Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.457.127ON47847823980.0
YPL259C (APM1)7.127ON47547822700.0
Smik_6.4667.127ON47647822450.0
Skud_16.197.127ON47647822310.0
NCAS0E021407.127ON48147818250.0
KNAG0L009507.127ON46148018160.0
KAFR0L004707.127ON46547718160.0
CAGL0K00539g7.127ON45647818140.0
TBLA0A009507.127ON46947718050.0
NDAI0E036807.127ON44447717810.0
ZYRO0C05236g7.127ON44747717680.0
TDEL0H028907.127ON44247717610.0
Kpol_1062.567.127ON45047617590.0
SAKL0F05346g7.127ON44747717550.0
Ecym_83507.127ON44547717080.0
Kwal_55.208437.127ON44147617040.0
TPHA0C043207.127ON45447917020.0
KLTH0F12584g7.127ON44147616990.0
ADL017C7.127ON44347716940.0
KLLA0D14311g7.127ON44347716570.0
Ecym_52393.165ON4644925461e-63
KLLA0C03894g3.165ON4754994972e-56
KLTH0F06534g3.165ON4665024902e-55
SAKL0C07414g3.165ON4825164833e-54
Kwal_33.141823.165ON4675064692e-52
NCAS0C035803.165ON4915184694e-52
CAGL0C05203g3.165ON4755124674e-52
SAKL0D13090g2.555ON4995434582e-50
TDEL0D045803.165ON4825134431e-48
NDAI0G029203.165ON4864234389e-48
Kwal_26.81462.555ON5055544283e-46
ABR047W2.555ON4984894204e-45
ZYRO0B04840g3.165ON4765094185e-45
Kpol_1045.443.165ON4694184168e-45
ADR315W3.165ON4923804161e-44
KLTH0D07502g2.555ON5045524082e-43
YOL062C (APM4)3.165ON4913174063e-43
TBLA0F008403.165ON4815134045e-43
Suva_15.1033.165ON4913173976e-42
Smik_15.963.165ON4913173941e-41
TPHA0P006603.165ON4734303817e-40
KLLA0F25432g2.555ON5075523837e-40
Skud_15.913.165ON4913183792e-39
Ecym_45912.555ON5015093704e-38
KNAG0K011503.165ON4745103441e-34
TPHA0I023902.555ON5593833346e-33
TDEL0B064302.555ON5253533185e-31
ZYRO0E05874g2.555ON5493593186e-31
CAGL0K03223g2.555ON5983943172e-30
NCAS0A126502.555ON5883613082e-29
Smik_8.232.555ON6033662967e-28
Kpol_1056.132.555ON5413692922e-27
KAFR0A020602.555ON5403602903e-27
Skud_8.262.555ON5963652896e-27
YHL019C (APM2)2.555ON6053792809e-26
KNAG0C055502.555ON5823762781e-25
Suva_8.332.555ON5963862763e-25
KAFR0C010203.165ON4285032468e-22
TBLA0B067602.555ON6572582026e-16
NDAI0B016102.555ON6722651883e-14
TPHA0C041302.522ON5331661294e-07
KLLA0E18789g2.522ON4973331223e-06
KAFR0D035602.522ON4551831171e-05
TDEL0A029702.522ON4961641143e-05
AGL061W2.522ON4111571124e-05
TBLA0I006202.522ON6091701116e-05
KLTH0D06556g2.522ON4561631062e-04
SAKL0A09218g2.522ON4732621053e-04
Kpol_1018.422.522ON5751571036e-04
Kwal_26.79572.522ON4561531019e-04
NCAS0A048702.522ON489219990.002
Suva_4.5482.522ON484153950.004
ZYRO0B01738g2.522ON492161910.016
Skud_2.4192.522ON484152900.019
ZYRO0E09746g3.575ON538137900.020
KLLA0D11396g3.575ON536137900.020
CAGL0L02145g2.522ON54336890.029
Smik_2.4302.522ON484149870.049
YBR288C (APM3)2.522ON483161830.12
CAGL0A04741g3.575ON536203790.45
AFR274C3.575ON532122780.51
Ecym_72662.522ON517153780.56
KLTH0G00528g3.575ON633137780.60
KLTH0H11770g1.388ON15692740.69
Ecym_60073.575ON537122770.77
NCAS0F040103.575ON547194770.82
NDAI0K019302.522ON612159761.0
KNAG0A069702.522ON50545761.0
Kwal_47.192923.575ON538139751.2
TDEL0D064303.575ON536137741.6
Skud_6.1423.575ON546122732.2
KLLA0B06545g1.505ON14854702.3
SAKL0F00594g3.575ON545122732.3
TBLA0E001403.575ON543159732.4
SAKL0D08074g1.388ON156104702.5
YFR051C (RET2)3.575ON546122722.8
AGL161C8.352ON77062723.3
CAGL0B04983g1.388ON156115684.2
Smik_7.3713.575ON598122714.2
Kwal_14.26071.388ON15686684.8
YLR170C (APS1)1.388ON15690675.1
NDAI0B063203.575ON540114705.8
NDAI0G052101.388ON156102668.3
TBLA0C069905.21ON51138689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.45
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   928   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   879   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   869   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   863   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   707   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   704   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   704   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   703   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   699   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   690   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   685   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   682   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   682   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   680   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   662   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   660   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   660   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   659   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   657   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   642   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   214   1e-63
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   196   2e-56
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   193   2e-55
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   190   3e-54
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   185   2e-52
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   185   4e-52
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   184   4e-52
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   181   2e-50
