN NF
Sbjct: 771  VLEEFIWTLQDRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNF 830

Query: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900
            TQHLKVC+EG++ TI LYPSP+TKN+D GTNAFIS NGHQDDPNNS+ YFIQTAQRD+IE
Sbjct: 831  TQHLKVCNEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIE 890

Query: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960
            NL LTFLTEY+FS TLVPDLRN+KQIGYIVL GLR+LTDT+GIH+TVMSGSSAH+LETKI
Sbjct: 891  NLALTFLTEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKI 950

Query: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNG 1020
            NEYLSYLE QVL+N TE  FR MLLEP                +GP +LLNEIVANVQNG
Sbjct: 951  NEYLSYLELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNG 1010

Query: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080
            D+Y LNNRQMK HR++RN I+EKRL+FQEE EMV+I FLQKLTLKKYL FF ++ISIYS 
Sbjct: 1011 DNYTLNNRQMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYST 1070

Query: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140
            QRSK+SIMI SPMAEE+IASR++FLQLEAFLKIKGFAIK+ DL+KIVE S+GSP+LL+KN
Sbjct: 1071 QRSKISIMIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVKN 1130

Query: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200
            LFT FRKR+EAFKLGTVVL+EI KII +NFKQ YGSVLGFSS +SE Q +  +WK+D+EP
Sbjct: 1131 LFTHFRKRNEAFKLGTVVLQEILKIIGMNFKQGYGSVLGFSSHNSEGQDVKNFWKNDIEP 1190

Query: 1201 IVPLRELPGPDVFRKYAF 1218
            ++PL+ELP P+ FRKY F
Sbjct: 1191 VIPLQELPDPNFFRKYVF 1208

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1858 bits (4813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 904/1218 (74%), Positives = 1022/1218 (83%), Gaps = 10/1218 (0%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREV NYE+P YIPLSY NRTHKICKLPNGILA                     HNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            +D  GLAHLCEHMILAAGSK+YPD GLFHTLIAKNNGSQNA+TTGEQTTFYFELPN+QSN
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GE AFE  LDVFASFFK PLFNPLLI KEIYAIQSEHEGN+SSTTKIFYHAAR+LAN+DH
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGNIHSLSS+P L+KIN+KNSLN YFKNN++GEN+T+C+RG QSVNIL KLAIS
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KFGDI  KN ++G+NFSI+AG            D SK                   KI +
Sbjct: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESF----------KILE 290

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
            TVWEEKY +  CFE+P   N+IFINS+K+P++RFLFPVSDKNTRFTKEDIK+YSHLW EL
Sbjct: 291  TVWEEKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCEL 350

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDESPGSL  YLVS+GW T  FAF SEFAIGNIGL+LELELT +GW S++ I TTIFSK
Sbjct: 351  FGDESPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSK 410

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
            LLPSF  KNID+LI FL+EQNLIDIARFLYQ+SED+PMEECS+LS ILQENLE LTP N+
Sbjct: 411  LLPSFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNV 470

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
            FKGFKSLIEI+DPNI+KYEN++ N+QWW GQAIKFQNFLKS MNHENTR+L+LG++KS+ 
Sbjct: 471  FKGFKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYE 530

Query: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600
            +FDKIE  SE++T+FFYEFEYY G+V L+ D + +++S YEFNFPT N FLPD++NDPLK
Sbjct: 531  VFDKIEKRSEMYTDFFYEFEYYTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLK 590

Query: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660
            LQQL+LECSLKSKFATLRPQIQSEP + LPQLVSKNLNYEMWVLKEDPNF SDN S+VSF
Sbjct: 591  LQQLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSF 650

Query: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720
            E++GLGIKPSPEATIHLEVLAQ+LFI TSS LYPALR GYTYEIASSSKGNVTLRFTISG
Sbjct: 651  EILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISG 710

Query: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780
            FSEGV+ I K FVDTLK I TD TF SKD +RKARILVR KYE ASSDN VKLASIGLLI
Sbjct: 711  FSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLI 770

Query: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840
            VLEEYMWTLQDRIDALELT+  S K FC LFW NPK+L LLIQGNL+YADEINHYLNNNF
Sbjct: 771  VLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNF 830

Query: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900
            TQHLKV +E NRPTI LYPSP+TKN+D GTN F+S NGHQDDPNNS+ YFIQTA+R++IE
Sbjct: 831  TQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIE 890

Query: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960
            ++TLTFLTEY+FS TLVPDLRNKKQIGYIVL GLR+LT+T+GIHITVMSG  AH+LE KI
Sbjct: 891  SMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKI 950

Query: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNG 1020
            NEYLSYL+ QVLN FTES FR +LLEP              + SGP NLLNEIVANVQNG
Sbjct: 951  NEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNG 1010

Query: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080
            D+Y LNNRQMK HR+IRN I E+R  FQ+E EM DI FLQ LTLK+YLEFF S+ISIYSR
Sbjct: 1011 DNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSR 1070

Query: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140
            QRSKLSIMITSPMAEE+I SRKMFLQLEAFLKIKGFAIKS DL+ IV++SKGSPVLL+KN
Sbjct: 1071 QRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKN 1130

Query: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200
            LFT FR+R+EAFKLG VVL+EISKII ++FKQ Y S+LGF    +E Q I+K+WK+D++P
Sbjct: 1131 LFTSFRRRNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKP 1190

Query: 1201 IVPLRELPGPDVFRKYAF 1218
            I+PL+ LP P+VFR+ A 
Sbjct: 1191 IIPLQGLPDPNVFRRDAL 1208

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score = 1836 bits (4756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 889/1218 (72%), Positives = 1019/1218 (83%), Gaps = 10/1218 (0%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREV+NYE+ FYIPLSY NRTHK+CKLPNGILA                     HNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            +DI GLAHLCEHMIL+AGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ+N
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GE  FES LDVFASFFKEPLFNPLLI KEIYAIQSEHEGN+SSTTKIFYHAAR+LAN DH
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGNIHSLSS+P L+KI +K+SLNTYF+NNF+GEN+TLC+RG QSVNILTKLA+S
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KFGDI  K+ +K  + SI+             QD+SK                   KI +
Sbjct: 241  KFGDIKPKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTF----------KILN 290

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
            T WE+KY +  CF+   + NSIFINS+K PI+R LFPVSDKNTRFTK+DIK+YSHLW EL
Sbjct: 291  TTWEKKYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCEL 350

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDESPGSLS+YL SKGW T  FAF SEFAIG+IGL+LELELT +GW +++ I T + ++
Sbjct: 351  FGDESPGSLSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNR 410

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
            LLPSF   NID+LI FL+EQNLID+  FLYQ+SEDLPMEECS LSGILQ++LECLTP NI
Sbjct: 411  LLPSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNI 470

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
            FKGFKSLIEI+DPNIEKYEN K N+QWWTGQAIKFQNFLKSFMNH+N R+LLLG+IKS N
Sbjct: 471  FKGFKSLIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGN 530

Query: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600
            +FDK++++S+I T+FFYEFEYY   VHL+ D+K+HS S YEFNFPT N FLPD V+DPLK
Sbjct: 531  IFDKMKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLK 590

Query: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660
            LQQL+LECSLKSKFATLRPQI SEP    PQLVS+N NYEMW+LKEDPNF SDN SVVSF
Sbjct: 591  LQQLFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSF 650

Query: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720
            EV+GLGIKPSPEATIHLEVLAQ LFI TSS LYPALR GYTYEIASSSKGNVTLRFTISG
Sbjct: 651  EVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISG 710

Query: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780
            F EGVF I K FVDTLKLI TDPTF SKD LRKARILVR+KY++ASSDN VKLAS+GLLI
Sbjct: 711  FPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLI 770

Query: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840
            VLE+Y+WTL+DRI+ALELT++ES + FC LFW+NPK L L +QG+L+YAD IN YLNNNF
Sbjct: 771  VLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNF 830

Query: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900
            TQHLK+ +EG++PTIRLYP P+TK++D GTNAFIS NGHQDDPNNS+ YFIQTAQRD+I+
Sbjct: 831  TQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIK 890

Query: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960
            NLTLTFLTEY+FS TLVPDLRNKKQIGYIVL GLR+LTDT+GIHITVMSGSS H+LET+I
Sbjct: 891  NLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRI 950

Query: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNG 1020
            NEYLSYL+ QVLN FTE  FR +LLEP                +GP +LLNEIVANVQNG
Sbjct: 951  NEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNG 1010

Query: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080
            D+Y LNN+QM+ HR++RN I+E RL+FQE++EM+DI FLQKLTLKKYL FF S+ISIYS 
Sbjct: 1011 DNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSA 1070

Query: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140
            QRSKLSIMITSPMAE+EIASRKMFLQLEAFLKI GFAIK+ DL+KIVE SKG+P+LL+KN
Sbjct: 1071 QRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKN 1130

Query: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200
            LFT+FR+R+E FKLGTVVL+EI KII +N KQ YGS+LGFSS+D E Q I+K+W +D  P
Sbjct: 1131 LFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSP 1190

Query: 1201 IVPLRELPGPDVFRKYAF 1218
            IVPL+ELP P+ FRK AF
Sbjct: 1191 IVPLQELPEPNFFRKAAF 1208

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1207 (50%), Positives = 792/1207 (65%), Gaps = 22/1207 (1%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS +E+ ++++P Y+PL+Y NR HK+C LPNG+L                      HNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            +DI GLAHLCEHMILAAGSK YPDPGL+H  ++KNNG  NAFTTGEQTTFYFE+PN    
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GEL F+  LD+FASFFKEPLFNPLL  KEIYAIQSEH+GNMSS TKI YHA RML++  H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGN+++L+S+P L+ +N++ +L  YFK N+Y   MTLC+RG QSVNILTK A+S
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KFGDI     +  S F   +            ++ S                     I +
Sbjct: 241  KFGDIKENTALTRSRFGSMSSISTKRSSKSSTENHS------------TKNDLESFNILE 288

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
              W +KY  + CF   SK N IFI SSK P +R LFPV+D  TRFTK +IK++  LW EL
Sbjct: 289  ESWRQKYCDIPCFPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCEL 348

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDE+ GSL +YLV K W TS +A+ S FA+GNIGL++EL LT TGW + ++I   +  K
Sbjct: 349  FGDETKGSLCYYLVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGK 408

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
            L+ +F  + +  L  F+ +QN ID+ RFLYQ  +  PMEECS+LS +LQ +L+      I
Sbjct: 409  LVETFSEQYVHELANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYI 468

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
            FKG   + ++++ N+    N++ N +WW  QAIKFQ+F+K FMN  N R++LLG ++   
Sbjct: 469  FKGSPPITDMHEGNVGGI-NSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIP 527

Query: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600
               K E ++ + TE FYEFEY +  ++L       S + YEF  P KN F+P        
Sbjct: 528  ELFKKEIQNTLTTEPFYEFEYKISTINLKASQ---SVNTYEFCIPHKNKFIPSACKGDGV 584

Query: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660
            L+QL+LE SLKS+++ L  QI S   E  PQLV +N  YEMW LKED N   D  S+VSF
Sbjct: 585  LEQLFLESSLKSQYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSF 644

Query: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720
            EV+   +K SPE TIHLE+L QI+F   S  LYPA++ GY YEI++SSKG+V LRFTI G
Sbjct: 645  EVLSTDMKGSPENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGG 704

Query: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780
            FSEG+  + +  + T+  I T P FPSK+ LR+AR+LVRS YE+A++DN VKLAS+GLLI
Sbjct: 705  FSEGILMLIEIIIKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLI 764

Query: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840
            VLEE MW+L+DRIDALE   M S K FC  F    K L L IQGNL YAD+IN +LN NF
Sbjct: 765  VLEENMWSLEDRIDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNF 824

Query: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900
            T+HL +  + + P   L    +T  + PGTN F    G  DDPNNS+ YFIQT  R + +
Sbjct: 825  TKHLDINKDTSLP---LNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTD 881

Query: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960
              TLT  TEYI S TLVP+LRNKKQIGY+V+ GLR+LTDTIG++ITVMSGS    LE+KI
Sbjct: 882  LCTLTSFTEYIMSLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKI 941

Query: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNG 1020
            +EY++++E  VLN  TE+TF     +                LSGP+NLLNEIV NVQ G
Sbjct: 942  DEYIAFIENGVLNRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVG 1001

Query: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080
                LN+  MK HRR RN IS+K+ +F +E   +DI  ++KLTL  YL FF  +ISI+S 
Sbjct: 1002 SSDQLNSTSMKLHRRFRNQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSP 1061

Query: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140
             RSKLSIMITS MA ++I +RK +LQLEAFLKIKGF IK   L++IV+ + G+  LL+KN
Sbjct: 1062 TRSKLSIMITSSMAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKN 1121

Query: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200
            LF +FR R+E +KL TVVLKE+ K+   + KQ Y   L  + K+ + +++D  W   V  
Sbjct: 1122 LFNYFRSRNEGWKLCTVVLKEVVKMSITSLKQHYNWSLS-TKKEDKDKSVD--WNGPVSS 1178

Query: 1201 IVPLREL 1207
             V L+++
Sbjct: 1179 TVELKKV 1185

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/1225 (48%), Positives = 779/1225 (63%), Gaps = 43/1225 (3%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS ++V NY+ PFYIP  Y +R HK+C+LPNGIL                      HNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
             D+PGLAHLCEHM+LAAGSK YP+ GL+H+++ KNNG+QNAFTTGEQTTFYFE+P TQ++
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GEL F+  +DVF+SFFKEPLFNPLL  KEIYAIQSEHEGN+SS  KI YHA R++AN DH
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGNI++LSS+P L+KIN+K +L  YF  NFYG  MTLC+RG QSVN LTKL +S
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KFGDI   N +K S F    G           Q   +                    I  
Sbjct: 241  KFGDIRANNGLKRSKF----GSISSRLSISSFQSKERQPTDLEQY-----------NILK 285

Query: 301  TVWEEKYGSVSCFENPS-KYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWRE 359
            + W+ KY    CF + S   N IFI S+K   +RFLFPV DK ++F+ + + ++ + W E
Sbjct: 286  STWKPKYREAPCFTHDSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCE 345

Query: 360  LFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFS 419
            LFGDE+ GSL + LV K W T  FA+ SEF+ G+ GL+L+  LT TGW +V+ I   +  
Sbjct: 346  LFGDETKGSLCYLLVGKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLD 405

Query: 420  KLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCN 479
              + +F  K  D L  FL+EQN ID+ RFLYQ +E  PMEECS++S +LQE+LE L    
Sbjct: 406  NTIAAFIDKPTDQLSCFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISY 465

Query: 480  IFKGFKSLIEI--NDPN---IEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLG 534
            +FKG  ++ +   ND N   + +YE      + W  QA +FQ FLK FMN  N  + LLG
Sbjct: 466  LFKGAPTISDCYSNDNNTVDMIEYEQ-----ECWLKQAREFQEFLKVFMNRSNVFLFLLG 520

Query: 535  DIK-SHNLFDKIEDESEIHTEFFYEFEYY----MGRVHLSEDHKYHSQSPYEFNFPTKNP 589
            + K +H+L       S I   +F   +      +  ++L       +Q  Y F  P  N 
Sbjct: 521  NEKIAHSL------RSIIRIRYFLLMQCMSLNILNVIYLRFPKLLSTQ--YTFQVPPPNA 572

Query: 590  FLPDFVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPN 649
            F+P    D   LQQL+LE SLKS+F+T R Q+ +  +  +P L+S+N +YEMW L    +
Sbjct: 573  FIPPSCQDVTILQQLFLESSLKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWALDNPID 632

Query: 650  FTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSK 709
             + D  S++SFE+    + PSPE +I+LE+L+QIL    S  LYP++R GY+YEI+SS K
Sbjct: 633  ASIDKKSIMSFEIFNRSMIPSPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPK 692

Query: 710  GNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDN 769
            G++ L+ TI GFSEG+  I    V TL  I   P FPSK+ LR++R+LVR+ YE+A+SDN
Sbjct: 693  GDIQLKVTIGGFSEGIISILDTIVKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDN 752

Query: 770  GVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYA 829
             V LAS+GLLI+LE  MWTLQDR++ALE  DM S K FC  F + P  + LLIQGNLDY 
Sbjct: 753  CVTLASMGLLIILERNMWTLQDRLEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYG 812

Query: 830  DEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAY 889
            +EIN+YLN N T HL+  +  N    +   + +T  ++PG+N +   NGH DDPNNS+ Y
Sbjct: 813  EEINNYLNTNLTHHLECSNVKNE---KQSSTLSTILLEPGSNFYAKYNGHMDDPNNSIVY 869

Query: 890  FIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMS 949
            FIQT  R N   +TLT+ TEYI S TLVPDLRNK+QIGY V  GLR LT TIGIHITVMS
Sbjct: 870  FIQTGLRTNRRTVTLTYFTEYIMSLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMS 929

Query: 950  GSSAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNL 1009
            G S   LE KI+EY++YLE  +LN+ TE+ F     +                  GP++L
Sbjct: 930  GISPSDLEIKIDEYIAYLEETLLNSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADL 989

Query: 1010 LNEIVANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLE 1069
            LNE+VANVQ+G+   LN+  MK H+   N IS KR  F+ ++E+VDI  ++ LT K++L+
Sbjct: 990  LNEVVANVQSGNADELNSHFMKSHKHFFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLK 1049

Query: 1070 FFGSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVED 1129
            FF  ++SI S+ RSK+S+MI SPMAE EI +RK FLQL+AFLK++GF I S  L  IVE 
Sbjct: 1050 FFREKVSIKSKVRSKISVMIESPMAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVER 1109

Query: 1130 SKGSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQT 1189
            + G P  L+K+LF +FR+R+EA +L TV+LKE+ K+ A + K  Y   +  SSK   ++ 
Sbjct: 1110 ANGRPSALIKDLFKYFRERNEALRLCTVILKEVVKVSASSLKHRYTPKVS-SSKMKPKRQ 1168

Query: 1190 IDKYWKSDVEPIVPLRELPGPDVFR 1214
                W  D EP +PL+E+   + F+
Sbjct: 1169 SSSNWDQDTEPAIPLKEIKDLNEFK 1193

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1223 (47%), Positives = 779/1223 (63%), Gaps = 34/1223 (2%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS  EV ++++    PLSY NRTHK+C LPNGI                       HNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
             +IPGLAHL EHMILAAGSK+YPDPGL+H LI+KNNGSQNAFTTGEQTTFYFELP+T   
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GEL F+  LDVFASFFK PLFN  +I KEIYAI++EH  NMS  TKI YH+ R+LAN  H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS F+TGNI SL +   L  I++K+ L  YF  +F    MTLC+RG  SVN+LTKLAI+
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KF DI  +ND++ + F                Q  SK                    I +
Sbjct: 241  KFSDIKSQNDLQRNKF---GSISSKRDSRQPRQGYSKIESS---------------NILE 282

Query: 301  TVWEEKYGSVSCFENPSK-YNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWRE 359
             +W ++Y ++ CF N SK  NSIFI S K P+VRFLFP+S ++T FT+ +I ++S+ W  
Sbjct: 283  NIWSKRYANLPCFVNESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCT 342

Query: 360  LFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFS 419
            LFGDES GSL H+LV KGW+TS  +++S FA+G+IGLV+EL LT +G   +  I   +F 
Sbjct: 343  LFGDESEGSLMHFLVEKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFE 402

Query: 420  KLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCN 479
            K++    TK+   +  FL EQN+I+  RFLY+  E  PMEECS LSG+LQEN++ L    
Sbjct: 403  KIVKILTTKHTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKY 462

Query: 480  IFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLG-DIKS 538
            +FKG  S+ ++     +  E+       WT  AIKFQNFL +FMN+EN R+L LG + K 
Sbjct: 463  LFKGSPSITQLYSGKNQYSESMTDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKE 522

Query: 539  HNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDP 598
              L  K +   E  T+FFYEF++Y       +         Y F  P+ N F+P      
Sbjct: 523  TRLITKEKKRIEFETDFFYEFDFYRTFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSY 582

Query: 599  LKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVL----KEDPNFTSDN 654
              LQQ + E SLKSK A+LRPQ+Q E I   P LVS + NYEMW L       P+  S  
Sbjct: 583  TYLQQAFQESSLKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRSK- 641

Query: 655  VSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTL 714
             ++V+FE+I   + PS E+TIHLE+LAQ+LF   SS LYP+L+ GY+Y+IASSSKG+V L
Sbjct: 642  -TIVTFELISTNMIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRL 700