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   175   1e-48
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   173   9e-48
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   169   3e-46
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   166   4e-45
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   165   5e-45
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   164   8e-45
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   164   1e-44
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   161   2e-43
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   160   3e-43
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   160   5e-43
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   157   6e-42
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   156   1e-41
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   151   7e-40
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   152   7e-40
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   150   2e-39
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   147   4e-38
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   137   1e-34
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   133   6e-33
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   127   5e-31
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   127   6e-31
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   126   2e-30
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   123   2e-29
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   118   7e-28
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   117   2e-27
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   116   3e-27
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   115   6e-27
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   112   9e-26
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   111   1e-25
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   110   3e-25
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...    99   8e-22
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    82   6e-16
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    77   3e-14
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    54   4e-07
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    52   3e-06
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    50   1e-05
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    49   3e-05
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    48   4e-05
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    47   6e-05
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    45   2e-04
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    45   3e-04
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    44   6e-04
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    44   9e-04
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    43   0.002
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    41   0.004
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    40   0.016
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    39   0.019
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    39   0.020
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    39   0.020
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.029
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    38   0.049
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    37   0.12 
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    35   0.45 
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    35   0.51 
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    35   0.56 
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    35   0.60 
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    33   0.69 
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    34   0.77 
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    34   0.82 
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    34   1.0  
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   1.0  
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    33   1.2  
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    33   1.6  
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    33   2.2  
KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly ...    32   2.3  
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    33   2.3  
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    33   2.4  
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    32   2.5  
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    32   2.8  
AGL161C Chr7 complement(394886..397198) [2313 bp, 770 aa] {ON} S...    32   3.3  
CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly ...    31   4.2  
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    32   4.2  
Kwal_14.2607 s14 complement(831030..831500) [471 bp, 156 aa] {ON...    31   4.8  
YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}  ...    30   5.1  
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    32   5.8  
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    30   8.3  
TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa] ...    31   9.6  

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/478 (94%), Positives = 453/478 (94%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLV             FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNATRPPVALTNSVSWRPEGISHKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
           ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478
           NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/478 (89%), Positives = 442/478 (92%), Gaps = 3/478 (0%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH+GKPLLSRRYRDDIPLSAIDKFP LLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+V             FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI+HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDD +N+P +
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIP-S 239

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
           AS TTSDN T+  TDKKPSITSSS  +K+KVNIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 240 ASATTSDNNTE--TDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPP 297

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD
Sbjct: 298 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 357

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTPTFKYSHGSLKYVPEKSAILWK+RSFPGGKEYSMSAELGLPSISN  DG++T+PK+
Sbjct: 358 DADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKS 417

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478
           NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 418 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/478 (90%), Positives = 440/478 (92%), Gaps = 2/478 (0%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH+GKPLLSRRYRDD+PLSAIDKF TLLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLV             FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI+HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLD+ SN+P A
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
            S  TSDN TD  TDKKPSITSSST SKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 VSAATSDNNTD--TDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 298

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD
Sbjct: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 358

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSIS   DGS+TIPK+
Sbjct: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKS 418

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478
           NA++LKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 419 NAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/478 (90%), Positives = 437/478 (91%), Gaps = 2/478 (0%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH+GKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLV             FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDD SN PP 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
            S  TSDN TD  TDKKPSITSSST SKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 TSAATSDNITD--TDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 298

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEI+IPVPD
Sbjct: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD 358

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISN  +G + IPK+
Sbjct: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKS 418

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478
           NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 419 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/478 (73%), Positives = 392/478 (82%), Gaps = 28/478 (5%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCD  G PLL+RRYRDDIP+SAI+KFPTLLSDLEE++NL+PPCL++NG++YLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+YLV             F FL+KLV+VL +YLKTVEEESIRDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNA RPP ALTNSVSWR   I +KKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DI+ESINMLMTQKGQ+LRSEIIG+VKV S+LSGMPDLKLGINDKGIFSK++DD S     
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
           AS                   +SST  K+K NIELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 272 AS------------------VASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LMNYRLST+IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KSTATNV+I+IPVP+
Sbjct: 314 DGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPE 373

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTP FKYSHGS+KYVPEK+ I+WK+RSFPGGKEYSMSA++ LPSI N       I ++
Sbjct: 374 DADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGN-------IEEH 426

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478
            A   K PVQIKFQIPYFTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 427 KA---KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/480 (71%), Positives = 392/480 (81%), Gaps = 23/480 (4%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCD  GKPLLSRRY+DD+PLSAIDKF TLL+DLE++S +IPPC+NHNG+EYLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+V             F FLHKL+ VL +YLKTVEEESIRDNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITE +MLK+YITQ            RNA RPP  L NSVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSS---NL 237
           DIVESINML+TQKGQVLRSEIIG VK+ S+LSGMPDLKLGIND+GIF+KYL+ ++   N+
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 238 PPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITF 297
           P      +   ++ +  D K          KRK NIELEDLKFHQCVRLSKFENEKIITF
Sbjct: 241 PDPQEHGSGVAESSITNDGK----------KRKTNIELEDLKFHQCVRLSKFENEKIITF 290

Query: 298 IPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIP 357
           IPPDG+FDLMNYRL+T+IKPLIWCDV++QVHS SRIEI C+AKAQIK+KS A NV+ILIP
Sbjct: 291 IPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIP 350

Query: 358 VPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTI 417
           VPDDADTP+FKYSHGS+KYVPE+SAILWK++SFPGGKEY+M AE+GLPS+ +  +     
Sbjct: 351 VPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE----- 405

Query: 418 PKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
           PK     +K PVQ+KF+IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 406 PK-----VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/477 (71%), Positives = 398/477 (83%), Gaps = 12/477 (2%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH GKPLLSR+YRDDIPLSAIDKF +LLSD EE+SNL+PPC++HNG++Y+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYL              F FLHK+++VL  YLKTVEEESIRDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YG+PQITETKMLK+YIT             RNA RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DI+ESINML+TQKGQVLRSEI+G+V+V S+LSGMPDLKLGIND+GIF+KYL + +N+  A
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYL-EGNNIGIA 239

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
            +    D++   DT+ + SI S  + +KRK NIELEDLKFHQCVRLSKFENEKII+FIPP
Sbjct: 240 KN---GDDEDADDTNNESSIVSEGS-NKRKTNIELEDLKFHQCVRLSKFENEKIISFIPP 295

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG+FDLMNYRLST+IKPLIWCDV++Q +   RIEIHCKAKAQIK+KS ATNVEILIPVP+
Sbjct: 296 DGEFDLMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPE 352

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DAD+P FKYSHG +KY+PEK+ +LWK+ SFPGGKEYSM+A++GLPSIS G D   T   N
Sbjct: 353 DADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSIS-GEDDLNTRVSN 411

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
            +   K PVQ+KF+IPYFTTSGIQVRYLK+NEPKLQYK+YPWVRYITQSGDDYTIR+
Sbjct: 412 QS---KKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/478 (71%), Positives = 386/478 (80%), Gaps = 22/478 (4%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASA+YFCD+ G+PLLSR+YRDDIP SAID+FP LLS+ EE++NLIPPC+ HNG+++LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLV             F+FLHK++EVLS+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITE KMLKQYITQ            RNA RPP +LTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DI+ESINMLMTQKGQVLRSEIIG+VKV SKLSGMPDLKLGINDKG+FSKYL+   N  P 
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
           A   +             S+  S    KR  N+ELEDLKFHQCVRLSKFENEK ITFIPP
Sbjct: 241 APDDS-------------SVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPP 287