Query: 715  RFTISGFSEGVFKITKAFVDTLKLIGTDP--TFPSKDALRKARILVRSKYESASSDNGVK 772
            +FTISGFSEG+  + +  + ++  I  D    + + + LRKAR+LVR KY+ A  +N  K
Sbjct: 701  KFTISGFSEGLLLVLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAK 760

Query: 773  LASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLF-WKNPKQLALLIQGNLDYADE 831
            L S+GLLI+LE ++WTL+DRIDALE TDM S KNF + F +++     L IQGNLD A E
Sbjct: 761  LGSVGLLILLESFLWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHE 820

Query: 832  INHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFI 891
            I+HYLN+N T HL +      P   +   P TK +  G+N F++ +GH++DPNN++ YFI
Sbjct: 821  IHHYLNDNLTHHLDIL-----PEKVILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFI 875

Query: 892  QTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGS 951
            Q+  R +    TLT  TEY+ S TL+PDLR+KKQIGYIV+ G+R+L D+IG+HITV+SG+
Sbjct: 876  QSGLRSDSIAYTLTAFTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGT 935

Query: 952  SAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLN 1011
                LE KI+EY+++LE  +L   TE  FR   ++                 +G  NLLN
Sbjct: 936  PPQDLEDKIDEYMNFLERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLN 995

Query: 1012 EIVANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFF 1071
            +IV+NV NG+  ILN+ +M+ H+R+ N IS+    F ++ E+++   ++ LTLK Y++FF
Sbjct: 996  DIVSNVANGEYEILNSSEMREHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFF 1055

Query: 1072 GSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSK 1131
              +ISI+S +RSKLS+M+TSPM E EI +RK+FLQLEAFLKIKGFAIKS  L++IV+ + 
Sbjct: 1056 KKKISIHSNKRSKLSVMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKAD 1115

Query: 1132 GSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTID 1191
            G P ++LK L + FR+R+EA+KL   VLKE+ K      K  YG VL   +K     +++
Sbjct: 1116 GKPSVVLKLLLSEFRERNEAWKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLE 1175

Query: 1192 KYWKSDVEPIVPLRELPGPDVFR 1214
            K     V+P++PL+ +   ++F+
Sbjct: 1176 KSSNYSVKPVIPLKRIEDLNIFK 1198

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score = 1051 bits (2718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1216 (45%), Positives = 759/1216 (62%), Gaps = 6/1216 (0%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS  EV NY+IPFY P+SY  RT+K+C+LPNG+L                      HNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            ++IPGLAHLCEHMILAAGSKKYP+PGL+H LIAKN G QNA+TTGEQTTFYFELPN    
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
                FE  +DVFASFFK+PLFN  L  KEIYAI+SEH GN S+ TKIFYHA R+LAN++H
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFSHFSTGNI++LSS P L KIN+K+ L++YFK NF  ENMTLC++G QSVNILTK+AI 
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  KFGDISLKNDIKGSNF--SIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKI 298
             F DI   N IK      +I+               +                     KI
Sbjct: 241  YFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKI 300

Query: 299  SDTVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWR 358
             + VW  KY ++ CF+   KYN+I + S+K P++R +FPV     +F+KE++  + +LW 
Sbjct: 301  LENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWC 360

Query: 359  ELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIF 418
            E  GDES  S+ + L+++ + T   AF S+FA+ NIGL+LE  LT  G  +V  I  +I 
Sbjct: 361  ETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIM 420

Query: 419  SKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPC 478
               +P    +  + L  FL E + ID+  FL++ SE  PMEECS LSG++Q +L+ L P 
Sbjct: 421  ESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPE 480

Query: 479  NIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKS 538
             +FK    ++    P I  +  +  + QWW  +A  +Q FL+ +MN +  RI LL D   
Sbjct: 481  CLFKQSPMIVGNKYPTIGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDFSE 540

Query: 539  HNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDP 598
               F K   E ++ T+ FYEF+Y    V   +  +          FP KN ++P+     
Sbjct: 541  KQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEKVPEDQVDIFSNLKFPAKNEYIPELGRSL 600

Query: 599  LKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVV 658
            L L+++  + S +S+   L     S+    +P+L  K   YEMWV+++    +++  ++V
Sbjct: 601  LYLREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPSTEKKTIV 660

Query: 659  SFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTI 718
            +F+++ L + P+P+ T+HLE+L QIL++  S  LYP+L+ GYTYEIASSSKG+V L FT+
Sbjct: 661  TFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDVRLSFTL 720

Query: 719  SGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGL 778
            SG+S+G+ ++ K  + T   I  D   PSK  LR+ARIL R KYESA+++N  KLAS+GL
Sbjct: 721  SGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCAKLASVGL 780

Query: 779  LIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNN 838
            +I+LE+Y+W L+DR++ALE +D+ S K FC  F ++ K L L++QGNL  A+EIN YLN+
Sbjct: 781  IIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANEINKYLND 840

Query: 839  NFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDN 898
            +FT HL   ++  + T  +  S  TK ++PGTN      GH DDPNN + YFIQT +RD+
Sbjct: 841  SFTNHLG--EKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQTGKRDD 898

Query: 899  IENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLET 958
             + L LT  TEY+ S TLVPDLRNKKQIGY+V  G+R+L+DT+GIHITVMSGS+   LE 
Sbjct: 899  KKALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNPLDLEE 958

Query: 959  KINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQ 1018
            KI+EYL +LE +VL   +E  F    ++               + +GP N+L+ I ANVQ
Sbjct: 959  KIDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGIAANVQ 1018

Query: 1019 NGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIY 1078
             GD  +LN+ QM  HRRI+N I+ KR +F  ++   D+ F++ LTLKKYL+FF   ISI 
Sbjct: 1019 AGDFSVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEENISIS 1078

Query: 1079 SRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLL 1138
            S  RSKLS+ ITSPMA +EI +RK FLQLE FLK+ GF I +  L+ +V +S+G P  L 
Sbjct: 1079 SVNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGRPGKLF 1138

Query: 1139 KNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDV 1198
            K LF +F  R E +K   +V  E+ KIIAI+ K  +  +   SSK S+   I + W S V
Sbjct: 1139 KLLFNYFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGIFP-SSKQSDSSNI-QTWSSSV 1196

Query: 1199 EPIVPLRELPGPDVFR 1214
            +P + L ++    +F+
Sbjct: 1197 KPAITLTKVNDVHIFK 1212

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1218 (44%), Positives = 780/1218 (64%), Gaps = 35/1218 (2%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            M  +++  Y+IPF  P S+  RTHK+CKLPNG+L                      HNDP
Sbjct: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
             +IPGLAHLCEHM+LAAGS+KYPDPG +H +I KN GSQNAFTTGEQT+FYFELPN   +
Sbjct: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
             +  F+  LDVFASFF EPLFN  LI KE YAI+SEH+ N+SS  KIFY A R+LAN +H
Sbjct: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGNI +L+S+PHL+ +N+KN L+ YFK NF    MTLC+RG QS++ L KLA++
Sbjct: 181  PFSRFSTGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KF  I  KN+ +    S                + +                     IS 
Sbjct: 241  KFSLI--KNNPQRYRPSPPVSPSKSKRSSNEWVEVNPKEM----------------NISK 282

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
              W  KY    CF +  +   IFI SSK P VRF+FP  ++NTRFT +DIK+ +HLW EL
Sbjct: 283  NTWLPKYRGQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPEL 342

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDESPGS SH+L SKGW T S+AF+SE AIGN  L+LEL+LT+TG++++  IA  +F +
Sbjct: 343  FGDESPGSFSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQ 402

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
             +P+   KN   L  F+ +QN ID+ RFLYQN+E  PMEEC +LS ++Q++LE L P  I
Sbjct: 403  AIPALSQKNTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYI 462

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
            FKG   +I+    NI  Y  NK + +WW GQAIKFQ+FLK FM   N R+++ G+ +   
Sbjct: 463  FKGSPMMIDEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQ 522

Query: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600
            L +      E   + FYEFEY+  R  +         + Y F  P  +  +PD      +
Sbjct: 523  LEEL--SSQEFQVDLFYEFEYF-KRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQ 579

Query: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660
            L+++  + S KS+ A L   I +  ++ +P LVS+N  +EMWV+ +D + +    S+VSF
Sbjct: 580  LKKILNDSSQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSF 639

Query: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720
            E+ GL ++  P  T++LE+L QI+FI  S  +YP+L+ G+T EI +S+KG++ L FTISG
Sbjct: 640  EIFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISG 698

Query: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780
            FS+ +    K+ ++T+K I  DP F SK+ LR+ARILVR+KYE+A+++N   + SIGL I
Sbjct: 699  FSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYI 758

Query: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840
            VLE+YMWTL+DR++ALE  DM++ K FC  F  + K L+L +QG+L  ADE+N YL+ +F
Sbjct: 759  VLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSF 818

Query: 841  TQHLKVC---DEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRD 897
            T HL       +G   T+       TK ++PGTNA +   G +DDPNNS+ YFIQT +R+
Sbjct: 819  THHLGGGIYETQGKTFTVE-----TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRN 873

Query: 898  NIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLE 957
            +    TLT  T +I S  L  +LRNK+Q+GY+V+ GLR+L++++G+HIT+MSG S   LE
Sbjct: 874  DRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLE 933

Query: 958  TKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANV 1017
            TKI+EYL YLE Q L    E TF    +                  SGP++LL+E+VANV
Sbjct: 934  TKIDEYLWYLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANV 992

Query: 1018 QNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISI 1077
            Q GD  IL+++ MK H++++  I +++  F  E+E +D   + +++L++YL FF   ISI
Sbjct: 993  QIGDSEILSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISI 1052

Query: 1078 YSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLL 1137
            +S+ RSK+SIMI+S +AE++I ++K+FLQLE FLKIKGFAI + +L+ IVE S G P +L
Sbjct: 1053 HSKLRSKISIMISSSIAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKIL 1112

Query: 1138 LKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSD 1197
               L++ FR R++A +L +V+L E+ K++A + +  YG++   +  D+ ++ + + W +D
Sbjct: 1113 AMELYSCFRTRNDALRLCSVILAELFKMLAKSLRHRYGNL---AHDDTSKRDLQE-WSTD 1168

Query: 1198 VEPIVPLRELPGPDVFRK 1215
            V+P + L+ +   + F++
Sbjct: 1169 VKPALDLKVIEDINFFKR 1186

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1174 (43%), Positives = 743/1174 (63%), Gaps = 43/1174 (3%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS  +V +  +PF+ PLSY NRTHK+C+LPNGIL                      +ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            +D+PG+AHLCEHM+LA GSKKYP PG +H +I KNNGS NAFTTGEQTTFYFELP+    
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
             E  FE  +D+FASFF EPLF+  LI KEIYAIQ+EH+ N+S+ TKI YHA R+L +  H
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS F+TGN+ SL +   L+   ++N L+ +F+ N+    MT+C+RG  SVN L KLAIS
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KFG++        +N  ++A                                     I  
Sbjct: 241  KFGELRPHK----ANEKVQAALTPNDGF----------------------------NILQ 268

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
            T W     + +CF +  + N+I ++S K PI+RFLFPV  K TRFTK+D  ++   W EL
Sbjct: 269  TRWGHTKAANNCFPSCLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFEL 328

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDES GS  H+LV KGW T+ +A+IS F+  N GL+LEL LT +GW ++E IA T+   
Sbjct: 329  FGDESAGSFCHFLVEKGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFY 388

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
            L+P F  ++   L  FL EQ  ID+ RFLY N+E+ PM ECS+L  +LQE++  L    I
Sbjct: 389  LVPKFSREHTVQLARFLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCI 448

Query: 481  FKGFKSLIEINDPNIEK-YENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSH 539
            F G  S + +N+ + +  +  N+ + +WW GQAIKFQ+FLK FMNH N R++LLG ++  
Sbjct: 449  FMG--SPMVLNEQSTQGLFSENEESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDC 506

Query: 540  NLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFV-NDP 598
            +L           T+ FY+F Y+  ++ L + H  +  + Y+F+ P KN F P +  N P
Sbjct: 507  SLSTTATQGKIAGTDPFYDFAYFTCKLSLRKPHA-NILNDYKFSIPPKNEFKPSWAENFP 565

Query: 599  LKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVV 658
              +++LY   S KS+ A+L   I+S+     PQLVS+N NY+MWVL + P  +  + ++V
Sbjct: 566  SLMRKLYYS-STKSQQASLGFAIKSDEGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIV 624

Query: 659  SFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTI 718
            SFE+    I+PSPE T++LE+LAQ++ +T +S+LYP+L+ G+T+EI  SS+G+V L   I
Sbjct: 625  SFEISCWEIQPSPENTMNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVI 684

Query: 719  SGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGL 778
            SG+S+ + K+ ++    ++ + ++ +FPS++  RKARI VRS Y+ A  ++ + +ASIGL
Sbjct: 685  SGYSKRLGKVIESLSSIIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGL 744

Query: 779  LIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNN 838
            L+V+E+YMW+LQDRIDA+E  D+++ K F + F    K L L IQG+L +AD+IN  L+ 
Sbjct: 745  LVVMEKYMWSLQDRIDAIECIDLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDR 804

Query: 839  NFTQHLKVCDEGNRPTIRLYPS-PNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRD 897
            N T HL     G +   +  P   +TK +DP TN ++   G +DDP NS  Y+IQT  RD
Sbjct: 805  NLTNHL----HGTQTDFQREPEYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRD 860

Query: 898  NIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLE 957
            +    TLT L+ Y+ S TL P+LRNK+QIGY+V+ GLR+L + +G+HI++MS     +LE
Sbjct: 861  DCTAYTLTALSAYMMSFTLKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALE 920

Query: 958  TKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANV 1017
             KINEYL YLE +VL   TE TFR   L+                 SGP++L+++IVANV
Sbjct: 921  EKINEYLLYLEREVLTPMTEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANV 980

Query: 1018 QNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISI 1077
            Q+GD  ILN+  MK H+R+RN I++ R  F + +  ++   LQ+LT+  YL FF  RISI
Sbjct: 981  QSGDSDILNSSFMKKHKRLRNQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISI 1040

Query: 1078 YSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLL 1137
            +S+ R+KLS+M+ SPM +EEI +R+++ Q++AFLK+ G  I++  L ++V+ SKG P+LL
Sbjct: 1041 HSKTRAKLSVMVKSPMTDEEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLL 1100

Query: 1138 LKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFK 1171
             K L+  F  R E +KL TV+L+E+ K++ +N K
Sbjct: 1101 AKELYQSFHSRHETWKLCTVMLRELLKMLTVNLK 1134

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1216 (43%), Positives = 726/1216 (59%), Gaps = 37/1216 (3%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS   V N+++ FY P+S  +R+H++ +L NG+L                      HNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            ++I GLAH CEHMIL+AGSK YPDP  +H +I+KN GSQNAFTTGEQTTF FELPN  ++
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
             EL F+  LD+F+S FK+PLFN LL+ KEIYAI SEH  N SS  KIFYHA R+LAN DH
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTG+I +LS +  L K++++  +  YFKNNFY ENM LC++G QS+N L KL  S
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
            KF      NDIKG   S               ++ S                    KI  
Sbjct: 241  KF------NDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESF---------KILS 285

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
              W +KYG+V  F     +N++ ++S K P +R +FP+  + TR TK++I + S  W EL
Sbjct: 286  RNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCEL 345

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDES GSL H++    + T   AF+S FA+ +  L+LEL LT TGW++++ I    F+K
Sbjct: 346  FGDESEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNK 405

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
             +P         L  FL E N I++ +FLYQ+     MEECS+LS +L  ++E L P  I
Sbjct: 406  YVPIVIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFI 465

Query: 481  FKG--FKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKS 538
             KG       EI D  +  +  ++ +  WW G AIKFQ+F+K F+N EN R++L+GD+K 
Sbjct: 466  LKGNPMNDCNEI-DSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKE 524

Query: 539  HNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDP 598
              L        +++ E +YEFEY+  R   S       +  Y F+ P KN FLP    + 
Sbjct: 525  CPLMKTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNL 584

Query: 599  LKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVV 658
              ++   L  S +S+ A L    Q+    +LP+L+ KN  YEMWV +ED   T  + S+V
Sbjct: 585  SLIKNALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIV 644

Query: 659  SFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTI 718
            +FE+I   + P P  T+ LE+L ++L    SS LYP+ + GYTYEIA+SSKG+V + FT+
Sbjct: 645  TFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTV 704

Query: 719  SGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGL 778
            SGFSEGV+KI +  V TL  I       ++D  RK+RI VR+KYE A+S N   L +IGL
Sbjct: 705  SGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGL 764

Query: 779  LIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNN 838
            LIVLE+YMW L+ R++ALE TDMES K F S F+ N   + L IQG+  Y D+IN +L+ 
Sbjct: 765  LIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDR 824

Query: 839  NFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDN 898
            N T HL       R  +++   P +  + PG+N FI+  G +DDPNNS+ YFIQT  R +
Sbjct: 825  NLTGHL----SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTD 880

Query: 899  IENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLET 958
              + TLT  T ++ S TLVPDLR +KQ+GYIVL GLR L+ T+G+HIT+ S S  H LE 
Sbjct: 881  NYSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEE 940

Query: 959  KINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQ 1018
            KI EYLSYLE  +L+N     FR   ++                   P NL++ I ANV+
Sbjct: 941  KIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVR 1000

Query: 1019 NGD-DYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISI 1077
            +G+ D +   R MK HRRIR  IS KR +F++E+E +D+  ++ L    Y++FF  +ISI
Sbjct: 1001 SGNLDRV--GRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISI 1058

Query: 1078 YSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLL 1137
            YS  RSK+S+M++SPM+  EI +RK+FLQLE+FLK+KGF I    L+KIV  S G P +L
Sbjct: 1059 YSSLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVL 1118

Query: 1138 LKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSD 1197
            +K LF +F  R E+ K+ TV+LKEI+       +Q   S+    ++ S       + + +
Sbjct: 1119 MKELFRYFASRGESLKICTVMLKEIT-------RQLSSSLKNLGARKSPN-----FERPN 1166

Query: 1198 VEPIVPLRELPGPDVF 1213
              P VPL E+  PD +
Sbjct: 1167 GSPTVPLTEIVDPDAY 1182

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1198 (45%), Positives = 748/1198 (62%), Gaps = 33/1198 (2%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS      ++I FY+P SY NR  K+C+LPNGILA                     H+DP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
             DIPG+AHLCEHMILAAGSKKYP PGLFH ++A NNGSQNAFTTGEQTTFYFELP + + 
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
             +  F   LD+F+SFFK+PLFN +L  KEIYAI+SEH+GNMS+T+KI YHA R+L+N  H
Sbjct: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PF +FSTGNIH+LS V +L+K N+K  L  YFKNN++  NMT+C++G QS+N LTKLA++
Sbjct: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
             FGDI  K+++  + F I +              +                     K+ D
Sbjct: 241  NFGDIKDKDEL--TKFHINS---IKPQKSLRISKSRSSISSCNSFKTNENLDLENFKLLD 295

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
              W +KYG   CF     +N+IF++SSK PI+R LFP+S+K TRFTK DIK+YS++W  +
Sbjct: 296  NAWLDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHI 355

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDE+ GS   YL    W T  +AF S FAIGN  L+LEL+LT TG + +++I   +  +
Sbjct: 356  FGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQ 415

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
            ++        ++L  FL E N+I I RF+  + E  PM+ECS LSG+LQEN +   P  +
Sbjct: 416  VVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYL 475

Query: 481  FKGFKSLIEINDPNIEKYENNKLN---VQWWTGQAIKFQNFLKSFMNHENTRILLLGDIK 537
            F G + L+  N+   +K  NN  +     +W GQAIKFQ FLK FMN EN +I+ +GDI 
Sbjct: 476  FYGSEFLLLENESLPQK--NNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDID 533

Query: 538  SHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVND 597
                   I  E    T+ +YEFEY   ++ +S+  +   +  Y F +P KN +LP F  +
Sbjct: 534  EFKNVLNIVKEMSKKTDLYYEFEY--QKLKISKKSRICPRD-YPFTYPIKNEYLPKFGYN 590

Query: 598  PLKLQQLYLECSLKSKFATL-RPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVS 656
               L+ + L     S+  +   PQ+  E  E   +LVS+N  +++WV   +P  + D +S
Sbjct: 591  LGLLRNILLNNLESSRTVSFYMPQVSEE--EDQNKLVSQNDMHKLWV---NPKNSKDQLS 645

Query: 657  ----VVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNV 712
                +VSF+++   I+ SPE+T+HLE++ Q+L     + LYPAL  GYT+EI+ S +G+V
Sbjct: 646  ESPCIVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDV 705

Query: 713  TLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVK 772
            +L FT+SGFSEG+FKI K  ++    + T     +K   R+ARILVR KYE A+SD+ VK
Sbjct: 706  SLSFTLSGFSEGIFKIIKECINIFGEL-TSSDLITKKEFRRARILVRDKYEDAASDSCVK 764

Query: 773  LASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEI 832
            LAS+GLLI+LE  MWTL++RIDALEL D+E    F   F++N   L+L I+GNL+YAD I
Sbjct: 765  LASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLI 823

Query: 833  NHYLNNNFTQHL-KVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFI 891
            N Y ++    HL K  D     T++  PS  TK I  GTN +    G  DDPNNS+ YFI
Sbjct: 824  NSYFSDKLVHHLTKRLDYPKEDTLQSLPS--TKLIS-GTNIYYELEGSVDDPNNSIVYFI 880

Query: 892  QTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGS 951
            QT    N + L+LT LT +I S +LVP+LRNKKQIGY+V  GLR L+DT+G+HIT+MS  
Sbjct: 881  QTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDG 940

Query: 952  SAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLN 1011
                +E +I +Y+SYLEF +L N  + TF+   L                  SGP N++N
Sbjct: 941  KPLDIEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMN 1000

Query: 1012 EIVANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFF 1071
            EI+ANV  GD  ILN+ ++K+H++ +N +        EE + VDI FL+ L L KYL+FF
Sbjct: 1001 EIIANVHGGDSAILNSEKIKNHKKNKNELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFF 1059

Query: 1072 GSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSK 1131
               IS  S++RSKLSI I SPM E E+ +RK+FLQL+ FLKIKGF IKS +L++IVE + 
Sbjct: 1060 KGSISTNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTN 1119

Query: 1132 GSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQ---TYGSVLGFSSKDSE 1186
            G P LL K LF  F+ R E++K  ++VLKEI K+I+++ KQ   T GS    S + SE
Sbjct: 1120 GRPTLLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSE 1177

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1192 (42%), Positives = 719/1192 (60%), Gaps = 48/1192 (4%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            M+   V NY+I F IPL++ +RTHK+CKLPNG+LA                     HNDP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            + +PGLAHLCEHM+ AAGSKKYPD   +H  ++K  G+ NA+TTGEQTTF+  +PN    
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GEL F+  LD+F+SF KEPLFN   + KEIYAIQSEH+ N+SS +KI Y A R++AN +H
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGNIH+L ++P +  +N++  L  YF+ NF   N+T+C++GSQSVNILTKLA++
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
             FG I      KG+   I+             +   K                   +I +
Sbjct: 241  NFGYIQSSRAAKGN--VIRRSISKRDSIRSNGKKLKKIESF---------------RILE 283

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
              W+ KY  + CF++  + N + I S+K   +RFLFPV++    FT +++K++S +WREL
Sbjct: 284  KAWKAKYKDIKCFDD--RNNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWREL 341

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDES GSL  Y + K W T +  +IS+F  G  GL+L+  LT +GW ++  I + +F  
Sbjct: 342  FGDESKGSLHSYFIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKG 401

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
             L     +N++ L   L E   I+   +LYQ  E L  + CS L+ +LQ +L       +
Sbjct: 402  TLELVRWENLNSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYL 461

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
            FK   +LIE+N+   +  EN      WW  QA+KFQNF+  FM   N ++ LLG    HN
Sbjct: 462  FKESPNLIELNN---DHSENLMTVTPWWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHN 518

Query: 541  LFDKIEDES-EIHTEFFYEFEYYMGRVHLSE--DHKYHSQSPYEFNFPTKNPFLPDFVND 597
             F ++  ++ +  T+ +Y F+Y    ++  +  D    + + Y    P+KN F+P F  +
Sbjct: 519  AFFELGSQNKDWSTDAYYGFDYIKSHLNFKQIIDEPCTTVNDYSLALPSKNLFIPQFFQN 578

Query: 598  PLKLQQLYLECSLKSKFATLRPQIQSEPIEILP----QLVSKNLNYEMWVL---KEDPNF 650
               LQQ+++E SL+S+FA L+PQ+   P  +LP    +LV+++ +YEMW+L   KE  + 
Sbjct: 579  LANLQQIFMEYSLRSRFAVLQPQV---PTSMLPNQKPRLVNRSSHYEMWILPIDKEPESV 635

Query: 651  TS-DNV---SVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIAS 706
             S D +   S V+F +  L + PS   T+HLE+L ++L    +S+LYP+L+  Y YEIA+
Sbjct: 636  ASPDRIPKQSTVTFSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIAT 695

Query: 707  SSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPT---FPSKDALRKARILVRSKYE 763
            S KG+V L  TI GFS+GV KIT   + TL+LIG DP      +   LRKARI VRSKYE
Sbjct: 696  SLKGDVQLCCTICGFSDGVVKITDYILSTLRLIG-DPATANIVTNSLLRKARIQVRSKYE 754

Query: 764  SASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQ--LALL 821
            +ASS+  VKLAS+GLLIVLE  MWTL+DR++ALE +DM S + FC  F  N     L L 
Sbjct: 755  AASSEICVKLASMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLF 814

Query: 822  IQGNLDYADEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQD 881
            +QG++ YADE+N  +++  T HL      + PT     S  T  + PG N ++   G  D
Sbjct: 815  VQGDMRYADEVNCLIHSKLTHHLN-SSRCSTPTTDYRRS--TTVLKPGVNYYVEYPGQGD 871

Query: 882  DPNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTI 941
            DPNNS+ +F+Q   R++    TL   T Y+   TLVPDLR KKQIGY+VL GLRI+TDT+
Sbjct: 872  DPNNSIVHFVQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTV 931

Query: 942  GIHITVMSGSSAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXX 1001
            G+HITVMS      LE KI+EY+ YLE  VLN  TES F  + L+P              
Sbjct: 932  GLHITVMSAGQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMD 991

Query: 1002 TLSGPSNLLNEIVANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQK 1061
            T  GP+NLL+EI  NVQNG   +L    MK H+++ N I  K   F + N+++D   +Q 
Sbjct: 992  TSGGPTNLLSEIYPNVQNGHSSVLEGIDMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQG 1051

Query: 1062 LTLKKYLEFFGSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSR 1121
            LTL +Y+ FF  ++S  S  RSK+SIMI SPM  EEI +R+MFLQ+E FLK+KGFAIK  
Sbjct: 1052 LTLHRYMTFFKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDT 1111

Query: 1122 DLEKIVEDSKGSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQT 1173
            +L  IV  S+GSP  LL++L   F+ R E +KL  V+ KE+ K++A+  +++
Sbjct: 1112 ELRDIVNKSQGSPTQLLRHLLAHFKTRGENWKLCRVIAKEVGKLLALGVRRS 1163

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1210 (40%), Positives = 715/1210 (59%), Gaps = 28/1210 (2%)

Query: 9    YEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAH 68
            +++  Y P+S   R+H+I +L N +LA                     HNDP ++PGLAH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 69   LCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFEST 128
             CEHM+L++GSKKYP+P  FH  + +NNGS+NA TTGEQT+FYFE+P+T S     FE  
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELHVFEQL 129

Query: 129  LDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTG 188
            +D+ A+ FKEP+F+ +L+ KEIYAI SEH GN S+ +K+ YHA R+LAN +HPFSHFSTG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 189  NIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDISLK 248
            N+ +L+++P + K+N+K  L  YFK +F  E M +C+RGSQS+N L+KLA  KFGDI   
Sbjct: 190  NVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIP-- 247

Query: 249  NDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISDTVWEEKYG 308
                    S  AG             +S                     + DT W  +Y 
Sbjct: 248  -------GSAAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLASLDESRILKDT-WLPRYS 299

Query: 309  SVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWRELFGDESPGS 368
                F    KYNS+ I S K P++RF+FPV+  +TRFT ++I  Y+  W ++ GDE  GS
Sbjct: 300  KEPVFTPRPKYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGS 359

Query: 369  LSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSKLLPSFCTK 428
              H+L    + +   AF S FA+ + GL+L+L LT  GW +V  I    +   + +    
Sbjct: 360  FCHFLRQNNYISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDT 419

Query: 429  NIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNIFKGFKSLI 488
            ++  +  +L E N ID+ +FLYQ+ E  PME C+ L   L ++L  + P  I K    + 
Sbjct: 420  SLSKIGQYLSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMF 479

Query: 489  EINDPNIEK---YENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHNLFDKI 545
            + NDP I+K   Y  ++ +  WW GQAIKFQ F+K F   EN ++++LG +     +   
Sbjct: 480  DCNDPRIQKIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYS-- 537

Query: 546  EDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLKLQQLY 605
             +  ++  +  YE++Y    + ++E     ++  YEF+ P+ N FL    +    +++  
Sbjct: 538  -NSMQLTADTHYEYDYLKAYIEITELEAIDNE--YEFHIPSPNQFLVPVGHKLSYIKKAL 594

Query: 606  LECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSFEVIGL 665
            L  S +S+ ++L    QS+ ++  P L  KN  YE+W  +ED N +  + S+VS EVI  
Sbjct: 595  LAASAQSENSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVIST 654

Query: 666  GIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISGFSEGV 725
             +KP+PE T+ LE+L Q+LF   S  LYPA RAGYTYE++ SSKG+V L  T+SGF+EG+
Sbjct: 655  TLKPAPEYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGI 714

Query: 726  FKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLIVLEEY 785
              I    +D+L  +G D    SK   R+AR++VR+KYE A+S+N   LAS+GLLIVLE  
Sbjct: 715  MGILNIILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGC 774

Query: 786  MWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQG-NLDYADEINHYLNNNFTQHL 844
            MWTL+DR++ALE  DMES   F  LF      L LL+QG +L  AD++N  ++   T H+
Sbjct: 775  MWTLEDRLNALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHM 834

Query: 845  KVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIENLTL 904
               + G    +     P T  I  G+N  +  +G  DDPNNS+ YFIQT  RDN    TL
Sbjct: 835  SSLETGKNILVE----PTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTL 890

Query: 905  TFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKINEYL 964
            T  TE++ S TLVPDLR KKQIGY+VL GLR+L+DT+G+HIT MS +    LE KI+EYL
Sbjct: 891  TVFTEFLMSMTLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYL 950

Query: 965  SYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNGDDYI 1024
            SYLE  VL       F+   L                  SGP+NL+++I ANV++G    
Sbjct: 951  SYLESMVLMKLNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQN- 1009

Query: 1025 LNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSRQRSK 1084
              +  MK H+RIRN IS +R +F+EE+E ++   ++ LTL++Y+ FF  +IS+YS+ R+K
Sbjct: 1010 -GSMAMKSHKRIRNQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAK 1068

Query: 1085 LSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKNLFTF 1144
            +S+M+TSPM+++E+ S+ MFLQ+E+FLK+KGF I S DL+ I+  S G P +LLK+LF++
Sbjct: 1069 MSVMVTSPMSKDEVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSY 1128

Query: 1145 FRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEPIVPL 1204
            FR R E+ KL T ++KEI K  +    +  GS    S+  +      +     V P VPL
Sbjct: 1129 FRVRGESIKLLTAIVKEIVKQAS---NKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPL 1185

Query: 1205 RELPGPDVFR 1214
             E+   + +R
Sbjct: 1186 IEVTDVNSYR 1195

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1160 (41%), Positives = 692/1160 (59%), Gaps = 32/1160 (2%)

Query: 9    YEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAH 68
            +++  Y P+S  NR+H+I +L N +L                      HNDP +IPGLAH
Sbjct: 10   FDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69

Query: 69   LCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFEST 128
             CEHM+L++GSK++P+P  FH  ++KNNGSQNA T+GEQT+FYFELP++QS+  L F+  
Sbjct: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129

Query: 129  LDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTG 188
            + + A   KEP+F+ +LI KEIYAI SEH GN SS TK+ YHA R+LA+ +HPF  F TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 189  NIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDISLK 248
            NI +L+++P L K+++KN L  YF+ +F+ ENM LC+RG QS+N L+K+A ++F DI   
Sbjct: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIP-- 247

Query: 249  NDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISDTVWEEKYG 308
                    SI                  K                   +I    W  +Y 
Sbjct: 248  --------SIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESF-------QILKDAWSARYA 292

Query: 309  SVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWRELFGDESPGS 368
                F+    +NSI + SSK+P++RF+FP++  +TRFT  ++  Y+ +W EL GDE  GS
Sbjct: 293  KKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGS 352

Query: 369  LSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSKLLPSFCTK 428
            L HYL S  + T   A+ S FA+ + GL+L+L LT  GW +V+ I   ++  L+P+    
Sbjct: 353  LCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDA 412

Query: 429  NIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNIFKGFKSLI 488
             +  L  ++ E N +D+ +FLYQ  E  PM+ C+ L   L ++L  +    + K   +  
Sbjct: 413  PLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYF 472

Query: 489  EIND---PNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHNLFDKI 545
            E N+    N+  Y  N+ +  WW G+A+KFQ F+  FM+ +  RI+LLG++ S   F+  
Sbjct: 473  ECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNL-SKCYFNCN 531

Query: 546  EDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLKLQQLY 605
             D+  I T+ ++E+EY   ++ +  +        Y F  P  NPF+    +    ++   
Sbjct: 532  PDK--ITTDTYFEYEYV--KIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHAL 587

Query: 606  LECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSFEVIGL 665
            L  S++S+ + L    QS+ +   P+L  KN  YE+W+ +ED + +  + S+ S E+I  
Sbjct: 588  LASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELIST 647

Query: 666  GIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISGFSEGV 725
             ++P+PE T+HLE+L Q+L+      LYPA RAGYTYE++ SSKG+V L  TISGF++G+
Sbjct: 648  SLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGI 707

Query: 726  FKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLIVLEEY 785
              + K  VD +  +  D     KD  RKARILVR+KY+ ASS++ V LAS+GLLI+LE  
Sbjct: 708  LNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENC 767

Query: 786  MWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQG-NLDYADEINHYLNNNFTQHL 844
            MW L+DR++ALE   +ES + F   F      L +LIQG ++  AD IN YL+   T H+
Sbjct: 768  MWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHI 827

Query: 845  KVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIENLTL 904
               D+      RL   P T  I  G+N F    G  DDPNNS+ YFIQT +RDN    TL
Sbjct: 828  SRADDN---VCRL-SEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTL 883

Query: 905  TFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKINEYL 964
            T LTE+I SQTLVPDLR KKQIGYIVL GLR+L+DT+G+HIT M+GS    LE KINEYL
Sbjct: 884  TVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYL 943

Query: 965  SYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNGDDYI 1024
            +YLE  VL   T   F+   ++                 SGP+NL+++I ANV +G    
Sbjct: 944  AYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN- 1002

Query: 1025 LNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSRQRSK 1084
              +  MK H+R+R  IS +R +F E++E VD   LQ L L +Y+ FF  RISIYS +R+K
Sbjct: 1003 -TSLAMKSHKRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAK 1061

Query: 1085 LSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKNLFTF 1144
            LSIM+ S M++EE+  + ++LQ+E+FLK+KGF I S+DL  IV+ SKG P  LLK L ++
Sbjct: 1062 LSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSY 1121

Query: 1145 FRKRSEAFKLGTVVLKEISK 1164
            FR + E+ KL + VL+E+ K
Sbjct: 1122 FRSQGESLKLLSTVLREVVK 1141

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1174 (40%), Positives = 673/1174 (57%), Gaps = 36/1174 (3%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS     N+++ FY P+S  +R  K+C+L NG+L                      HNDP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
            ++  GLAHLCEH IL+ GSKKYP    +H ++A+N GS NA+TTGE TTFYFELP    +
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDS 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            GEL F+  LDV AS  K PLF+ +LI KEIYAI+SEH  N +   K  YHA+R+LAN  H
Sbjct: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS F TGN  +L ++P L K N+K +L ++ K  +   NM+LC+RGSQS+N LTKLAI 
Sbjct: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
             FGD+                           Q+ ++                   KI  
Sbjct: 241  FFGDLPASG-----------------------QNIARPSSSSLFSNKGTAQSMPYFKILK 277

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
              W  KY  V  F   S  N + I SSK P++R +FPVS K+TR +  DI  +S  W + 
Sbjct: 278  YEWTPKYKDVRAFSQGSS-NVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDF 336

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDES GSL+  L   G  +   + +S FA    GL LEL LT+ GW+++ +I   +F  
Sbjct: 337  FGDESVGSLADCLKGCGLISGIVSSVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDD 396

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
             +P       + +   L E N I++ +FLYQ++E  PM+ C++LS  L  +LE L P  +
Sbjct: 397  YIPKLIHDKTEDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCL 456

Query: 481  FKGFKSLIEINDPN--IEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKS 538
             KG   LIE N  +  I  Y  N  +  WW G+AIKFQN +  F+N +N R ++LGD   
Sbjct: 457  LKG-SPLIECNQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSK 515

Query: 539  HNLFDKIEDESEIHTEFFYEFEYYMGRVH-LSEDHKYHSQSPYEFNFPTKNPFLPDFVND 597
             N    +   S   T+ +YEF+Y +  V  LS     ++   Y F+ P+ + FLP     
Sbjct: 516  SNFLASVR--STTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARK 573

Query: 598  PLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSV 657
               ++Q     S +++ A+L    +S+ ++  P+L  KN NYE+WV +E+ + +  + S+
Sbjct: 574  LSLIKQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSI 633

Query: 658  VSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFT 717
            VSFE+I   +  SP+ T++LE+L Q+L  T S+ LYP+ + GYTYEI+ SSKG+V L  T
Sbjct: 634  VSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLT 693

Query: 718  ISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIG 777
            +SGF EGV+ + K  V+ +K   +     SK   R+ARI VRSKYE A++ N   LAS+G
Sbjct: 694  VSGFPEGVYNLIKIIVEEIKSFSSRDIISSK-VFREARIAVRSKYEEAAAANCTALASLG 752

Query: 778  LLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLN 837
            LLI+LEE MW ++DR++ALE    E+   FCS F  +P  + L IQG++   ++IN +L 
Sbjct: 753  LLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLK 812

Query: 838  NNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRD 897
             + T HL+   E   P +R    P  K +  GTN F+  N   DDPNNS+ YFIQT +R+
Sbjct: 813  WSLTSHLEDTREYQGP-VR---EPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGERE 868

Query: 898  NIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLE 957
            +    T T L E+  S TLVPDLRNKKQIGY V  GLR+L+ +IG+HIT MS S    LE
Sbjct: 869  DARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLE 928

Query: 958  TKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANV 1017
             +I EYLSYLE  +L+  TE  F+   +                  +GP++L+ +I ANV
Sbjct: 929  VQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANV 988

Query: 1018 QNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISI 1077
            ++G +       M+ H+  +N IS +R +F  E E V+   L+ +TL ++  FF  +ISI
Sbjct: 989  RSG-NLEEQGSAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISI 1047

Query: 1078 YSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLL 1137
            YS +RSKLS+MI SPM  EEI+ +++FLQ+E+FLK+KG  I S DL  I+E S G    +
Sbjct: 1048 YSLKRSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGI 1107

Query: 1138 LKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFK 1171
            L+ LF +F    E  KL  V++KEISK + ++ K
Sbjct: 1108 LRGLFRYFSANGETMKLCNVIIKEISKALVLSLK 1141

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1161 (42%), Positives = 664/1161 (57%), Gaps = 21/1161 (1%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            MS  +V NY+IP YIP S     +K+C+LPNGIL                      HNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
              IPGLAHLCEHMIL+AGSKKYPDP  +H LI+++NGS NA+TTGEQTTFYFE+P   ++
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
             E  FE  LD+F+S FK+PLF    + KEIYAI+SEH+GN  + TKI YHA R+LAN+ H
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
            PFS FSTGNI +L     L K   K  L +YFK N+   NMTLC++G QSVN+LTK A++
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  KFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISD 300
             F  I   + I+  N  IK+              +S                     I  
Sbjct: 241  YFNGID--DSIRNDNTFIKS-LKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILS 297

Query: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360
              +  KY  + CF+    +N+IFI S+K PI+R LFP+   +  F K+D+  +  +W EL
Sbjct: 298  NAYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCEL 357

Query: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420
            FGDE+  SL ++L      T  FAF S FA+ ++GLV+EL LT TG ++ E I  +I + 
Sbjct: 358  FGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNS 417

Query: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480
             +      N   L  FL E N IDI RF+ +  ED  M+E S +S  LQENL    P  +
Sbjct: 418  AIEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFL 477

Query: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540
             K F  + + ++  I  +E N+ +  WW  +A  FQ FLK ++N +N RIL LGDI++  
Sbjct: 478  LKEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPK 537