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LM+YRLST IKPLIWCDVN++ HS SRIEI C+AKAQIK+KSTATNVEILIPVP+
Sbjct: 288 DGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPE 347

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTP FKYSHGS+KYVPEK+AILWK+R+FPG KEYSM+AE+GLPS + G +  K     
Sbjct: 348 DADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEK----- 402

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478
               LK PVQ+KFQIPYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 403 ----LKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/477 (72%), Positives = 393/477 (82%), Gaps = 10/477 (2%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S++ FCD  GK LLSR+YRDDIPL+AID F TLL  LEE+S+++PPCL HNG+ YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+V             FTFLHKLVEV+S+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNA RPP ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINMLMTQ+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+ +S+   +
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
               +++  +   +  +PS      +S++  N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LM+YRL+T IKPLIWCDVN+ VHS SR+EIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTP+F+YSHGS+K+VPEK+AILWK+RSF GGKEYSM+A+LGLPSI   +D  K  PK 
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSI---DDNEK--PK- 414

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
               LK PVQIKFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 415 ----LKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/477 (71%), Positives = 388/477 (81%), Gaps = 34/477 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASA+YFCD  G+PLLSR+YRDDIPL+AIDKF +LL+DLEE+S++IPPCL +N  +YLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QH+D+YLV             F FL+K+++VL DYLKTVEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +NA RPP ALT+SVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINMLMTQKGQ+LRSEI+G VK+ S+LSGMPDLKLGINDKGIFSK L         
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQL--------- 231

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
               T D+            T+++  SK++  IELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 232 ----TEDD------------TNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPP 275

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LMNYRLST+IKPLIWCD+NVQVHSNSRIEIHC+AKAQIK+KSTATNVEILIPVP+
Sbjct: 276 DGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPE 335

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTP FKYSHGS+K+VPEKSAILWK+RSFPGGKEYSM+AEL LPS S+ ++  +     
Sbjct: 336 DADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQN---- 391

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
                K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 392 -----KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/477 (69%), Positives = 379/477 (79%), Gaps = 32/477 (6%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M SAVYFCD  G+P+LSRRYRDDIP+SAIDKF  LL  LEE+S++IPPCL+H+G++YLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+V             F FLHKL+EVL +YLK+VEEES+RDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            + A RPP  +TNSVSWR   I HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINMLM Q+GQVLRSEIIG +KV SKLSGMPDLKLGINDKGIFSKY++  S+    
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---- 236

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
                              +T++ T  K+K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 237 ------------------PVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPP 278

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LMNYRLS  +KPLIWCDVNVQVHS SRIEIHC+A+AQIK++S A +VEILIPVPD
Sbjct: 279 DGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPD 338

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTP+FKY+HGS+K+VP+K+AILWK+RSF GGKEYSMSA++GLPSI N  D  K     
Sbjct: 339 DADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSI-NALDKPK----- 392

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
               +K PVQIKFQIPYFTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 393 ----VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/477 (69%), Positives = 379/477 (79%), Gaps = 36/477 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD  G+P+LSRRYRDDIPLSAID+F  LL+DLEE+S++IPPCLNH G++YLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           +H DLY+V             FTFLHKLVE L DYLKTVEEES+RDNFVIIYELLDE+MD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +   RPP  LTNSVSWR +GI++KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DIVESINM+M Q+GQVLRSEIIG V V S+LSGMPDLKLGINDKGIF++           
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR----------- 229

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
                     D +T +     S  TA K+K + ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 230 ----------DPETGE-----SQVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPP 274

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG+F+LM+YRL+T +KPLIWCDVNVQVHS SRIEIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 275 DGEFELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPD 334

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTP+F+YSHGS+K+VPEK+AILWK+RSF GGKEYSM+A++GLPSI NG +  K     
Sbjct: 335 DADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSI-NGVEKPK----- 388

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
                K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQ+GDDYTIRL
Sbjct: 389 ----FKRPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIRL 441