Query: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYE-FNFPTKNPFLPDFVNDPL 599
                 ED     T+ FY+FEY   +     +        +     P +N F+P+ +   L
Sbjct: 538  FTTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPE-IGKSL 596

Query: 600  KLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVS 659
             +    LE  LK   +   P I +  IE  P LV KN N E WVL      +S   S+ S
Sbjct: 597  AILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHSSTESSIFS 656

Query: 660  FEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTIS 719
            FE+    IKPSP +T+HLEVL Q+L I  +  LYPALR GYTYEI +S  G+V L  TIS
Sbjct: 657  FEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITIS 716

Query: 720  GFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLL 779
            GF  G+  + +  +     I       +  AL +AR++ R KYE A+S N VKLAS+GLL
Sbjct: 717  GFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLL 776

Query: 780  IVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNN 839
            I+LE++MWTL+DR DALE +D+ S  NFCS F+K+ K +   I G  + A +++H +   
Sbjct: 777  IMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLI--- 833

Query: 840  FTQHLKVCDEGNRPTIRL-YPSPN----TKNIDPGTNAFISCNGHQDDPNNSLAYFIQTA 894
               H  + D     TI L Y   N    T  + PG N +    G + D NN + YFIQT 
Sbjct: 834  -YDHWILSD-----TISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTG 887

Query: 895  QRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAH 954
            +R+N    TLT LT+YI    LV +LRN+KQ+GY+V  G+R LT+TIG+HIT+MS +   
Sbjct: 888  ERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPE 947

Query: 955  SLETKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIV 1014
             LE  I+EY+  LE   + +  ESTF+   L P               ++   NL++++V
Sbjct: 948  DLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDTNNPFNNVTN-VNLVDDVV 1006

Query: 1015 ANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQ-EENEMVDILFLQKLTLKKYLEFFGS 1073
            ANVQ GD      +QMK H  ++  I   R+    + NE +D+  ++KLTLK+YLEFF +
Sbjct: 1007 ANVQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRA 1066

Query: 1074 RISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGS 1133
             ISI S+ RSK+SI I S MA+EEIA+RK+FLQL  FLK+KG  IK  +L++IVE S+G 
Sbjct: 1067 TISINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGK 1126

Query: 1134 PVLLLKNLFTFFRKRSEAFKL 1154
            P  LLK +  +F+K+ EA KL
Sbjct: 1127 PSKLLKEIVKYFKKKDEAKKL 1147

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/1170 (40%), Positives = 670/1170 (57%), Gaps = 37/1170 (3%)

Query: 6    VSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPG 65
            V ++++ FY P+S  N+  ++C+L NGIL                      H DP+++ G
Sbjct: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEVLG 67

Query: 66   LAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAF 125
            LAHLCEH IL+AGSKK+P    +H ++A+N GS NA+TTGE TTFYFELP +  +GEL F
Sbjct: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127

Query: 126  ESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHF 185
            +  LD  AS FK P+F+   I KEIYAI+SEH  N +ST K  YHA R+LAN  HPFS F
Sbjct: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187

Query: 186  STGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
             TGN  +L   P+L K+NVK +L  YFK N+    M LC+RG QS+N L KLA   FGD+
Sbjct: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247

Query: 246  SLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISDTVWEE 305
                D   +   +K             QD                      +  D    +
Sbjct: 248  PASRDRDPTRPPLK----KRPSSGVASQD-------------------LHVRPLDFKNSK 284

Query: 306  KYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWRELFGDES 365
            +   V     P   N + I SSK P++R +FPVS K+TR T  DI   S  W + FGDE 
Sbjct: 285  QQTQVQDAFVPDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEG 344

Query: 366  PGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSKLLPSF 425
             GSL+H L +        A ++ F+ GN GL LE  LT  GW S + I T +F   +P  
Sbjct: 345  VGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRL 404

Query: 426  CTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNIFKGFK 485
                   +   L E N  D+  FLYQ +E   ME C+ LS  L    E L P  + KG  
Sbjct: 405  IHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-S 463

Query: 486  SLIEIN-DPN-IEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHNLFD 543
             LIE N +P+ I  Y  +  +  WW G+AIKFQNF+  F+N +N RI++LG+    +L  
Sbjct: 464  PLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLS 523

Query: 544  KIEDESEIHTEFFYEFEYYMGRVH-LSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLKLQ 602
             +   S+  T+ +YEF Y + ++  LS   + +    + F  P  + FLP        ++
Sbjct: 524  SVTSVSK--TDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIK 581

Query: 603  QLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSFEV 662
            Q     S +S+ + L    ++  ++ +P+L  KN N+E+WV +ED + +  + S++S EV
Sbjct: 582  QALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEV 641

Query: 663  IGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISGFS 722
                I+  P  T+ LEVLAQ+L  + S+ LYP+ + GYTYEI+ S+KG+  L FTISGF 
Sbjct: 642  ASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFP 701

Query: 723  EGVFKITKAFVDTLK-LIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLIV 781
            EGV  + +  +D  K LI +D   P+    RKAR+ VR+KYE A+S N   LA++GLLIV
Sbjct: 702  EGVCAMVRVIIDQTKSLINSDTVTPA--MFRKARVAVRNKYEEAASANSTTLATLGLLIV 759

Query: 782  LEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNFT 841
            LEE MW ++DR+DALE  D+ES + FCS F   P  L +  QG+L Y +EI+ +L++  T
Sbjct: 760  LEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLT 819

Query: 842  QHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIEN 901
             HL      + P +R    P T  + PGTN FI  +   +DP++S+ YFIQT  RD+ + 
Sbjct: 820  SHLSR-RTWHEPAVR---EPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQM 875

Query: 902  LTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKIN 961
            L+LT LTE++ S TLVPDLR KKQIGY V SGLR+L+ T+G+HIT MS S    LE++I+
Sbjct: 876  LSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQID 935

Query: 962  EYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLNEIVANVQNGD 1021
            +YL+Y+E  VL+  +E  F+   +                  +GP++LL +I ANV +G+
Sbjct: 936  QYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGN 995

Query: 1022 DYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSRQ 1081
                    M+ H+RIRN IS  R +F  + E  D+  L+ LTL ++  FF  +ISI S  
Sbjct: 996  -LPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTT 1054

Query: 1082 RSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKNL 1141
            RSKLS+M+ SP++ +EIA +++FLQ+E++LK+KG  I S +L  IVE S+G P  L++ L
Sbjct: 1055 RSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGL 1114

Query: 1142 FTFFRKRSEAFKLGTVVLKEISKIIAINFK 1171
            F FF  R E  +L  V+LKE+SK + ++ K
Sbjct: 1115 FKFFLARGETLRLCNVILKELSKAVVLSLK 1144

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1181 (37%), Positives = 674/1181 (57%), Gaps = 62/1181 (5%)

Query: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
            M+   V   ++P Y P+S  NR H+  +L NGI A                     HNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQS- 119
            +++PGLAHLCEHMI+++ SKK+P    +H L+ + NG+QNAFTTGEQT+FYFE+PN+ + 
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 120  NGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANAD 179
             G+  F+  + V A     P+F    I KEI AI +EHE N +  +K  YH  + LA   
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFSHFSTGNIHSLSSVPHLEK--INVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKL 237
              FS FSTGNI++L+  P +    IN+KN L  ++ +NF  EN+++ +RGSQS++ L KL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  AISKFGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXK 297
              + FGD   K+ IK  +FSI++                                    K
Sbjct: 241  VQTTFGDFRTKSTIKSQSFSIES-----------------------------------FK 265

Query: 298  ISDTVWEEKYGS-VSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHL 356
                VW  +Y   +   + P   NSI I SSKAPI+R +FPVS +   F++ ++K++S +
Sbjct: 266  KLQKVWAARYTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKV 325

Query: 357  WRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRS-VESIAT 415
            W +LFGDES GS+     ++   T     +S+F I + GLVL+ ELT +GW++ VES+ T
Sbjct: 326  WSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLT 385

Query: 416  TIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECL 475
             +F   LP F + + D +  +L E N I++ +F+YQ+ ++  M++CS L     E L+C 
Sbjct: 386  DLFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCS---ELLQCE 442

Query: 476  TPCNIFKGFKSL-IEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLG 534
             P  I     +        +I  Y  +  + +WW  QA KF +F+K++M+  N +++ LG
Sbjct: 443  DPQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLG 502

Query: 535  DIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDF 594
            D++S++     +  + +  +  Y F+Y +  + L+    +   SP +F  P+   FL   
Sbjct: 503  DLQSNDFLKSRQVPTNVKFDEHYRFQYELSLIKLN----HVKMSPKDFRLPSSTAFLFGL 558

Query: 595  VNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDN 654
              +   L+Q       KS+ + L    QS+ ++  P+L+SKN NYE+WV KE+ +    +
Sbjct: 559  EKNLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV-KEENSLEYSS 617

Query: 655  VSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTL 714
             SV++ E+I +G++PS + T++LE+L Q+L+   + +LYP+ R GY Y+IA++++G+V L
Sbjct: 618  RSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRL 677

Query: 715  RFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDAL-RKARILVRSKYESASSDNGVKL 773
              TI+GF +GV  I +  +D +  IG  P F   +++ R +RILVR+KYE A+  N   L
Sbjct: 678  AVTINGFPQGVAMILQIIMDKMVDIG-KPDFDITNSMFRHSRILVRTKYEEAARANSCTL 736

Query: 774  ASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQ--LALLIQGNLDYADE 831
            AS+G+LI+LE+ + TL++R+DALE  D+ES K FC   W  PK   + L+IQG+L  A+ 
Sbjct: 737  ASLGVLILLEKELTTLEERLDALEDIDIESFKMFCKDLWI-PKSNYMNLVIQGDLSIAET 795

Query: 832  INHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFI 891
            +N Y+ +    HL   +       RL   P T  +  G+N FI     ++DP NS+ YFI
Sbjct: 796  VNQYM-DGIIHHLSGPNVNQTSVFRLR-EPETIKLAQGSNFFIEMTSFKEDPTNSVVYFI 853

Query: 892  QTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGS 951
            +T  R N  + T++ L EY  S TLVPDLRNKKQIGY+VL GLR+LTDT+GIHI+VMS  
Sbjct: 854  ETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNL 913

Query: 952  SAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXTLSGPSNLLN 1011
              H++E +I EYL YLE  VL   TE+ F+  +L+                 +GP+NL+ 
Sbjct: 914  PPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMA 973

Query: 1012 EIVANVQNGD---DYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYL 1068
            +I A+V +G+   +       +  H+++++ IS +   F E    VD+  L KLTL+++ 
Sbjct: 974  QIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFK 1031

Query: 1069 EFFGSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVE 1128
              F  +ISI S QR KLS+   +PM + +I    M +QL+ FLK KGF I   +L++IV 
Sbjct: 1032 RLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVT 1091

Query: 1129 DSKGSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISK-IIAI 1168
             + G P  L K LF  FR + ++ +L T+VLKEI K I+A+
Sbjct: 1092 KTAGKPTSLFKELFHHFRTQGQSLRLCTLVLKEIVKQILAV 1132

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1229 (31%), Positives = 624/1229 (50%), Gaps = 119/1229 (9%)

Query: 3    LREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPED 62
            + +V  + +PFY+PL + NR +K+ +LPNGI                       HNDP  
Sbjct: 2    ITDVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPAT 61

Query: 63   IPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNT-QSNG 121
            +PGLAHLCEHMILAAGS  +P PGLFH+LIAK NG  NA+TTGEQT+FYF++P    S G
Sbjct: 62   VPGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEG 121

Query: 122  ELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHP 181
             LAFE  L VF+S FK PLF   ++ KEIYAIQSEHE N ++  K+ Y A R+LAN +HP
Sbjct: 122  TLAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHP 181

Query: 182  FSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISK 241
            FS F TG++++L + P  E IN++  L +YF +NFYGEN+TLC+RG QS+N L KL +  
Sbjct: 182  FSRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQN 241

Query: 242  FGDISLKNDIKGSNFSIKAGXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISDT 301
            F      NDIK       A            ++  K                    I   
Sbjct: 242  F------NDIKPLPVLPTAIGNNRDSDTELFEETLKRL-----------------NILYD 278

Query: 302  VWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWRELF 361
            VW  +Y S+ CF    K N I +NS      R + P+   +TR      +V++++  EL 
Sbjct: 279  VWAPRYTSLPCFHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELL 338

Query: 362  GDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSKL 421
            G+E  GS  H+L    W    + + SEFA+G  G+VLE +   TG+  +E+I   +F  L
Sbjct: 339  GNEEVGSFCHFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTL 398

Query: 422  LPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNIF 481
            +P +     D L  F++EQ +I+   F+Y      PMEE S LS  LQ++L         
Sbjct: 399  IPMYLNMPSDDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHN------- 451

Query: 482  KGFKSLIEINDPNIEKYE--NNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGD---- 535
            +G K L+  +   +  YE  +    + +W     KF+ FL+  M   N ++++       
Sbjct: 452  RGIKYLLMKSPSFLHNYEEMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVIIPTSEPFT 511

Query: 536  IKSHNLFDKIED-ESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDF 594
                NLF   +  E    T+ +YEF Y +  V   E        PY+F+FP  N F+P  
Sbjct: 512  KTVRNLFKNAQQMEVTSETDPYYEFNYSVYSVSFPESRVIF---PYQFSFPGPNEFIPPK 568

Query: 595  VNDPLKLQQLYLECSLKSKFATLRP--QIQSEPIEILPQLVSKNLNYEMWVLK-EDPNFT 651
              +   L ++    S ++ F+ LRP  ++++      P+LV +  + E+W     D  F+
Sbjct: 569  YRNLDTLLEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFS 628

Query: 652  ----SDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASS 707
                +D  S V+ +++   I+P+P +++HL ++ +I+ +     LY   + G+++ + ++
Sbjct: 629  KVVNADIKSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAA 688

Query: 708  SKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDA-LRKARILVRSKYESAS 766
              G+++    ++G   G+ KI +   D +++I T P +   +A +RKAR+ +RS+YE+A+
Sbjct: 689  LDGSMSFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAAT 748

Query: 767  SDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQ-GN 825
              + VK+ + GLL+ LE ++W+ ++R+DALE +D+E    F + F++  K   +  Q  +
Sbjct: 749  KGSSVKIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSS 808

Query: 826  LDYADEINHYLNNNFTQHLKVCDEGNRPTIR-LYPSPNTKNIDPGTNAFISCNGHQDDPN 884
                D+I  Y+            EGN   +  +    +T+ + PG    I   G  +DPN
Sbjct: 809  TSNIDKIARYVVQRIVT--PGIPEGNDALVECVRDDGHTRMLKPGEERHIKLIGRDNDPN 866

Query: 885  NSLAYFIQTAQRDNI--ENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIG 942
            N +  +++ A  + I  +   +   T+Y+F  TLVP+LRNK+Q+GY V  GL IL + +G
Sbjct: 867  NCVFSYLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVG 926

Query: 943  IHITVMSGSSAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPXXXXXXXXXXXXXXT 1002
            +++ V+S +S   +E +I  Y +++  Q L++  +  +R                     
Sbjct: 927  VNVVVVSSTSPEHIEQEIESYYAHVR-QYLSDNVDQIWRDY------------------- 966

Query: 1003 LSGPSNLLNEIVANVQNGDDYILNNRQMKHHRRIRNSISE-KRLHFQ------EENEMVD 1055
                S ++N+     ++   Y+L++    +  R  + I E  R H        +  ++++
Sbjct: 967  ----SKIIND-----RDPLMYLLDHDVWYNIERENSDIPEYSRDHVANCQRVFKYKDLIE 1017

Query: 1056 ILFLQK------------LTLKKYLEFFGSRISIYSRQR-----SKLSIMITSPMAEEEI 1098
            +L +               ++++YL+F  S I  Y  +R       +S+ + SPM + ++
Sbjct: 1018 LLVVDTPISGRHPDYTPPFSMQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDV 1077

Query: 1099 ASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKNLFTFFRKRSEAFKLGTVV 1158
              R++  QLE+FLK+KG  I  RDL  I+ ++ G    + K L+  F++++EA K    V
Sbjct: 1078 FQRQVKYQLESFLKLKGLVIPERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSV 1137

Query: 1159 LKEISKIIAINFKQTYGSVLGFSSKDSEQ 1187
              E           T+ S+L   SK + Q
Sbjct: 1138 ATE-----------TFKSILHIPSKTTAQ 1155

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  144 bits (362), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 108/401 (26%), Positives = 172/401 (42%), Gaps = 69/401 (17%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R ++  +LPN +                         DPE +PGLAH CEH++   GS+
Sbjct: 19  DRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGLAHFCEHLLFM-GSE 77

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           KYPD   + + ++ N GS NA+T    T ++FE+     N E   E  LD F+ FF  PL
Sbjct: 78  KYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEI-----NYE-HLEGALDRFSGFFSRPL 131

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           F+     KEI A+ SE++ N+ S     Y   + L+N  HP+  FSTGNI +L ++P+ +
Sbjct: 132 FSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHPYHKFSTGNIQTLGTIPNEQ 191

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDISLKNDIKGSNFSIKA 260
            +++++ L  ++ N++    M L + G + ++IL   A S F       D+K  N  +  
Sbjct: 192 GLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMF------KDVKNLNREL-- 243

Query: 261 GXXXXXXXXXXXQDASKXXXXXXXXXXXXXXXXXXXKISDTVWEEKYGSVSCFENPSKYN 320
                                                    V+EEK  +        +Y 
Sbjct: 244 ----------------------------------------PVYEEKMLT-------EEYL 256

Query: 321 SIFINSSKAPIVRFL---FPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKG 377
              IN      +R L   F V D +  +  +  ++ SHL     G E  GSL  +L   G
Sbjct: 257 MQIINIKPVQDMRKLELSFTVPDLDKEWESKTPRILSHL----LGHEGSGSLLAHLKCLG 312

Query: 378 WATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIF 418
           WAT   A     +  N    ++++LT+ G+   E +   IF
Sbjct: 313 WATELAAGGHTISDDNAVFSVDIDLTEEGFNHYEDVTVAIF 353

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 60/276 (21%), Positives = 113/276 (40%), Gaps = 47/276 (17%)

Query: 706 SSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESA 765
           S SK    L  T+SGF+  +  + ++F+  +K             L K+R L+  +    
Sbjct: 577 SFSKTGQGLDITVSGFNHKILILLESFLKGIKNF----------KLEKSRFLIFQEKYIQ 626

Query: 766 SSDNGVKLASIGLL-----IVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLAL 820
              N +     G +      V+++  W++++++  ++    E L+NF    + N      
Sbjct: 627 QLKNMLFQVPYGQVSHYYNYVIDDRAWSIKEKLSTMQKLTFEDLENFLPTIF-NEVYFES 685

Query: 821 LIQGNLDYAD--EINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNG 878
           L+ GN + +D  E+N  +    +  +      + P IR          +    +++   G
Sbjct: 686 LVHGNFEKSDAAEVNQLVEKYISGSI------HNPQIR----------NDRLRSYVLQKG 729

Query: 879 HQ-------DDPNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPD----LRNKKQIG 927
                    +DP N +   IQ   +  + N  L  L+  +F+Q +       LR K+Q+G
Sbjct: 730 ETYRYETLLEDPEN-VNSCIQHVTQIGLYNDRLAALSS-LFAQIINEPCFNILRTKEQLG 787

Query: 928 YIVLSGLRILTDTIGIHITVMSGSSAHSLETKINEY 963
           Y+V S       T  I I V S  +   LE +I+E+
Sbjct: 788 YVVFSSSLNNYGTTNIRILVQSEHTTEYLEWRIDEF 823

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  142 bits (357), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 118/225 (52%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R ++  +LPN + A                       DPE +PGLAH CEH++   G++
Sbjct: 59  DRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEHLLFM-GNE 117

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           KYPD   + + ++K+ GS NA+T  + T +YF L     N E  + + LD F+ FF  PL
Sbjct: 118 KYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHL-----NHENLYPA-LDRFSGFFSCPL 171

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           FN     KEI A+ SE++ N+ +     Y   + L N +HP+  FSTGNI +L  +P L+
Sbjct: 172 FNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTLGDIPKLK 231

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            I+++N L  + KNN+    M LC+ G + ++ L       F D+
Sbjct: 232 GIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDV 276

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 37/90 (41%), Gaps = 4/90 (4%)

Query: 332 VRFLFPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAI 391
           + F FP  D +  +  +     SHL     G E  GSL  +L  KGWA    A     + 
Sbjct: 311 IEFTFPTPDMDPYWESKPNHYLSHL----IGHEGNGSLLAFLKEKGWAVELSAGSHTISK 366

Query: 392 GNIGLVLELELTKTGWRSVESIATTIFSKL 421
            N    +E++LT  G   V  I  + F  L
Sbjct: 367 DNAVFGIEIDLTDDGMNHVNEIIISTFQYL 396

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 83/189 (43%), Gaps = 14/189 (7%)

Query: 781 VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGN--LDYADEINHYLNN 838
           ++ E  WT + ++D  +    E LK+F    ++     +L++ GN  ++ A EIN  ++ 
Sbjct: 687 LVNERSWTTKAKLDVTKDLTFEHLKSFVPTIYEQLFHESLVL-GNFSVEMAYEINQLVD- 744

Query: 839 NFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQD--DPNNSLAYFIQTAQR 896
                + V D    P + +  +     I P  +AF      +D  + N+ + Y IQ    
Sbjct: 745 -----ILVVDR--IPNLEVKNNKLRSYILPEESAFRYEYMLEDKANVNSCIQYLIQLGAY 797

Query: 897 DNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSL 956
              E      L   +  +     LR K+Q+GYIV S +     T  + + V S   +  +
Sbjct: 798 SE-ELAAKASLVSQLIHEPCFDTLRTKEQLGYIVFSAVANTHGTTNLRVLVQSERDSAYV 856

Query: 957 ETKINEYLS 965
           E++I ++L+
Sbjct: 857 ESRIVKFLN 865

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  139 bits (351), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 118/225 (52%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R+++  +LPN + A                       DPE +PGLAH CEH++   GS+
Sbjct: 46  DRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDPEGLPGLAHFCEHLLFM-GSE 104

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           KYPD   + + ++K+ G+ NA+T  + T +YFE+     N E  F   LD FA FF  PL
Sbjct: 105 KYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEV-----NHEHLF-GALDRFAGFFTCPL 158

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           FN     KEI A+ SE++ N+ S     Y   + L N +HP+  FSTGN  +L  +P   
Sbjct: 159 FNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEHPYHKFSTGNFITLHEIPTSN 218

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            I+V+  L  ++K ++    M LC+ G + ++ L+  A S F D+
Sbjct: 219 GIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACSLFQDV 263

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           H+   L G E  GSL  +L  KGWA    A     +  N    ++++LT  G +  E + 
Sbjct: 317 HILSHLVGHEGSGSLLAHLKDKGWANELSAGGHSVSKENAFFSIDIDLTDLGLKHYEDVT 376

Query: 415 TTIFSKL 421
             IF  L
Sbjct: 377 HIIFQYL 383

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 119/226 (52%), Gaps = 9/226 (3%)

Query: 22  RTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSKK 81
           R+++  +LPN + A                       DPE +PGLAH CEH++   GS+K
Sbjct: 72  RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESLPGLAHFCEHLLFM-GSEK 130

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+ +    G       LD FA FF  PLF
Sbjct: 131 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEINHQHLFG------ALDRFAGFFSCPLF 184

Query: 142 NPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLEK 201
           N     KEI A+ SE++ N+ +     Y   + L N +HP+  FSTGNI +L ++P    
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHPYHKFSTGNIETLGTLPKENG 244

Query: 202 INVKNSLNTYFKNNFYGEN-MTLCMRGSQSVNILTKLAISKFGDIS 246
            NV++ L   F NNFY  N M LC+ G + ++ L+    + F DIS
Sbjct: 245 QNVRDEL-LQFHNNFYSANLMKLCILGREDLDTLSDWTYNLFKDIS 289

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 336 FPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIG 395
           F V D + ++  +  ++ SHL     G E  GSL  +L + GWA    A     + GN  
Sbjct: 327 FTVPDMDEKWESKPPRILSHL----IGHEGSGSLLAHLKNVGWANELSAGGHTVSKGNAF 382

Query: 396 LVLELELTKTGWRSVESIATTIF 418
             ++++LT  G      +   +F
Sbjct: 383 FAVDIDLTDNGLTHYRDVIVLVF 405

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  139 bits (349), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 122/232 (52%), Gaps = 7/232 (3%)

Query: 14  YIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHM 73
           +I     +R+++  +LPN + A                      +DPE++PGLAH CEH+
Sbjct: 40  FIKPDLDDRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEELPGLAHFCEHL 99

Query: 74  ILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFA 133
           +   GS+K+PD   + + ++K+ GS NA+T  + T +YF++ +    G       LD F+
Sbjct: 100 LFM-GSRKFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQVNHEHLKG------ALDRFS 152

Query: 134 SFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSL 193
            FF  PLF+     KEI A+ SE++ N+ +     Y   + L+N  HP+  FSTGN+ +L
Sbjct: 153 GFFTGPLFSKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHPYHKFSTGNLKTL 212

Query: 194 SSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
           + +P  + ++V+N L  ++   +    M LC+ G + ++ L+  A   F D+
Sbjct: 213 NEIPKSKGVDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELFSDV 264

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 104/269 (38%), Gaps = 37/269 (13%)

Query: 709 KGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTD----PTFPSKDALRKARILVRSKYES 764
           K N  L  TI+GF++ +  +   F++ LK    D      F  K        L    Y  
Sbjct: 608 KTNEGLDITITGFNDKLIILLTRFLEGLKAFKPDRKRFEIFKEKSKQHLNNQLYEIPYSQ 667

Query: 765 ASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQG 824
            SS             ++ E  WT +++++ +E    E L+ F    ++       L+ G
Sbjct: 668 VSSLYNS---------LVNERSWTAEEKLEVVEQLTFEQLEAFIPTIFEE-MFFETLVHG 717

Query: 825 NLDY--ADEIN---HYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGH 879
           N+ Y  AD+I+     L +N   + ++        IR Y  P  K     T+ + +    
Sbjct: 718 NIKYEEADQIDSLIQMLRSNSVSNSQI----KNARIRSYVLPLGK-----THRYEAKLAD 768

Query: 880 QDDPNNSLAYFIQTAQRDN----IENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLR 935
             + N+ + Y IQ    D     I  L    L E  F       LR K+Q+GY+V S   
Sbjct: 769 TQNVNSCIQYVIQLGVYDEALSAIGRLFAQMLHEPCFDT-----LRTKEQLGYVVFSSSL 823

Query: 936 ILTDTIGIHITVMSGSSAHSLETKINEYL 964
               T  I I + S  +   LE +I  +L
Sbjct: 824 NNHGTANIRILIQSEHTTPYLEWRIESFL 852

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 354 SHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESI 413
           +H+   L G E  GSL  +L S GWA    A     +  N    ++++LT  G +  E +
Sbjct: 317 NHILSHLIGHEGSGSLLAHLKSLGWANELSAGGHTVSKSNAFFCIDIDLTDEGLKHHEDV 376

Query: 414 ATTIF 418
             TIF
Sbjct: 377 THTIF 381

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  139 bits (349), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 126/249 (50%), Gaps = 8/249 (3%)

Query: 1   MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
           M+     N+ + F  P     R+++  +LPN + A                      NDP
Sbjct: 25  MTAASYKNHNLSFQKP-DLDERSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
           E +PGLAH CEH++   GS+K+PD   + + ++K+ G  NA+T    T ++FE+     N
Sbjct: 84  EPLPGLAHFCEHLLFM-GSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEI-----N 137

Query: 121 GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
            E  F   LD F+ FF  PLFN     KEI A+ SE++ N+ +     Y   + L+N  H
Sbjct: 138 AEHLF-GALDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLKH 196

Query: 181 PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
           P+  FSTGNI +L  +P  + +N+++ L  ++ +++    M LC+ G + ++ L +    
Sbjct: 197 PYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTAD 256

Query: 241 KFGDISLKN 249
            F D+  K+
Sbjct: 257 LFNDVKNKD 265

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 109/285 (38%), Gaps = 29/285 (10%)

Query: 705 ASSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDAL-----RKARILVR 759
           AS +K N  L  T+SGF++ +  +   F+  +K        P+ D       +  + L  
Sbjct: 602 ASLTKTNQGLDITVSGFNDKLIILLTRFLQGIKSFK-----PNSDRFQIFKDKTIQHLQN 656

Query: 760 SKYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLA 819
           S YE   S       S+     + E  WT  +++ AL+    + L  F    ++      
Sbjct: 657 SLYEVPYSQMSTLYNSL-----INERTWTTTEKLSALDKISYDQLLTFIPTIFEE-LYFE 710

Query: 820 LLIQGNLDY--ADEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCN 877
            LI GNL Y  A EI+  +    T++  +  +     +R Y  P  K     T+      
Sbjct: 711 SLIHGNLKYDEAMEIDSLVKLLLTENNILNLQIQNDKLRSYILPKGKTFRYETDL----- 765

Query: 878 GHQDDPNNSLAYFIQTAQRD--NIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLR 935
               DP N  +      Q D  + E      L   +  +     LR K+Q+GY+V S   
Sbjct: 766 ---KDPKNVNSCIQHVTQIDIYSEELSAKCALFAQMIHEPCFDTLRTKEQLGYVVFSSTL 822

Query: 936 ILTDTIGIHITVMSGSSAHSLETKINEYLSYLEFQVLNNFTESTF 980
               T  I I V S  S   LE +I+ +      + L   +E TF
Sbjct: 823 NNHGTANIRILVQSEKSTPYLEWRIDNFYKIFG-KSLKTMSEDTF 866

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  137 bits (344), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 117/225 (52%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R ++  +LPN + A                       DPE++PGLAH CEH++   GS+
Sbjct: 60  DRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPGLAHFCEHLLFM-GSE 118

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           K+PD   + + ++K+ GS NA+T  + T ++FE+     +G       LD F+ FF  PL
Sbjct: 119 KFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEVNADHLHG------ALDRFSGFFSCPL 172

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           FN     KEI A+ SE++ N+ +     Y   + L+N DHP+  FSTGN+ +L   P   
Sbjct: 173 FNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFSTGNLETLGDKPKAA 232

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            ++++  L  ++  N+    M LC+ G + ++ L++ A   F D+
Sbjct: 233 GLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDV 277

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 124/288 (43%), Gaps = 43/288 (14%)

Query: 709 KGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILV---RSKYESA 765
           K N  L  TISGF+E +  + K FV+ ++  G +P        +K R  V   ++ +   
Sbjct: 622 KTNQGLDITISGFNEKLLILLKRFVEGVQ--GFEP--------KKERFEVFKDKTVHHLK 671

Query: 766 SSDNGVKLASIGLLI--VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQ 823
           +    V  + I  L   V+ E  W  +++++  E    E L NF    + +       + 
Sbjct: 672 NQMMEVPYSQISGLYNSVVNERTWPTKEKLEVAEKLKFEQLDNFVRAIY-DGMYYESFVH 730

Query: 824 GNLDYADE------INHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCN 877
           GNL+  +       ++ +L  +  +++ V  + NR  +R Y  P  K+    T+ +    
Sbjct: 731 GNLESKEAREVDSLVSTFLKKDDIKNIDV--QSNR--LRSYIIPKGKSYAYETDLY---- 782

Query: 878 GHQDDPNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQTL----VPDLRNKKQIGYIVLSG 933
               D NN  +      Q D + N  L+ L+  +F+Q L       LR K+Q+GY+V S 
Sbjct: 783 ----DENNVNSCIQHVVQLD-VYNEKLSALSG-LFAQMLHEPCFDILRTKEQLGYVVFSS 836

Query: 934 LRILTDTIGIHITVMSGSSAHSLETKINEYLSYLEF-QVLNNFTESTF 980
                 T  I I V S  +   LE +I+E+  Y  F + L N  E  F
Sbjct: 837 SLNNHGTANIRILVQSEHTTPYLEWRIDEF--YKTFGEKLRNMDEEDF 882

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%)

Query: 354 SHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESI 413
           SH++  L G E  GSL  +L S GWA    A     + GN    +++ELT  G +  + I
Sbjct: 330 SHIFSHLIGHEGSGSLLAHLKSLGWANELGAGGHTVSDGNAFFNVDIELTNEGLKHYKDI 389

Query: 414 ATTIFSKL 421
              IF  L
Sbjct: 390 VVLIFQYL 397

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  134 bits (337), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 116/225 (51%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R+++  +LPN + A                       DPE +PGLAH CEH++   GS+
Sbjct: 49  DRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHLLFM-GSE 107

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           K+PD   + + ++K+ G  NA+T  + T ++FE+      G       LD F+ FF  PL
Sbjct: 108 KFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEINYEHLKG------ALDRFSGFFSCPL 161

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           FN     KEI A+ SE++ N+ S     Y   + L+  DHP+  FSTGN+ +L  +P  +
Sbjct: 162 FNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPESK 221

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            +NV++ L  ++  N+    M LC+ G + ++ L+    S F D+
Sbjct: 222 NVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDV 266

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 142/643 (22%), Positives = 257/643 (39%), Gaps = 105/643 (16%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           H+   L G E  GSL  +L + GWA    A     + GN    ++++LT+ G ++ E + 
Sbjct: 320 HILSHLIGHEGNGSLLSHLKTLGWANELSAGGHTVSRGNAFFSIDIDLTENGLKNYEQVI 379

Query: 415 TTIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLEC 474
              F  +       ++     +L  QN+ + A F ++   + P    S LS +L++  E 
Sbjct: 380 LLAFQYI--EMLKNSLPQKWIYLELQNIAN-ANFKFKQKGN-PSSTVSSLSKLLEK--EY 433

Query: 475 LTPCNIFKGFKSLIEINDPN-IEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLL 533
           +   NI      L    +P  +EKY                      S M + N+RI L+
Sbjct: 434 IPVGNILST--GLFNKYEPELVEKY---------------------LSEMIYSNSRITLI 470

Query: 534 GDIKSHNLFDKIEDESEIHTEFF---YEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPF 590
               S NL      E++   +++   Y+ E Y   V L    K    +P  F+ P  N F
Sbjct: 471 ----SKNL------ETDSKEKWYGTKYKLEDY--SVDLINKIKTPGLNP-NFHLPRPNEF 517

Query: 591 LPDFVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNY-EMWVLKEDPN 649
           + D                    F   +P+ +S+ I +   L+ K+ +  ++W  K+D  
Sbjct: 518 IAD-------------------NFHVDKPKNESDIIPLEEPLLLKDTSMGKLWYKKDDRF 558

Query: 650 FTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALR--AGYTYEIASS 707
           +       +SF++      P   +T+ L  +   L++   ++    L+  A       S 
Sbjct: 559 WQPRGYIKISFKL------PHTHSTL-LNSMLTTLYVQMVNDSLKDLQYDASCANLHVSL 611

Query: 708 SKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARI--LVRSKYESA 765
           SK N  L  ++SGF++ +  +   F+  +K     PT       +   I  L  S YE  
Sbjct: 612 SKTNQGLDISLSGFNDKLIILLTRFLQGIK--DFKPTSERFQIFKDKTIQHLKNSMYEVP 669

Query: 766 SSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGN 825
            S    +++S+   ++  E  W  +++++ +    ++ L +F    + +       + GN
Sbjct: 670 YS----QMSSLYNALI-NEKTWLPEEKLNMMNKLTLDQLNSFIPFIF-DELFFECFVHGN 723

Query: 826 LDY--ADEINHYLNNNFTQHLKVCD-EGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDD 882
           L Y  A EI   ++   +    + + +     +R Y  P  K     T  + +    + +
Sbjct: 724 LKYDEAIEIESLIDLLMSSKENLTNSQYENEKLRSYLLPKNK-----TYRYETLLKDRKN 778

Query: 883 PNNSLAYFIQ----TAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILT 938
            N+ + + IQ    + +   I  L    L E  F       LR K+Q+GY+V S      
Sbjct: 779 VNSCIQHVIQVDIYSEELSAICGLFAQMLHEPCFDT-----LRTKEQLGYVVFSSTLNNH 833

Query: 939 DTIGIHITVMSGSSAHSLETKINEYLSYLEF-QVLNNFTESTF 980
            T  I I V S  S   LE +I+E+  Y +F  +LN  ++  F
Sbjct: 834 GTANIRILVQSEKSTPYLEWRIDEF--YKKFGDLLNGMSDEDF 874

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  133 bits (335), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 119/226 (52%), Gaps = 9/226 (3%)

Query: 22  RTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSKK 81
           R+++  +LPN + A                       DP+++PGLAH CEH++   GS+K
Sbjct: 72  RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLPGLAHFCEHLLFM-GSEK 130

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+ +    G       LD F+ FF  PLF
Sbjct: 131 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVNHQHLFG------ALDRFSGFFSCPLF 184

Query: 142 NPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLEK 201
           N     KEI A+ SE++ N+ +     Y   + L N  HP+  FSTGNI +L ++P    
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTLPKENG 244

Query: 202 INVKNSLNTYFKNNFYGEN-MTLCMRGSQSVNILTKLAISKFGDIS 246
           +NV++ L  + K NFY  N M LC+ G + ++ L+      F D++
Sbjct: 245 LNVRDELLKFHK-NFYSANLMKLCILGREDLDTLSDWTYDLFKDVA 289

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 144/370 (38%), Gaps = 48/370 (12%)

Query: 624 EPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQI 683
           EP+ +L   VSK     +W  K+D  +       +SF++      P   A+I   +L+ +
Sbjct: 557 EPVLLLSDDVSK-----LWYKKDDRFWQPRGYIYLSFKL------PHTHASIINSMLSTL 605

Query: 684 LFITTSSNLYPALRAGYTYEIASS-SKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTD 742
                +  L          ++  S +K N  L  T SGF+E +  +   F     L G +
Sbjct: 606 YTQLANDALKDVQYDAACADLRISFNKTNQGLAITASGFNEKLIILLTRF-----LQGVN 660

Query: 743 PTFPSKDAL-----RKARILVRSKYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALE 797
              P KD       +  R L    YE   S       +I     + E  W+  +++   E
Sbjct: 661 SFEPKKDRFEILKDKTIRHLKNLLYEVPYSQMSNYYNAI-----INERSWSTAEKLQVFE 715

Query: 798 LTDMESLKNFCSLFWKNPKQLALLIQGNLDY-----ADEINHYLNNNFTQHLKVCDEGNR 852
               E L NF    ++       LI GN+ +      D +   L  N   +L+V +  NR
Sbjct: 716 KLTFEQLINFIPTIYEG-VYFETLIHGNIKHEEALEVDSLIKSLIPNNIHNLQVSN--NR 772

Query: 853 PTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIENLT-LTFLTEYI 911
             +R Y  P  K     T  + +      + N+ + +  Q       E+L+ L+ L   +
Sbjct: 773 --LRSYLLPKGK-----TFRYETALKDSQNVNSCIQHVTQLDVYS--EDLSALSGLFAQL 823

Query: 912 FSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKINEYLSYLEF-Q 970
             +     LR K+Q+GY+V S       T  I I + S  +   LE +IN +  Y  F Q
Sbjct: 824 IHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNF--YETFGQ 881

Query: 971 VLNNFTESTF 980
           VL +  E  F
Sbjct: 882 VLRDMPEEDF 891

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 336 FPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIG 395
           F V D    +  +  ++ SHL     G E  GSL  +L   GWA    A     + GN  
Sbjct: 327 FTVPDMEEHWESKPPRILSHL----IGHEGSGSLLAHLKKLGWANELSAGGHTVSKGNAF 382

Query: 396 LVLELELTKTGWRSVESIATTIF 418
             ++++LT  G      +   IF
Sbjct: 383 FAVDIDLTDNGLTHYRDVIVLIF 405

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  132 bits (333), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 14  YIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHM 73
           +I     +R+++  KLPN + A                       DPE +PGLAH CEH+
Sbjct: 54  FIKPDLDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGLAHFCEHL 113

Query: 74  ILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFA 133
           +   GS+K+PD   + + ++K+ GS NA+T+   T +YFE+     N E  + + LD F+
Sbjct: 114 LFM-GSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEV-----NHEHLY-NALDRFS 166

Query: 134 SFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSL 193
            FF  PLFN     KEI A+ SE++ N+ +     Y   + L+N  HP+  FSTGN+ +L
Sbjct: 167 GFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHKFSTGNLITL 226

Query: 194 SSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
              P    +N+++ L  ++ +++    M LC+ G + ++ L+  A   F D+
Sbjct: 227 GENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDV 278

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 147/650 (22%), Positives = 249/650 (38%), Gaps = 122/650 (18%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           HL   L G E  GSL  YL +KGWA    A     +  N    +++ELTK G  S + + 
Sbjct: 332 HLLSHLIGHEGSGSLLAYLKAKGWANELSAGGHTVSKDNAFFSIDVELTKDGLESYKEVV 391