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/476 (71%), Positives = 383/476 (80%), Gaps = 26/476 (5%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S VYFCD  GKP+LSRRYRDDIPLSAIDKF  +L + EE+S+++PPCL + G+ YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QH+D+Y+V             F FLH+LV VL DYLK+VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNA RPPVALTNSVSWR EGI +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           DI+ESINMLM Q+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL++  +    
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
                 D                ST + +K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 VQIINDD----------------STTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 284

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG+F+LMNYRL+T IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 285 DGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPD 344

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DADTPTFKYSHGS+K++PEK+AILWKLRSF GGKEYSM+A+LGLPS+    DG +  PK 
Sbjct: 345 DADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSV----DGIEP-PK- 398

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
               +K PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 399 ----VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/477 (67%), Positives = 381/477 (79%), Gaps = 31/477 (6%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD  GK +LSRRY+DDIP +AIDKFP LL + E++S++IPPCL HNG++YLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY++             F FL+K+VEVL++Y+K VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +N  RPP+ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           D+VESINML+TQ+GQVLRSEI+G VKV S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV--------- 231

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
            S    D   D+           S   K+K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 232 -SGGVEDEADDL-----------SATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPP 279

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LM+YRL+T IKPLIWCD+ +QVHS SRIE+HC+AKAQIK+KSTA NVEILIPVP+
Sbjct: 280 DGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPE 339

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DAD+P F+YSHGS+K+ PEK+AILWK++SFPGGKEYSM+A+LGLPS+S+  +        
Sbjct: 340 DADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEE-------- 391

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
              ++K PVQ+KFQIPYFTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 392 --PVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/477 (66%), Positives = 378/477 (79%), Gaps = 32/477 (6%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S +YFCD  GK LLSRRY+DDIP+SAI++FP LL + E++SN+IPPC +HNG++YLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY++             F+FLH LV+VL +Y+K VEEESI+DNFVIIYELLDEVMD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
            GIPQIT+TKML+QYITQ            +N  RPP +LT +VSWRPEGI +KKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           D++ESINM+MTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIF------------- 227

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
              T S+ + + +   +PSIT      ++K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 228 ---TQSNEEEEDEPSSQPSIT------RKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 278

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LM+YRLST IKPLIWCD  +QVHS SR+E+HC+AKAQIK KSTA NVEILIPVP+
Sbjct: 279 DGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPN 338

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DAD+P F+YSHGS+K+VPEK+AILWK++SFPGGK+YSM+AE+GLPS+++  D +      
Sbjct: 339 DADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN------ 392

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
                K PVQIKFQIPYFTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 393 ----FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/476 (66%), Positives = 375/476 (78%), Gaps = 37/476 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI++FP LL + E++S+++PPCL HNGL+Y+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+Y++             F+FL+KLVEVL++YLKTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +N  RPP  LT SVSWRPEGI++KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           D+ ESINML+T  GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+   ++  N    
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTS--EEGGN---- 234

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
                                ++   S +K NIELEDL+FHQCVRLSKFENEKII+FIPP
Sbjct: 235 ---------------------NAEGGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPP 273

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG FDLMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+
Sbjct: 274 DGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE 333

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DAD+P F+YSHGSLKYVPEKSAILW++++F GGKEYS +A+LGLPS+++       +PK 
Sbjct: 334 DADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVE-----VPKA 388

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
                K P+Q+KFQIPYFTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 389 -----KRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/479 (67%), Positives = 383/479 (79%), Gaps = 29/479 (6%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD+ GKP+L+RRYRDDI ++AID F  LL  LEE++ +IPPC+ H G+ YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           +H+D+Y+V             F FLH+LVEVL +Y+K V EES+RDNFVIIYELLDE+MD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXX--XXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEA 178
           +GIPQITETKMLK+YITQ              +NA RPP  LTNSVSWRPEGI++KKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLP 238
           FLDI+ESINML+TQ+GQVLRSEI+G V+V S+LSGMPDLKLGIND+GIFS YL+++ N+ 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEEN-NVD 239

Query: 239 PAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFI 298
            ++S+T      +   DKKP              IELEDLKFHQCVRLSKFENEKIITFI
Sbjct: 240 GSSSSTPIPEGVE---DKKP-------------QIELEDLKFHQCVRLSKFENEKIITFI 283