Query: 415 TTIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQEN--- 471
            +IF  +       ++     F+  QN I  A F ++   + P    S L+ +L++    
Sbjct: 392 HSIFQYI--EMLRNSLPQDWIFVELQN-ISRANFKFKQKGN-PASTVSALARLLEKEYIP 447

Query: 472 LECLTPCNIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRIL 531
           +E +   N+F         ++P                       N+++S +  EN+RI 
Sbjct: 448 VENILSTNVFTK-------DEPQT-------------------LMNYVQS-LTLENSRIT 480

Query: 532 LLGDIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSP---YEFNFPTKN 588
           L+            +D      E +Y+ +Y +  ++  ED +   +SP    +   P  N
Sbjct: 481 LIS-----------QDLETDSNEKWYKTDYKV--INYPEDMRKKCKSPGLNTQLRLPRPN 527

Query: 589 PFLPD-FVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKED 647
            F+ + F+ D               K  ++ P    EP+ +    +SK     +W  K+D
Sbjct: 528 EFVANNFLVD---------------KLESVTPS--EEPLLLKDTKLSK-----LWFKKDD 565

Query: 648 PNFTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIA-- 705
             +       VS ++      P   A++ L  +   +++  +++    L+  Y    A  
Sbjct: 566 RFWQPRGYIYVSLKL------PHTHASV-LNSMLSTIYVQLANDFLKDLQ--YDASCANL 616

Query: 706 --SSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPT------FPSKDALRKARIL 757
             S  K N  L  T+SGF++ +  +   F+  +K     PT      F  K       +L
Sbjct: 617 NLSFVKTNQGLDITLSGFNDKLVTLMTRFLQGVK--DFKPTEERFKIFKDKTTQHLKNLL 674

Query: 758 VRSKYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQ 817
               Y   S   GV  + I       E  W+++++++ +E    E L  F    ++    
Sbjct: 675 YEVPYSQIS---GVYNSLIN------ERSWSVEEKLNVVEHITFEQLLAFIPTVFEEL-Y 724

Query: 818 LALLIQGNLDY--ADEINHYLNNNFT---QHLKVCDEGNRPTIRLYPSPNTKNIDPGTNA 872
              L+ GNL +  A EI   +N+       H  +  + NR  +R Y  P  K     T  
Sbjct: 725 YETLVHGNLKFEEAIEIESLINDILITNENHNNLQVKNNR--LRSYFIPKGK-----TYR 777

Query: 873 FISCNGHQDDPNNSLAYFIQTAQRD--NIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIV 930
           F        D  N  +      Q D  N E   L+ L   +  +     LR K+Q+GY+V
Sbjct: 778 F---EKELKDSKNVNSCIQHVTQLDVYNEELSALSGLFAQMIHEPCFDTLRTKEQLGYVV 834

Query: 931 LSGLRILTDTIGIHITVMSGSSAHSLETKINEYLSYLEFQVLNNFTESTF 980
            S       T  I I V S  +   LE +I E+ S     +L + +E  F
Sbjct: 835 FSSSLNNHGTANIRILVQSEHTTPYLEWRIEEFYSKFG-AILKDMSEEDF 883

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  132 bits (332), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 123/238 (51%), Gaps = 8/238 (3%)

Query: 8   NYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLA 67
           N+ I F  PL   +R ++  +LPN +                         DPE++PGLA
Sbjct: 43  NHNIEFKKPL-LDDREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPENLPGLA 101

Query: 68  HLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFES 127
           H CEH++   GS KYP+   + + ++K+ G  NA+T+ + T ++F++     +G      
Sbjct: 102 HFCEHLLFM-GSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQVNQGNLHG------ 154

Query: 128 TLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFST 187
            LD F+ FF  PLFN     KEI A+ SE++ N+ S     Y   +  ++ +HP+  FST
Sbjct: 155 ALDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHPYHKFST 214

Query: 188 GNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
           GN+ +L  +P  + ++V++ L  ++  ++    M LC+ G + +++L++     F D+
Sbjct: 215 GNLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDLFKDV 272

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 87/209 (41%), Gaps = 14/209 (6%)

Query: 781 VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDY--ADEINHYLNN 838
           ++ E  WT++D+++ +E    + L+NF    ++       L+ GN  Y  A EI+  +  
Sbjct: 683 LINERSWTIKDKLEVVEQLTFQHLENFLPTIFEQ-FFFEALVHGNFSYETAVEIHKLVKA 741

Query: 839 NFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDN 898
                +K C       +     P + +I PG   +       +   NS    +      +
Sbjct: 742 LAPNDIKNC-------LLKSSKPRSLHIPPGRAYYYEQRLADEKNINSCIQHVNQFGTYS 794

Query: 899 IENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLET 958
            E      L   +  +     LR K+Q+GY+V S       T+ + I + S      LE+
Sbjct: 795 EELAAKAALFAQLIDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRILIQSERDTAFLES 854

Query: 959 KINEYLSYLEFQVLNNFTESTF---RTML 984
           +I+ +L+ +  Q+L + +E  F   RT L
Sbjct: 855 RIDAFLAKMG-QILQDMSEEEFERHRTAL 882

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           H    L G E  GSL  YL SKGWA    A     +  N    + ++LT  G  + E + 
Sbjct: 326 HYLSHLIGHEGSGSLLAYLKSKGWANELSAGSHTVSKDNGFFSISIDLTDEGIANYEDVV 385

Query: 415 TTIF 418
            ++F
Sbjct: 386 ISVF 389

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  131 bits (330), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 119/226 (52%), Gaps = 9/226 (3%)

Query: 22  RTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSKK 81
           R+++  +LPN + A                       DPE +PGLAH CEH++   GS+K
Sbjct: 72  RSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEHLLFM-GSEK 130

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+     N +  F++ LD F+ FF  PLF
Sbjct: 131 FPDENEYSSFLSKHGGSSNAYTASQNTNYFFEV-----NHQHLFDA-LDRFSGFFSCPLF 184

Query: 142 NPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLEK 201
           N     KEI A+ SE++ N+ +     Y   + L N  HP+  FSTGNI +L + P    
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPKENG 244

Query: 202 INVKNSLNTYFKNNFYGEN-MTLCMRGSQSVNILTKLAISKFGDIS 246
           +N+++ L   F  +FY  N M LC+ G + ++ L+      F ++S
Sbjct: 245 LNIRDEL-LKFHKDFYSANLMKLCILGREDLDTLSDWVYDLFKNVS 289

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 109/284 (38%), Gaps = 30/284 (10%)

Query: 706 SSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDAL-----RKARILVRS 760
           S SK N  L  T SGF+E +  +   F     L G     P KD       +  R L   
Sbjct: 629 SFSKTNQGLDITASGFNEKLIILLTRF-----LQGVTSFEPKKDRFEILKDKTIRHLKNL 683

Query: 761 KYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLAL 820
            YE   S       ++     + E  W+  +++   E    E L NF    ++       
Sbjct: 684 LYEVPYSQMSNYYNAL-----INERSWSTVEKLQVFEKLTFEQLINFIPTIYEGV-FFET 737

Query: 821 LIQGNLDY--ADEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNG 878
           LI GN+ +  A E++  + +  T ++      N   +R Y  P  K       +F     
Sbjct: 738 LIHGNIKHEEAVEVDSLIKSLITNNINNLQVANN-RLRSYLLPKGK-------SFRYETA 789

Query: 879 HQDDPN-NSLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRIL 937
            +D  N NS    +      + E   L+ L   +  +     LR K+Q+GY+V S     
Sbjct: 790 LKDSQNVNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNN 849

Query: 938 TDTIGIHITVMSGSSAHSLETKINEYLSYLEF-QVLNNFTESTF 980
             T  I I + S  +   LE +IN +  Y  F Q+L + T+  F
Sbjct: 850 HGTANIRILIQSEHTTPYLEWRINNF--YETFGQILRDMTKEDF 891

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 4/83 (4%)

Query: 336 FPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIG 395
           F V D    +     ++ SHL     G E  GSL  +L   GWA    A     + GN  
Sbjct: 327 FAVPDMEEHWESRPPRILSHL----IGHEGSGSLLAHLKKLGWANELSAGGHTVSKGNAF 382

Query: 396 LVLELELTKTGWRSVESIATTIF 418
             ++++LT  G      +   IF
Sbjct: 383 FAVDIDLTDNGLIHYRDVIILIF 405

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  131 bits (330), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 118/226 (52%), Gaps = 9/226 (3%)

Query: 22  RTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSKK 81
           R+++  +LPN + A                       DPE++PGLAH CEH++   GS+K
Sbjct: 73  RSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENLPGLAHFCEHLLFM-GSEK 131

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+ +    G       LD F+ FF  PLF
Sbjct: 132 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVNHQHLLG------ALDRFSGFFSCPLF 185

Query: 142 NPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLEK 201
                 KEI A+ SE++ N+ +     Y   + L N+ HP+  FSTGNI +L   P    
Sbjct: 186 QKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHPYHKFSTGNIETLGESPKENG 245

Query: 202 INVKNSLNTYFKNNFYGEN-MTLCMRGSQSVNILTKLAISKFGDIS 246
           +N+++ L  + K +FY  N M LC+ G + ++ L++     F D+S
Sbjct: 246 LNIRDELLKFHK-HFYSANIMKLCILGREDLDTLSEWTYDLFKDVS 290

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 149/667 (22%), Positives = 247/667 (37%), Gaps = 124/667 (18%)

Query: 336 FPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIG 395
           F V D    +  +  ++ SHL     G E  GSL  +L   GWA    A     + GN  
Sbjct: 328 FTVPDMEEHWKSKPPRILSHL----IGHEGSGSLLAHLKELGWANELSAGGHTVSKGNAF 383

Query: 396 LVLELELTKTGWRSVESIATTIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSED 455
             ++++LT  G      +   IF  +       ++     F   Q+ I  A F ++ + +
Sbjct: 384 FAVDIDLTDNGLTHYRDVIVLIFQYI--GMLKNSLPQKWIFTELQD-ISNATFKFKQAGN 440

Query: 456 LPMEECSHLSGILQENLECLTPCNIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKF 515
            P    S L+ +L+ +     P +       L E     I KY          T   I  
Sbjct: 441 -PSSTVSSLAKLLERDY---IPVDKILAMGLLTEYEPDLITKY----------TEALIP- 485

Query: 516 QNFLKSFMNHENTRILLLGDIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYH 575
                     EN+R+ L+           +E +S   +E +YE +Y +  +   ED    
Sbjct: 486 ----------ENSRVTLISR--------GLETDS---SEKWYETKYKI--LDYPEDLLKD 522

Query: 576 SQSPY---EFNFPTKNPFLPDFVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQL 632
            +SP      N P  N    +FV+   K+          +K   ++P    EP+ +L   
Sbjct: 523 IKSPGLNPALNLPRPN----EFVSTNFKV----------NKIDGVKPT--DEPMLLLSSG 566

Query: 633 VSKNLNYEMWVLKEDPNFTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNL 692
           +S+     +W  K+D  +       +SF++      P   A++ +  +   L+I   ++ 
Sbjct: 567 MSR-----LWYKKDDRFWQPRGYIYLSFKL------PHTHASV-INSMLSTLYIQMINDA 614

Query: 693 YPALRAGYTYEIASSS------KGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFP 746
              L+    Y+ A +       K N  L  T SGF+E +  +   F     L G     P
Sbjct: 615 LKDLQ----YDAACADLRISFVKTNQGLDITASGFNEKLIVLLTRF-----LQGVVSFEP 665

Query: 747 SKDAL-----RKARILVRSKYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDM 801
            KD       +  R L    YE   S       S+     + E  W+  +++   E    
Sbjct: 666 KKDRFEILKDKTIRHLKNLLYEVPYSQMSNYYNSL-----INERSWSTAEKLQVFEKLTF 720

Query: 802 ESLKNFCSLFWKNPKQLALLIQGNLDY-----ADEINHYLNNNFTQHLKVCDEGNRPTIR 856
           E L +F    ++       L+ GN+ +      D +   L  N   +L+V +  NR  +R
Sbjct: 721 EQLNSFIPTIYEG-VFFETLVHGNIKHEEAIEVDSLIKSLIANNIDNLQVSN--NR--LR 775

Query: 857 LYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRD--NIENLTLTFLTEYIFSQ 914
            Y  P  K+    T+          DP N  +      Q D  + E   L+ L   +  +
Sbjct: 776 SYLLPKGKSFRYETDL--------KDPKNVNSCIQHVTQLDVYSEELSALSGLFAQLIHE 827

Query: 915 TLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKINEYLSYLEF-QVLN 973
                LR K+Q+GY+V S       T  I I + S  +   LE +IN +  Y  F Q L 
Sbjct: 828 PCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNF--YETFGQHLK 885

Query: 974 NFTESTF 980
           + T+  F
Sbjct: 886 DMTQEDF 892

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  130 bits (328), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 126/245 (51%), Gaps = 11/245 (4%)

Query: 4   REVSNY---EIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDP 60
           R++S+Y    + F  PL   +R ++  +LPN + A                       DP
Sbjct: 36  RKMSSYIDHGVKFTKPL-LDDRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDP 94

Query: 61  EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120
           ED+PGLAH CEH++   GS K+P+   + + ++K+ G  NA+T+   T ++F++     +
Sbjct: 95  EDLPGLAHFCEHLLFM-GSSKFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQVNQESLH 153

Query: 121 GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180
           G L        F+ FF  PLFN     KEI A+ SE++ N+ S     Y   +  +N +H
Sbjct: 154 GALL------RFSGFFSCPLFNKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEH 207

Query: 181 PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240
           PF  FSTGN+ +L  +P  + +++++ L  ++ +++    M LC+ G + ++ +++    
Sbjct: 208 PFHKFSTGNLKTLGDIPKSKDVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYD 267

Query: 241 KFGDI 245
            F D+
Sbjct: 268 LFKDV 272

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           H    L G E  GSL  YL  KGWA    A     +  N    ++++LT  G ++ ES+ 
Sbjct: 326 HYLSHLIGHEGSGSLLAYLKLKGWANELSAGSHTVSEDNAFFSVDIDLTDEGVKNYESVI 385

Query: 415 TTIF 418
            ++F
Sbjct: 386 QSVF 389

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 79/201 (39%), Gaps = 9/201 (4%)

Query: 781 VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840
           V+ E  WT+ ++++ ++    E LK F    ++      +L+ GN      +     +N 
Sbjct: 683 VINERAWTIANKLEVVKQLKFEHLKLFIPAIFEQ-FSFEILVHGNFSCEAALE---ADNL 738

Query: 841 TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPN-NSLAYFIQTAQRDNI 899
            + L   D  N    +L  S     + P    F       DD N NS    +      + 
Sbjct: 739 VRALAPRDVQN---FQLKSSKPRSVLLPQGKTFCYQQMLADDKNINSCIQHVTQFGSYSE 795

Query: 900 ENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETK 959
           E      L   +  +     LR K+Q+GY+V S       T+ + + + S      LE++
Sbjct: 796 ELSAKASLFAQLIDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRLLIQSERDTAYLESR 855

Query: 960 INEYLSYLEFQVLNNFTESTF 980
           I+ +L  +  QVL   ++  F
Sbjct: 856 IDAFLVKMG-QVLQEMSDEEF 875

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  130 bits (328), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 116/225 (51%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R+++  +LPN + A                       DPE++PGLAH CEH++   GS 
Sbjct: 44  DRSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEHLLFM-GSS 102

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           K+P+   + + ++K+ GS NA+T  + T +YF     Q N E  +   LD F+ FF  PL
Sbjct: 103 KFPNENEYSSYLSKHGGSSNAYTGAQNTNYYF-----QVNYEHLY-GALDRFSGFFTGPL 156

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           FN     KEI A+ SE++ N+ +     Y   + L N  HP+  FSTGN+ +L + P   
Sbjct: 157 FNKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKEL 216

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            +++++ L  ++  ++    M LC+ G + ++ +TK     F D+
Sbjct: 217 GLDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDV 261

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 142/644 (22%), Positives = 248/644 (38%), Gaps = 107/644 (16%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           H+   L G E  GSL  YL +KGWA    A     + GN    ++++LT  G    E + 
Sbjct: 315 HILSHLIGHEGTGSLLAYLKTKGWANELSAGGHTVSKGNAFFSVDIDLTDDGLAHYEEVV 374

Query: 415 TTIFS--KLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENL 472
             +F   K+L +   +N         E   I  A F ++     P    S L+  L+   
Sbjct: 375 HNVFQYIKMLQNCLPQN-----WVFHELQEIAQANFKFEQKGS-PSNTVSTLAKALE--- 425

Query: 473 ECLTPCNIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILL 532
                       K  I +N     +  +N L  ++      ++   LK     EN+RI L
Sbjct: 426 ------------KEYIPVN-----RILSNGLLTKYEPELVAQYCRDLKP----ENSRITL 464

Query: 533 LG-DIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFL 591
           +G D+K+               E +Y  EY        E  KY             +P L
Sbjct: 465 IGKDLKTSK------------REKWYGTEY--------EVEKY-------------SPDL 491

Query: 592 PDFVNDPLKLQQLYLECS---LKSKFATLRPQIQSE----PIEILPQLVSKNLNYEMWVL 644
              ++ PL    L+L      + + F   +P+  S     P+E  P L+S+N   ++W  
Sbjct: 492 LAKISTPLLNSHLHLPHPNEFIANNFKVDKPEGSSADEIVPLE-EPLLISENETGKVWFK 550

Query: 645 KEDPNFTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALR--AGYTY 702
           K+D  +       ++F++      P   A+  L  +   L++   ++    L+  A    
Sbjct: 551 KDDRFWQPRGYIYLTFKL------PHTHASA-LNSMLSTLYVQLINDSLKDLQYNANCAN 603

Query: 703 EIASSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTD-PTFPS-KDALRKARILVRS 760
             AS  K N  L  T+ GF++ +  +    ++ +K    + P F   KD  +  + L   
Sbjct: 604 LRASFVKTNQGLDLTLYGFNDKLIILLTRLLEGIKSFKLEQPQFKIFKD--KSVQHLKNL 661

Query: 761 KYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLAL 820
            YE   S       S     ++ E  W++++++D +E    E L NF    ++       
Sbjct: 662 MYEVPYSQ-----ISTVYNYLINERSWSVEEKLDVMEKITYEELINFIPTIFEE-LYFEA 715

Query: 821 LIQGNLDYADEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQ 880
           LI GNL Y + +           +K+    +   ++   S     + P    +      +
Sbjct: 716 LIHGNLKYEEAM------EIASLVKILQPSDVTRLQTKNSRMRSYLIPRGETYRYETKLK 769

Query: 881 D--DPNNSLAYFIQTAQRDNIENLTL-TFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRIL 937
           D  + N+ + Y  Q    D  E L+  + L   +  +     LR K+Q+GY+V S     
Sbjct: 770 DAKNVNSCIQYVTQLDVYD--EKLSAKSGLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNN 827

Query: 938 TDTIGIHITVMSGSSAHSLETKINEYLSYLEF-QVLNNFTESTF 980
             T  + I + S  +   LE +I+ +  Y +F ++LN  +E  F
Sbjct: 828 HGTANMRILIQSEHTTPYLEFRIDTF--YQKFGELLNAMSEEDF 869

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  130 bits (328), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 122/239 (51%), Gaps = 10/239 (4%)

Query: 8   NYEIPFYIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLA 67
           N++I F  P    +R ++  +LPN + A                       DPE+IPGLA
Sbjct: 47  NHKISFKKP-DLDDRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGLA 105

Query: 68  HLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFES 127
           H CEH++   GS K+PD   + + ++K+ G+ NA+T  + T +YF++ +    G      
Sbjct: 106 HFCEHLLFM-GSSKFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQVNHEDLRG------ 158

Query: 128 TLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFST 187
            LD F+ FF  PLFN     KEI A+ SE++ N+ +     Y   +   +  HP+  FST
Sbjct: 159 ALDRFSGFFTSPLFNKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHPYHKFST 218

Query: 188 GNIHSLSSVPHLEKINVKNSLNTYFKNNFYGEN-MTLCMRGSQSVNILTKLAISKFGDI 245
           GN+ +L   P  + +++++ L  ++ N FY  N M LC+ G + ++ +++     F D+
Sbjct: 219 GNLKTLGETPKNQGLDIRDELLKFY-NKFYSANIMKLCVLGREDLDTMSEWVYELFKDV 276

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 11/108 (10%)

Query: 316 PSKYNSIFINSSKAPI-----VRFLFPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLS 370
           P++Y +  I +   P+     V   F V D +  +  +     SHL     G E  GSL 
Sbjct: 292 PAEYKTKIIRAK--PVKDLKKVEITFAVPDVDVHWESKPHHYLSHL----IGHEGSGSLL 345

Query: 371 HYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIF 418
            YL  +GWA    A     ++ N    +++ELT  G    + + +++F
Sbjct: 346 AYLKGQGWANELSAGAHTVSVNNAFFSVDIELTNNGLDHYQDVVSSVF 393

 Score = 35.4 bits (80), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 82/199 (41%), Gaps = 36/199 (18%)

Query: 781 VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQL--ALLIQGNL--DYADEINHYL 836
           ++ E  W+ ++++D  +    E LKNF    ++   QL   +L+ GN   + A EIN  +
Sbjct: 687 LINERSWSTKEKLDLTKQLTFEHLKNFIPTIYE---QLYYEILVHGNFSQEAATEINDLV 743

Query: 837 NN---NFTQHLKVCDEGNRP-------TIRL-YPSPNTKNIDPGTNAFISCNGHQDDPNN 885
                N  ++L+V +   R        T R+  P  + KN++           + +D + 
Sbjct: 744 KMMVPNDIKNLQVKNGKLRSYIIPQEKTFRMELPLADEKNVNSCIQHVTQFGIYSEDLSA 803

Query: 886 SLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHI 945
             A   Q                  +  +     LR K+Q+GY+V S       T+ + +
Sbjct: 804 KTALLAQ------------------LIDEPCFDTLRTKEQLGYVVFSSALSTHGTVNLRL 845

Query: 946 TVMSGSSAHSLETKINEYL 964
            + S   +  LE++I+ +L
Sbjct: 846 LIQSERDSSYLESRIDSFL 864

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  130 bits (328), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 117/225 (52%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R ++  +LPN +                         DPED+PGLAH CEH++   GSK
Sbjct: 66  DRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHLLFM-GSK 124

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           K+P+   + + ++K+ G+ NA+T  + T +YF +     N E  +++ LD F+ FF  PL
Sbjct: 125 KFPNENEYASFLSKHGGASNAYTASQNTNYYFHV-----NHENLYDA-LDRFSGFFSCPL 178

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           FN     KEI A+ SE++ N+ +     Y   + L N  HP+  FSTGN  +L S+P  +
Sbjct: 179 FNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSK 238

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            +NV++ L  ++  ++    M L + G + ++ L + A   F D+
Sbjct: 239 GVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDV 283

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 110/262 (41%), Gaps = 23/262 (8%)

Query: 706 SSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESA 765
           S  K N  L  ++SG+++ +  +   F + ++          K  LR+ R +V  +    
Sbjct: 625 SLRKTNQGLDLSLSGYNDKLLVLLARFFEGIQ----------KLFLREERFMVLKQRLIQ 674

Query: 766 SSDNGV---KLASIGLLI--VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLAL 820
              N +       IG L   ++ E  WT Q+++D  E    + L NF    ++      L
Sbjct: 675 KLHNHLYDTPYTQIGRLYSSLINERSWTTQEKLDITEQLTFDHLANFVPTIYEQ-MYFEL 733

Query: 821 LIQGNLDYADEINHY-LNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGH 879
           L+ GN  + + +  Y L ++   +     EG    +R Y  P       G   + +    
Sbjct: 734 LVHGNFSHEEALEVYDLVSSLVPNEIRNSEGRNSKLRSYFIPAG-----GAYHYETALAD 788

Query: 880 QDDPNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTD 939
           +++ N+ +   IQ      + +   + L + + ++     LR ++Q+GY+V S       
Sbjct: 789 KENVNSCIQKVIQLGAYSELLSAKGSLLAQMV-NEPCFNTLRTEEQLGYVVFSSKLNTHG 847

Query: 940 TIGIHITVMSGSSAHSLETKIN 961
           T+ + I V S  S+  LE++I+
Sbjct: 848 TVNLRILVQSERSSSYLESRID 869

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  130 bits (327), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 119/229 (51%), Gaps = 7/229 (3%)

Query: 14  YIPLSYGNRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHM 73
           +I     +R+++  +LPN   A                       DP+++ GLAH CEH+
Sbjct: 65  FIKPDLDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHFCEHL 124

Query: 74  ILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFA 133
           +   GSKK+P+   + + + K+ GS NA+T  + T ++FE+ +   +G       LD F+
Sbjct: 125 LFM-GSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEINHEHLHG------ALDRFS 177

Query: 134 SFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSL 193
            FF  PLFNP    KEI A+ SE++ N+ +     Y   + L+N  HP+  FSTGN+ +L
Sbjct: 178 GFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGNLKTL 237

Query: 194 SSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKF 242
             +P  E ++++N L  ++ +++    M LC+ G + ++ ++    + F
Sbjct: 238 DEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYNLF 286

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 131/623 (21%), Positives = 243/623 (39%), Gaps = 103/623 (16%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           H+   L G E  GS+  +L +  WA    A     +  N    ++++LT+ G++  + I 
Sbjct: 343 HILSHLIGHEGSGSILSHLKTLSWANELSAGGHTVSKDNAFFSIDIDLTENGFQHYKEIV 402

Query: 415 TTIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQEN--- 471
             +F  +       ++     FL  Q++ + A F ++   + P    S+LS  L++    
Sbjct: 403 HIVFQYI--EMLKISLPQERIFLELQDIAN-ASFKFKQKVN-PSSTVSNLSKALEKEYIP 458

Query: 472 LECLTPCNIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRIL 531
           +E +    +F+ +       DP I K                   N++ S ++ +N+RI 
Sbjct: 459 VENILSTGLFRKY-------DPEIMK-------------------NYVNS-LSPDNSRIT 491

Query: 532 LLGDIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFL 591
           L G          +E +S+         E + G  +  ED+      P +     K+P L
Sbjct: 492 LAGK--------AVETDSK---------ETWYGTDYRVEDY------PKDLYDTIKSPGL 528

Query: 592 PDFVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFT 651
              ++ P   + +     ++ KF    P +  EP+ +    VSK     +W  K+D  + 
Sbjct: 529 NPNLSIPRPNEFIATNFDVE-KFDVNEPLV--EPLLLKDSPVSK-----LWYKKDDRFWQ 580

Query: 652 SDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNL----YPALRAGYTYEIASS 707
                 ++ ++      P  +A++   +L  +     + +L    Y A  A       S 
Sbjct: 581 PRGFIYITMKL------PHTQASVINNLLTSLYVQLVNDSLKDLQYDAACANLH---LSF 631

Query: 708 SKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALR--KARILVRSK---Y 762
           SK N  L  TISGF++ +  + + F+      G     PSK   +  K + +   K   Y
Sbjct: 632 SKTNQGLDITISGFNDKLIVLLQRFI-----YGVSVYQPSKLRFKIFKEKTIQNLKNCLY 686

Query: 763 ESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLI 822
           E   S      +S+     + E  W+++ ++  +E    E    F    ++       L+
Sbjct: 687 EVPYSQISTLYSSL-----INERTWSVKQKLSIIEKITYEQFLAFLPTIYEEC-YFDGLV 740

Query: 823 QGNL--DYADEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQ 880
            GN   + A EI+  + +  T  +      N   +R Y  PN +     T  F       
Sbjct: 741 HGNFRNEEAVEIDSLVQSLITTDIVNLHVKNT-RLRSYVIPNGE-----TYRFEIDLEDA 794

Query: 881 DDPNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDT 940
           ++ N+ + + +Q       E   ++ L   I ++     LR K+Q+GY+V S       T
Sbjct: 795 ENVNSCVQHVVQLGGYSE-ELSAMSGLFAQILNEPCFDTLRTKEQLGYVVFSSSLNNHGT 853

Query: 941 IGIHITVMSGSSAHSLETKINEY 963
             I I V S  S   LE +I+E+
Sbjct: 854 ANIRILVQSEHSTPYLEWRIDEF 876

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  130 bits (327), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 116/225 (51%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R+++  +LPN + A                       DPE++PGLAH CEH++   GS+
Sbjct: 90  DRSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLFM-GSE 148

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           K+PD   + + ++K+ G  NA+T    T ++FE+ +   +G       LD F+ FF  PL
Sbjct: 149 KFPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEVNHEHLHG------ALDRFSGFFTGPL 202

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
            N     KEI A+ SE++ N+ +     Y   + ++N +HP+  FSTGNI +L   P   
Sbjct: 203 MNADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKL 262

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            +N +N L  ++ +++    M LC+ G Q ++ L+  A   F D+
Sbjct: 263 GLNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDV 307

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 144/647 (22%), Positives = 256/647 (39%), Gaps = 117/647 (18%)

Query: 355 HLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIA 414
           H+   L G E  GS+  YL   GWA    A     +  N    + ++LT  G  + + IA
Sbjct: 361 HVLSHLIGHEGSGSILSYLKKLGWANDLSAGAHTVSKDNAFFGINVDLTDKGLENYQEIA 420

Query: 415 TTIFSKLLPSFCTKNIDHLIGFLREQ----NLIDIARFLYQ-NSEDLPMEECSHLSGILQ 469
             IF         + I+ L   L ++     L D+++  ++   +  P    S LS +L+
Sbjct: 421 LLIF---------QYIEMLKHSLPQEWIFSELQDVSKSSFKFKQKSSPSGTVSELSKLLE 471

Query: 470 ENLECLTPCNIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTR 529
           +  E + P  I     +L+   +P + K   + L V                    +N+R
Sbjct: 472 K--EYINPDLILST--TLLRKYEPEMIKQYVDSLTV--------------------DNSR 507

Query: 530 ILLLGDIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLS-EDHKYHSQSPYEFNFPTKN 588
           I L+           +E +S+   E +Y  EY +     S  D         EF  P +N
Sbjct: 508 ITLISKT--------VETDSK---EKWYGTEYQVVDYPKSFIDQLNQPGLNSEFKLPRRN 556

Query: 589 PFLPDFVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDP 648
            F+                    + F   +P  +  P++  P L+  N   ++W  K+D 
Sbjct: 557 EFVA-------------------TNFEVKKPTDELVPLD-EPHLILDNDISKVWYKKDDR 596

Query: 649 NFTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNL-----YPALRAGYTYE 703
            +       VS ++      PS ++ I +  L   L++   ++      Y A  A     
Sbjct: 597 FWQPRGYIYVSMKL------PSCQSGI-VNSLLNGLYVDQINDYMKDLQYDASCANLNLS 649

Query: 704 IASSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDAL-----RKARILV 758
            +S+++G   L  TISGF++ +  +   F++ +KL       PS++       +  + L 
Sbjct: 650 FSSTNQG---LDITISGFNDKLLVLLSRFIEGVKLYQ-----PSEERFNIFKNKAIQNLK 701

Query: 759 RSKYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQL 818
            S +E   S  G    +I     + E  W +++++D LE    +   +F    + N    
Sbjct: 702 NSLFEVPYSQMGTLYNTI-----MNESTWPIKEKLDVLEALTFDQFVSFVPSIY-NEFYF 755

Query: 819 ALLIQGNLDY--ADEINHYLNNNFTQHLKVCDEGNRPT-IRLYPSPNTKNIDPGTNAFIS 875
             L+ GN+ Y  A E N  L +      K+ +   R + +R Y  P  ++     +    
Sbjct: 756 DALVHGNIRYEEAMEANDLLKS--LASFKILNLHVRNSRLRSYILPEGESYRYEIDM--- 810

Query: 876 CNGHQDDPNNSLAYFIQTAQRDNIENLT-LTFLTEYIFSQTLVPDLRNKKQIGYIVLSGL 934
               +D+ N+ + + +Q       E L+ L+ L   +  +     LR K+Q+GY+V S  
Sbjct: 811 --EDKDNLNSCIQHVVQLGLY--TEELSALSGLFAQMIREPCFDTLRTKEQLGYVVFSSN 866

Query: 935 RILTDTIGIHITVMSGSSAHSLETKINEYLSYLEF-QVLNNFTESTF 980
                T  + I V S  S   LE +I+E+  Y +F + LNN +E  F
Sbjct: 867 LNNHGTANMRILVQSEHSTSYLEWRIDEF--YKKFGESLNNMSEEDF 911

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  117 bits (293), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 109/225 (48%), Gaps = 7/225 (3%)

Query: 21  NRTHKICKLPNGILAXXXXXXXXXXXXXXXXXXXXXHNDPEDIPGLAHLCEHMILAAGSK 80
           +R ++  +LPN +                         DPED+PGLAH CEH++   GS+
Sbjct: 77  DRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHLLFM-GSE 135

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPL 140
           K+P+   + + ++ + G+ NA+T+ + T +YF +    ++G L     LD F+ FF  PL
Sbjct: 136 KFPNENEYSSYLSHHGGASNAYTSTQNTNYYFMV----NHGNLY--DALDRFSGFFTSPL 189

Query: 141 FNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLE 200
           F+     KE+ A+ SE++ N+ S         R L N  HPF  FSTGN  +L   P   
Sbjct: 190 FSVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSR 249

Query: 201 KINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245
            I ++  L  ++   +    M L + G + ++ L+  A   F D+
Sbjct: 250 GIEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDV 294

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 147/669 (21%), Positives = 258/669 (38%), Gaps = 122/669 (18%)

Query: 332 VRFLFPVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAI 391
           V   F V D  T +        SHL     G ES  SL  YL+S+ WAT  +      + 
Sbjct: 329 VEVSFDVPDTETFWDSRPADYISHL----IGHESSNSLLSYLISQSWATELYCGAQTVSK 384

Query: 392 GNIGLVLELELTKTGWRSVESIATTIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQ 451
           GN    + +ELT  G +  E +  T+F  +      K++     F+ E N I  ++F ++
Sbjct: 385 GNAYFCIHIELTDKGVQDYEEVVYTVFQYI--EMLKKSLPQERIFV-ELNKIGESKFRFK 441

Query: 452 NSEDLPMEECSHLSGILQENLECLTPCNIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQ 511
                P    S L+  LQ++   L P  IF    SLI    P +                
Sbjct: 442 QKGS-PSNTVSSLAKNLQKDF--LPPEIIFNA--SLIRKFKPEL---------------- 480

Query: 512 AIKFQNFLKSFMNH---ENTRILLLGDIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHL 568
                  + SF++H   +N+RI L+    + NL           TE +Y  EY +     
Sbjct: 481 -------IMSFLSHLQPKNSRISLISRSVTTNL-----------TERWYGTEYAV----- 517

Query: 569 SEDHKYHSQSPYE-------FNFPTKNPFLPDFVNDPLKLQQLYLECSLKSKFATLRPQI 621
            ED+        E          PT N F+P   N  +  Q+              R   
Sbjct: 518 -EDYDKELLKKLEAPELNPSLQLPTPNMFIP--TNFDVNKQEDVKPLLEPLLLKEDR--- 571

Query: 622 QSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSFEVIG--LGIKPSPEATIHLEV 679
                           +  +W  K+D  +  +    VSF++      +  S  +T+++E+
Sbjct: 572 ----------------SCRLWYKKDDRFWVPEGHVYVSFKLPHSYSSVVNSMLSTLYVEM 615

Query: 680 LAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLI 739
           +   L       LY A  A +      +++G   L  +++G+++ +  +  + ++ ++  
Sbjct: 616 VKDSL----KDLLYNAECANFEVSFVKTNQG---LDLSLTGYNDKMTLLLTSILEGIR-- 666

Query: 740 GTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI--VLEEYMWTLQDRIDALE 797
             DP     D L+K  +L +  Y    +   V  + IG+L   ++ +  WT  +++   +
Sbjct: 667 NFDPKKERFDVLQK--LLCQKLYNRLYN---VPYSQIGVLYNSLINDRSWTPSEKLKVTK 721

Query: 798 LTDMESLKNFCSLFWKNPKQLALLIQGNL--DYADEINHYLNNNFTQHLKVCD-EGNRPT 854
               E  K F    ++       L+ GN   + A E+N Y+ +     +K      NRP 
Sbjct: 722 QLTFEHFKAFVPSIYEQ-MYFETLVHGNFPENQAIELNSYICSLIPNQIKHSGARNNRP- 779

Query: 855 IRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQ 914
            R Y  P  K     T  F      +++ N+     IQ        N   + L + I ++
Sbjct: 780 -RSYMLPEGKTYRYETTLF-----DEENVNSCFEMVIQLGMYSEDMNAKGSLLAQLI-NE 832

Query: 915 TLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKINEYLSYLEFQVLNN 974
                LR ++Q+GY+V S  +    +  + I V S S    +E++++++        LNN
Sbjct: 833 PCFNTLRTEEQLGYVVWSSKQNTHASTNLRILVQSESDTVYIESRVDKF--------LNN 884

Query: 975 FTESTFRTM 983
           F + T R+M
Sbjct: 885 FAD-TLRSM 892

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 107/194 (55%), Gaps = 9/194 (4%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ 118
           DP ++PGLAH CEH+ L  GSK +P+   + + + +N G  NA+T    T ++FE+    
Sbjct: 77  DPSNLPGLAHFCEHL-LFMGSKNFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFEI---- 131

Query: 119 SNGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANA 178
            N    FE+ L  F+ FFK PLFN     KEI+AI SE++ N+ +     Y   + L+N 
Sbjct: 132 -NHANLFEA-LRRFSCFFKTPLFNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNH 189

Query: 179 DHPFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGEN-MTLCMRGSQSVNILTKL 237
           +HP+  FSTG+  +L        +N++  L  ++ N +Y  N M LC+ G + +  L++ 
Sbjct: 190 EHPYHKFSTGSKLTLLENTETLNLNIREELIKFY-NKWYSSNIMNLCIIGREDLGTLSRW 248

Query: 238 AISKFGDISLKNDI 251
           A   F ++  KN I
Sbjct: 249 AKILFENVPNKNVI 262

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 133/630 (21%), Positives = 246/630 (39%), Gaps = 100/630 (15%)

Query: 354 SHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESI 413
           S++   LFG +  GS+S  L ++   T   +     +  N    L  +LT+ G    E I
Sbjct: 310 SYILSHLFGHKGNGSISSLLKNQQLITGISSGSENISKENSLFSLNFDLTEDGINQYEKI 369

Query: 414 ATTIFS--KLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQEN 471
              +F   K+L S   +          E   I    F Y+   + P    S LS  ++  
Sbjct: 370 IKIVFQYIKMLNSNLPQE-----WIYNELKGISDNSFKYKQKIN-PASTVSQLSKRME-- 421

Query: 472 LECLTPCNIFKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRIL 531
                        K+ I IN  NI  +E       ++     +   +LK F+  +N+RI+
Sbjct: 422 -------------KTFIPIN--NILSHE------LFYEYDPQQLNKYLK-FLTPDNSRIM 459

Query: 532 LLGDIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFL 591
           L+    S NL    + E    T++  + +Y  G +    + K +S    E   P KN F+
Sbjct: 460 LV----SKNLNGLHKSEKWYGTKYGVK-DYPDGLLKDLSNIKENS----ELYLPHKNEFI 510

Query: 592 PDFVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFT 651
                           CS+K        ++++   +I P L+  +   ++W  K+D  + 
Sbjct: 511 ST-------------TCSVK--------KVENHVAQIEPYLLKDDNISKLWYKKDDTFWL 549

Query: 652 SDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALR--AGYTYEIASSSK 709
                 VS ++      P   +++   VL    +I   ++    LR  A       S +K
Sbjct: 550 PRATIFVSIKL------PHTHSSLVANVLTS-FYINLVNDALQDLRCYAACADLYVSLNK 602

Query: 710 GNVTLRFTISGFSEGVFKITKAFVDTLK-LIGTDPTFPSKDALRKARI--LVRSKYESAS 766
            N  L  T++G ++ +  + K +++ +K  +  +  F   + ++K  I  L    Y+   
Sbjct: 603 TNQGLDLTLTGLNDKLLILLKRYLEGIKSFVPNEERF---EVIKKQTIQSLTNRLYDVPY 659

Query: 767 SDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNP--KQLALLIQG 824
              G   +S+     + E  W++++ +  ++  D   L++F    ++    + LA    G
Sbjct: 660 IQMGDIYSSL-----INERSWSVEENLKVVQDIDFPQLQDFIPTIYQELFFETLAF---G 711

Query: 825 NLDY--ADEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDD 882
           N+ Y  A E++  +       +K     N   +R Y  P+ K     T  +      +++
Sbjct: 712 NIQYEQAQEVDSLVRTLIPNTIKNSQVKN-DRLRSYIIPSGK-----TFKYEVFQKDKNN 765

Query: 883 PNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIG 942
            N  + Y  Q           ++ L + I  +     LR K+Q+GYIV S       T  
Sbjct: 766 LNTCIQYICQFGIYSEYLAAVVSLLAQ-IMHEPCFNTLRTKEQLGYIVFSSSLSNHGTCN 824