Query: 299 PPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPV 358
           PPDG+FDLMNYRL+T IKPLIWCDVN+QVHS SRIEIHC+AKAQIK+KS A NVEILIPV
Sbjct: 284 PPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPV 343

Query: 359 PDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIP 418
           PDDADTP F+YSHGS+K++PEK+AILWKLRSF GGKEYSMSA+L LPS+    DG +  P
Sbjct: 344 PDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSV----DGVEP-P 398

Query: 419 KNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
           K     ++ PVQ+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 399 K-----VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/476 (66%), Positives = 373/476 (78%), Gaps = 37/476 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI+KFP+LL + E++S+++PPCL HNG++YLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+Y++             F+FL+KLVEVL++Y+KTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +N  RPP  LT SVSWRPEGI++KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           D+ ESINML+T  GQVLRSEI+G V V S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIF------------- 227

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
             T+     +   T+ K            K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 228 --TSVESASSSEATEGK------------KSNIELEDLKFHQCVRLSKFENEKIITFIPP 273

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+
Sbjct: 274 DGDFELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE 333

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DAD+P F+YSHGSLKYVPEKSAILWK+++F GGKEYS +A+LGLPS+++       +P+ 
Sbjct: 334 DADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAE-----VPRA 388

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
                K P+Q+KFQIPYFTTSGIQVRYLKINEPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 389 -----KRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/477 (65%), Positives = 376/477 (78%), Gaps = 34/477 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD  GK LLSRRY+DDIP +AI++FP LL + E++S+++PPC + NG++YLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY++             F++LHKL+EVL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
           +GIPQIT+TKML+QYITQ            +N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           D+VESINML+TQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++  DD       
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDE---- 236

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
                                 +S  +K+K NIELEDLKFHQCVRL+KFENEKIITFIPP
Sbjct: 237 --------------------EGASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPP 276

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG F+LM+YRLST IKPLIWCDV +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+
Sbjct: 277 DGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPE 336

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DAD+P F+YSHG++K+VP ++AILWK++SFPGGK+YSM+AE+GLPS+S+ +D        
Sbjct: 337 DADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHK------ 390

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
               LK PVQIKFQIPYFTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 391 ----LKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/477 (65%), Positives = 369/477 (77%), Gaps = 34/477 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS V FCD  GKPLLSRRY+DD+  SA++ F  LL + E++S+++PPC +HNG+ Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           Q+ND+Y++             F F++KL+ V+ +Y+K VEEESIRDN++IIYELLDE+MD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
            G+PQ+TETKMLKQYITQ            +N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           D++ESINMLMTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIF------------- 227

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
              TT+D     +   +P ++S     K+  NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 228 ---TTNDQ----EDSPEPVVSS----KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPP 276

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360
           DG+FDLM YRLST IKPLIWCDV VQVHS SRIEIHC+AKAQIK+KS A NVEILIP+P+
Sbjct: 277 DGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPE 336

Query: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420
           DAD+PTFKYS G++K+VPEK+AILWK  SF GGKEYSM+A+LGLPS+S+        PK 
Sbjct: 337 DADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEP-----PK- 390

Query: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477
               LK PVQIKFQIPYFTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 391 ----LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  214 bits (546), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 149/492 (30%), Positives = 241/492 (48%), Gaps = 45/492 (9%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++     G  ++S+  +D+I L   + F   ++++L+ +S    P L      +  
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           I+ N    +             + FL+   ++L  Y     E+S++ +F++ YE+LD V+
Sbjct: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQITETKMLKQYITQXXXXXXX-------------XXXXXRNATRPPVALTNS--V 164
           D GIP+ TE   +  YI++                         R  +   + LT+    
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175

Query: 165 SWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224
            WR EGI +KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234

Query: 225 GIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCV 284
                YL  SSN   + +   ++ +      K  +IT S         + LED KFHQCV
Sbjct: 235 -----YLSPSSNTQSSGNDGWAEEENGTKAIKN-AITGS---------VILEDCKFHQCV 279

Query: 285 RLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIK 344
           +L KF+ E++I F+PPDG F+LM Y +   +         V       +E     K+   
Sbjct: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFP 339

Query: 345 RKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGL 404
            K  A +VE+ IP P D        S G  K++PE++AI+WK+  + G  E   SA + +
Sbjct: 340 SKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-V 398