Query: 943 IHITVMSGSSAHSLETKI----NEYLSYLE 968
           + I V S  S   L+ +I     ++LSYL+
Sbjct: 825 LSIMVQSEYSTDYLQFRIENFLKDFLSYLK 854

>Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL098C
           - Hypothetical ORF [contig 184] FULL
          Length = 1040

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GSKKYP  GL  T       S NA+T  +QT +        S G L 
Sbjct: 57  GVPHTLEHLIFM-GSKKYPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TSAGWLG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F++ L V+      P  +      E+Y +  E
Sbjct: 111 FKNLLPVYLDHVLHPTISDHACTTEVYHVDPE 142

>CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098c
          Length = 1021

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 39/92 (42%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GSKKYP  GL  TL      S NA+T  +QT +        S G   
Sbjct: 57  GVPHTLEHLIFM-GSKKYPYKGLLDTLGNLCMSSTNAWTATDQTVYTL-----TSAGWQG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F+  L V+      P         E+Y I  +
Sbjct: 111 FKKLLPVYLDHLLNPTLTDEACVTEVYHIDPQ 142

>SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1069

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GS+K+P  GL  T       S NA+T  +QT +        S G L 
Sbjct: 86  GVPHTLEHLIFM-GSRKFPFKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TSAGWLG 139

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F+  L V+      P         E+Y +  E
Sbjct: 140 FKKLLPVYLDHVLNPTLTDEACCTEVYHVDPE 171

>AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL098C
          Length = 1029

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 36/87 (41%), Gaps = 6/87 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GS++YP  GL  T       + NA+T  + T +        S G L 
Sbjct: 57  GVPHTLEHLIFM-GSQRYPRKGLLDTAGGITMSTTNAYTASDHTAY-----ELVSAGWLG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIY 151
           F+  L V+      P         E+Y
Sbjct: 111 FKKLLPVYLDHLLHPTLTEHAFTTEVY 137

>SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {ON}
           highly similar to uniprot|P32898 Saccharomyces
           cerevisiae YDR430C CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 11/102 (10%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ 118
           +P +  G+ H+ EHM L  GS KYP    F  ++ ++  +     TG   TFY   P   
Sbjct: 75  NPPNATGVPHILEHMTLC-GSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFAT 130

Query: 119 SNGELAFESTLDVFASFFKEPLFNPLLIGKEIY--AIQSEHE 158
           +N +  FE+  DV+     +  FNPLL  ++ Y    + EHE
Sbjct: 131 TN-KADFENLRDVYL----DATFNPLLKPEDFYQEGWRLEHE 167

>KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1042

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GSKK+P  GL  T       S NA+T  +QT +        S G   
Sbjct: 57  GVPHTLEHLIFM-GSKKFPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TSAGWQG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F+  L V+      P         E+Y +  E
Sbjct: 111 FKKLLPVYLDHVLHPTITDDACTTEVYHVDPE 142

>Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} similar
           to Ashbya gossypii AFR334W
          Length = 1032

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 52/130 (40%), Gaps = 9/130 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G  H  EH+I   GSKKYP  GL          + NA+T  +QT +     +  S G + 
Sbjct: 57  GAPHTLEHLIFM-GSKKYPWKGLLDISGGITMSNTNAWTATDQTVY-----SLTSAGWVG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE---HEGNMSSTTKIFYHAARMLANADHP 181
           F+  L V+      P         E+Y I  +    +G + S  +    AA  + N +  
Sbjct: 111 FKKLLLVYLDHIVNPRLTDEACTTEVYYIDPKDLVDKGVVYSEMEGIESAAYSITNLEVQ 170

Query: 182 FSHFSTGNIH 191
              F  GN +
Sbjct: 171 RLMFPEGNAY 180

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 44/89 (49%), Gaps = 13/89 (14%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYP--DPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPN 116
           +P D  G+AH+ EH  L  GSKKYP  DP  F  L    +   NA T  + T + F   N
Sbjct: 76  NPPDSTGVAHILEHTTL-CGSKKYPVRDP-FFKMLNRSLSNFMNAMTGHDYTMYPFATTN 133

Query: 117 TQSNGELAFESTLDVFASFFKEPLFNPLL 145
           ++      F++  DV+     +  F+PLL
Sbjct: 134 SKD-----FKNLQDVYL----DATFSPLL 153

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 70/180 (38%), Gaps = 17/180 (9%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQSNGEL 123
           G AH  EH+     SK+         L  +N GS  NA+T+ E T +Y +    + N  L
Sbjct: 68  GTAHFLEHLAFKGTSKRSQKQ---IELDIENIGSHLNAYTSRENTVYYAK--TLKENLPL 122

Query: 124 AFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFS 183
           A    +D+ +            I +E   I  E E       ++ +     +A  D P  
Sbjct: 123 A----VDILSDILTNSKLEKNAIERERDVIVRESEEVDKMYDEVVFDHLHEIAYKDQPLG 178

Query: 184 HFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFG 243
               G I ++ S+        ++ L  Y  +N+ G+ M L   G  +   L KLA   FG
Sbjct: 179 RTILGPIKNIKSIN-------RSDLVHYITSNYKGDRMVLAGAGDINHQDLIKLAEKYFG 231

>TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3.93
           YOL098C
          Length = 1038

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GS KYP  GL  T+      S NA+T  +QT +        S G   
Sbjct: 57  GVPHTLEHLIFM-GSPKYPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TSAGWTG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F+  L ++      P         E+Y I  +
Sbjct: 111 FKKLLPMYLEHIINPTLTDDAYVTEVYHIDPD 142

>YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}
           Putative metalloprotease
          Length = 1037

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 38/96 (39%), Gaps = 6/96 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G  H  EH+I   GSK YP  GL  T    +  + NA+T  +QT +        S G   
Sbjct: 57  GAPHTLEHLIFM-GSKSYPYKGLLDTAGNLSLSNTNAWTDTDQTVYTL-----SSAGWKG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGN 160
           F   L  +      P         E+Y I  E+ G+
Sbjct: 111 FSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLGD 146

>NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 13/117 (11%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P +  G+ H+ EH  L  GSKKYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPNSTGVPHVLEHTTLC-GSKKYPVRDPFFKMLNKSLANFMNAMTGHDYTFFPFATTNA 133

Query: 118 QSNGELAFESTLDVFASFFKEPLFNPLLIGKEIY--AIQSEHEGNMSSTTKIFYHAA 172
           +      F +  DV+     +   NPLL  ++ Y    + EH+     TT I +   
Sbjct: 134 KD-----FNNLRDVYL----DATLNPLLKQEDFYQEGWRLEHDTVTDVTTPIVFKGV 181

>ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} similar
           to uniprot|Q12496 Saccharomyces cerevisiae YOL098C
           Hypothetical ORF
          Length = 1028

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 6/93 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G  H  EH++   GS+KYP  GL  T       S NA+T  +QT +        + G   
Sbjct: 57  GAPHTLEHLVFM-GSQKYPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TTAGWQG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSEH 157
           F+  L V+      P         E++ I  +H
Sbjct: 111 FKKLLPVYLDHILNPTLTDESCLTEVHHIDPDH 143

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYP--DPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPN 116
           +P D  G+ H+ EH  L  GS+KYP  DP  F  L    +   NA T  + T F F   N
Sbjct: 75  NPPDCTGVPHILEHTTL-CGSQKYPVRDP-FFKMLNRSLSNFMNAMTAHDYTFFPFSTTN 132

Query: 117 TQSNGELAFESTLDVFASFFKEPLFNPLL 145
                E  F++  DV+     +   NPLL
Sbjct: 133 -----ETDFKNLRDVYI----DATLNPLL 152

>NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]
           {ON} Anc_3.93
          Length = 1032

 Score = 35.8 bits (81), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GSK++P  GL  T+      S NA+T  +QT +        S G   
Sbjct: 57  GVPHTLEHLIFM-GSKQHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TSAGWKG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F   L  + +    P         E+Y +  E
Sbjct: 111 FSKILPAYLNHILFPTLTDDACTTEVYHVDPE 142

>Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430C
           (CYM1) - Hypothetical ORF [contig 193] FULL
          Length = 987

 Score = 35.4 bits (80), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 9/87 (10%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ 118
           +P D  G+ H+ EH  L  GS+KYP    F  ++ ++  +     TG   TFY   P   
Sbjct: 75  NPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFAT 130

Query: 119 SNGELAFESTLDVFASFFKEPLFNPLL 145
           +N +  F +  DV+     +  FNPLL
Sbjct: 131 AN-KADFANLRDVYI----DATFNPLL 152

>Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 42/112 (37%), Gaps = 12/112 (10%)

Query: 60  PEDIP---GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPN 116
           P + P   G  H  EH+I   GSK YP  GL  T    +    NA+T  +QT +      
Sbjct: 49  PTECPNDSGAPHTLEHLIFM-GSKSYPYKGLLDTAGNLSMSITNAWTDTDQTVYTL---- 103

Query: 117 TQSNGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIF 168
             S G   F   L  +      P         E+Y I  E   N+S    +F
Sbjct: 104 -ASAGWKGFSKLLPTYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVVF 151

>TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1032

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 37/92 (40%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G  H  EH+I   GSK YP  GL  T       S NA+T  +QT +        + G   
Sbjct: 57  GCPHTLEHLIFM-GSKSYPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TTAGWKG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F++ L V+      P         E++ I  E
Sbjct: 111 FKTLLPVYLDHLLFPTLTDEACITEVHHIDPE 142

>SAKL0H14718g Chr8 complement(1277222..1279948) [2727 bp, 908 aa] {ON}
            similar to uniprot|P27801 Saccharomyces cerevisiae
            YLR148W PEP3 Vacuolar peripheral membrane protein that
            promotes vesicular docking/fusion reactions in
            conjunction with SNARE proteins required for vacuolar
            biogenesis forms complex with Pep5p that mediates protein
            transport to the vacuole
          Length = 908

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 65/131 (49%), Gaps = 23/131 (17%)

Query: 1051 NEMVDILFLQKLTLKKYLEFFGSRISIYSR-----------------QRSKLSIMITSPM 1093
            N + DI F+ +L+LK   + FG  I +YS+                 + +KL +  T  +
Sbjct: 646  NNIFDIDFILRLSLK--FKKFGCAIYLYSQLKLYEDAVSLALEKGMLESAKL-VASTPEL 702

Query: 1094 AEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKNLFTFFRKRSEAFK 1153
            AE+    RK++L++  FL  +G  IK + ++ I++DS    VL +K+L   F + +    
Sbjct: 703  AEDYNLGRKLWLRIARFLISQGNDIK-QTIKTIIQDS--GEVLTIKDLLPLFNEFTTIAN 759

Query: 1154 LGTVVLKEISK 1164
            L   ++K + K
Sbjct: 760  LKEELVKSLEK 770

>Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 42/112 (37%), Gaps = 12/112 (10%)

Query: 60  PEDIP---GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPN 116
           P + P   G  H  EH++   GSK YP  GL  T    +    NA+T  +QT +      
Sbjct: 49  PTECPNDSGAPHTLEHLVFM-GSKSYPYKGLLDTAGNLSLSVTNAWTDTDQTVYTL---- 103

Query: 117 TQSNGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIF 168
             S G   F   L  +      P         E+Y I  E   N+S    +F
Sbjct: 104 -SSAGWKGFSKLLPAYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVVF 151

>NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1034

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GSK++P  GL  T+      S NA+T  +QT +        S G   
Sbjct: 57  GVPHTLEHLIFM-GSKEHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TSAGWKG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F   L  + +    P         E+Y +  E
Sbjct: 111 FSKLLPSYLNHILFPTLTDEACTTEVYHVDPE 142

>ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]
           {ON} highly similar to uniprot|P32898 YDR430C
           Saccharomyces cerevisiae CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 11/116 (9%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ 118
           +P +  G+ H+ EH  L  GS KYP    F  ++ ++  +     TG   TFY   P + 
Sbjct: 75  NPPNATGVPHILEHTTLC-GSVKYPVRDPFFKMLNRSLSNFMNAMTGPDYTFY---PFST 130

Query: 119 SNGELAFESTLDVFASFFKEPLFNPLLIGKEIY--AIQSEHEGNMSSTTKIFYHAA 172
           +N    F +  DV+     +  FNPLL  ++ Y    + EH     S + I +   
Sbjct: 131 TN-RADFANLRDVYV----DATFNPLLTPEDFYQEGWRLEHSDVKDSKSDIVFKGV 181

>KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1037

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G+ H  EH+I   GS+KYP  GL  T       + NA+T  +QT +        + G   
Sbjct: 57  GVPHTLEHLIFM-GSEKYPYKGLLDTAGNLCMSNTNAWTATDQTVYTL-----STAGWKG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156
           F+  L V+      P         E+Y I  +
Sbjct: 111 FKKLLPVYLDHLFFPTLTEDACTTEVYHIDPD 142

>KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 982

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ 118
           +P D  G+ H+ EH  L  GS KYP    F  ++ ++  +     TG   TFY   P   
Sbjct: 75  NPPDSTGVPHILEHTTL-CGSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFAT 130

Query: 119 SNGELAFESTLDVFASFFKEPLFN 142
           +N E  F +  DV+      PL N
Sbjct: 131 TN-ETDFANLRDVYLDATLNPLLN 153

>KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.541
           YDR430C
          Length = 994

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 60  PEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQS 119
           P D  G+ H+ EH  L  GS KYP    F  ++ K+  +     TG   TF+   P   +
Sbjct: 88  PPDSTGVPHILEHTTL-CGSVKYPVHDPFFKMLNKSLANFMNAMTGPHYTFF---PFATT 143

Query: 120 NGELAFESTLDVFASFFKEPLFNPLL 145
           NG   F +  DV+     + + NPLL
Sbjct: 144 NGR-DFANLRDVYL----DSILNPLL 164

>ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR430C (CYM1)
          Length = 990

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 11/128 (8%)

Query: 60  PEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNTQ 118
           P D  G+ H+ EH  L  GS+KYP    F  ++ ++  +  NA T  + T + F   N +
Sbjct: 76  PPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTAHDHTFYPFATTNQK 134

Query: 119 SNGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSST---TKIFYHAAR-M 174
                 F +  D++      PL       +E + ++    G+ SS      + Y+  +  
Sbjct: 135 D-----FANLRDLYLDATLRPLLRHADFLQEGWRLEHRDVGDASSELVFKGVVYNEMKGQ 189

Query: 175 LANADHPF 182
           ++NAD+ F
Sbjct: 190 VSNADYYF 197

>TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 69/183 (37%), Gaps = 19/183 (10%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G  H  EH+I   GS+++P  GL  T       S NA+T  +QT +        S G   
Sbjct: 57  GAPHTLEHLIFM-GSQQHPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TSAGWQG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHA---------ARML 175
           F+  L  +      P         E+Y +  +   ++S    +F              ML
Sbjct: 111 FKQLLPAYLDHILNPTLTDAACLTEVYHVDPD---DLSDKGVVFSEMDAIESQSWFVTML 167

Query: 176 ANADHPFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILT 235
                 F   S     +    P+L +I+  + +  + K+ +  +N+ L + G+   + L 
Sbjct: 168 EKQRLMFPEGSGYRSETGGLTPNLRQIS-NDEIRKFHKDAYSPDNLCLIVSGNVPEDELL 226

Query: 236 KLA 238
           K+ 
Sbjct: 227 KIV 229

>CAGL0F07183g Chr6 (702000..703244) [1245 bp, 414 aa] {OFF} highly
           similar to uniprot|P27697 Saccharomyces cerevisiae
           YGL119w ABC1 ubiquinol--cytochrome-c reductase complex
           assembly protein
          Length = 414

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 180 HPFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGEN-MTLCM 225
           H +  F+T N+ ++S +   E +N+KN  N+    NF  EN M LC+
Sbjct: 201 HVYEEFTTENVLTMSRMEGTEIMNLKNESNSQEIRNFISENIMRLCL 247

>Cgla_YGOB_ABC1 Chr6 (701085..701366,701877..703244) [1650 bp, 549
           aa] {ON} ANNOTATED BY YGOB -
          Length = 549

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 180 HPFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGEN-MTLCM 225
           H +  F+T N+ ++S +   E +N+KN  N+    NF  EN M LC+
Sbjct: 336 HVYEEFTTENVLTMSRMEGTEIMNLKNESNSQEIRNFISENIMRLCL 382

>NCAS0B00160 Chr2 (11885..11890,11989..12651) [669 bp, 222 aa] {ON}
           Anc_8.869
          Length = 222

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 583 NFPTKN--PFLPDFVNDPLKLQQLYLECSLKSKFATLRPQ 620
           NF  KN  P  P F++D  KLQQ   E  L+ KF  L+P+
Sbjct: 164 NFENKNLIPLNPTFLDDEYKLQQRINELDLQHKFHNLKPK 203

>KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 990

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ 118
           +P D  G+ H+ EH  L  GS+KYP    F  ++ ++  +     TG   TFY   P   
Sbjct: 75  NPPDASGVPHILEHTTL-CGSEKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFAT 130

Query: 119 SNGELAFESTLDVFASFFKEPLFNPLL 145
           +N +  F +  DV+     +  F PLL
Sbjct: 131 AN-KADFANLRDVYL----DATFKPLL 152

>CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 Saccharomyces cerevisiae
           YDR430c
          Length = 990

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 11/128 (8%)

Query: 60  PEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNTQ 118
           P D  G+ H+ EH  L  GS+KYP    F  ++ K+  +  NA T  + T F F   N +
Sbjct: 76  PPDATGVPHILEHTTL-CGSEKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFATTNAR 134

Query: 119 SNGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTT----KIFYHAARM 174
                 F +  DV+ +    PL       +E + ++     N  S       +F      
Sbjct: 135 D-----FVNLRDVYLNSTLRPLLKEQDFYQEGWRLEHSEVTNPKSDIIFKGVVFNEMKGQ 189

Query: 175 LANADHPF 182
           ++NAD+ F
Sbjct: 190 VSNADYHF 197

>Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON}
            YBL047C (REAL)
          Length = 1377

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 36/57 (63%), Gaps = 7/57 (12%)

Query: 1036 IRNSISEKRLHFQEENEMVDI----LFLQKLT---LKKYLEFFGSRISIYSRQRSKL 1085
            +++ ++EK+ H ++E  MVD+    L L ++T   L+K +E  G +I++Y  ++ +L
Sbjct: 724  LQSQLNEKQQHVKQERSMVDVNSKQLELSQITVVNLQKEIEGLGEKITVYLTKQKEL 780

>Suva_15.67 Chr15 complement(105988..109104) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 39/104 (37%), Gaps = 9/104 (8%)

Query: 65  GLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELA 124
           G  H  EH+I   GS  +P  GL  T    +    NA+T  +QT +        S G   
Sbjct: 57  GAPHTLEHLIFM-GSNSHPYKGLLDTAGNLSMSVTNAWTDTDQTVYTL-----ASAGWKG 110

Query: 125 FESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIF 168
           F   L V+      P         E+Y +  E   N+S    +F
Sbjct: 111 FSKLLPVYLDHILNPTLTDEACLTEVYHVDPE---NLSDKGVVF 151

>Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P D  G+ H+ EH  L  GS KYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QSNGELA---FESTLD 130
           Q    L     +STL+
Sbjct: 134 QDFANLRGVYLDSTLN 149

>Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P D  G+ H+ EH  L  GS KYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QSNGELA---FESTLD 130
           Q    L     +STL+
Sbjct: 134 QDFANLRGVYLDSTLN 149

>Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 32.3 bits (72), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 59  DPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P D  G+ H+ EH  L  GS KYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 Q 118
           Q
Sbjct: 134 Q 134

>KAFR0D00260 Chr4 (34896..36239) [1344 bp, 447 aa] {ON} Anc_1.25
           YCL048W
          Length = 447

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 10/112 (8%)

Query: 440 QNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNIFKGFKSLIEINDPNIEKYE 499
           +N+ID+      N  DL +E   H++ I   +L+ +T   +F    SLI I+ P IE   
Sbjct: 98  ENVIDLQDIERING-DLIIENNVHITRINANSLKFVTGNVLFNSLTSLITIDLPIIEDCN 156

Query: 500 NNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHNL--FDKIEDES 549
               ++ W     +   NF    M H+N   +++ D    N+  FDKI++ S
Sbjct: 157 ----SIDWKVLPILNNANFNNKVMVHQN---IIISDTSISNIEGFDKIKEIS 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,750,887
Number of extensions: 5900530
Number of successful extensions: 17228
Number of sequences better than 10.0: 106
Number of HSP's gapped: 17478
Number of HSP's successfully gapped: 158
Length of query: 1218
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1097
Effective length of database: 39,606,813
Effective search space: 43448673861
Effective search space used: 43448673861
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)