Query: 405 PSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVR 464
           P + NGND       N  +  + P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+
Sbjct: 399 P-MGNGNDS-----LNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVK 452

Query: 465 YITQSGDDYTIR 476
           YI++SG  Y +R
Sbjct: 453 YISKSG-AYEVR 463

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  196 bits (497), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 137/499 (27%), Positives = 249/499 (49%), Gaps = 48/499 (9%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++  +  G  L+S+  +D +  S  D F T +++D   +S ++   L     +++ 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58

Query: 60  IQHND---LYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
            + +D   ++LV             + +LHKL +++  +    +E+ ++D F+++YE+L+
Sbjct: 59  RESSDNLPMWLVAVSRSNVDSSMI-WEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116

Query: 117 EVMDYGIPQITETKMLKQYITQX-------------------XXXXXXXXXXXRNATRPP 157
             ++ GIPQ T+   +   +++                               R+++   
Sbjct: 117 LTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIA 176

Query: 158 VALTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDL 217
           ++  +   WRP G+ +KKNE +LDI E I +L+ + G +++S + G V   S LSGMP  
Sbjct: 177 LSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236

Query: 218 KLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELED 277
           +LG+ND   +S + ++ S L      +  +  ++ D   K +I +++  S     + LED
Sbjct: 237 QLGLNDT--YSIHGNEKSEL------SIVEMMSEYDIKNKKAIPNAAAGS-----VILED 283

Query: 278 LKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHC 337
            KFHQCV+L+K+E   +I F+PPDG F LM YR+   I         V++  NS +    
Sbjct: 284 CKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKV 343

Query: 338 KAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYS 397
             ++      +A +V + IPVP       F  S G  KY   +  ++WK   + G  E +
Sbjct: 344 TLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENT 403

Query: 398 MSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQY 457
           +S ++ +P+ S  +D S  +  +     + P+ + F+I  F+ SG+ VR+LK  EP+L Y
Sbjct: 404 LSGKVAIPATS--HDLSDLLRWS-----RPPISMGFEIVMFSNSGLVVRHLKCQEPQLNY 456

Query: 458 KSYPWVRYITQSGDDYTIR 476
           +   W++YI+ SG  Y IR
Sbjct: 457 QPVKWIKYISHSG-AYEIR 474

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  193 bits (490), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 148/502 (29%), Positives = 241/502 (48%), Gaps = 63/502 (12%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++     G+ L+S+  R  +P S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           ++      +             + FL+KL  +L  +    E E ++++F+  YELLD V+
Sbjct: 57  VKSPGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITE-----TKMLKQYITQXXXXXXXXXXXXRNATRP-PVA-------------- 159
           + G+P  TE     +KM  +                    R  PVA              
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 160 ----LTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMP 215
               + +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIEL 275
             + G+ND                + ST   DN++   T  K +I  ++  S     + L
Sbjct: 236 VCRFGLNDS--------------LSVSTPFGDNES--PTTNKKAIPKAAAGS-----VML 274

Query: 276 EDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIE 334
           ED KFHQCV+L KF++E+ I FIPPDG F+LM Y +   +  P     V     +NS I+
Sbjct: 275 EDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANS-ID 333

Query: 335 IHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGK 394
                K+    K TA +V++ IPVP +        S+G  K+VPE+SAI+WK   + G  
Sbjct: 334 YRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLT 393

Query: 395 EYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPK 454
           E S+SA   +P         K    N  +  K P+ +KF+I  F+ SG+ VR+  ++E  
Sbjct: 394 ENSLSAT-AVP--------MKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGD 444

Query: 455 LQYKSYPWVRYITQSGDDYTIR 476
             YK   W++Y+++SG  Y +R
Sbjct: 445 RNYKMVKWIKYLSKSG-AYEVR 465

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  190 bits (483), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 142/516 (27%), Positives = 237/516 (45%), Gaps = 75/516 (14%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ ++S+  RD I  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           I+ +    +             + FL+K   +L  Y     EES+++ F+  YELLD V+
Sbjct: 57  IRSSSNLWIVAVTRSNADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DYGIPQITE-----TKMLKQYITQXXXXXXXXXXXXRNAT------RPPVALTNSVS--- 165
           + G+P  TE     +KM ++ +                A       R P  L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
                             WR  GI +KKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 NSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTAS 267
            + LSG P  + G+N          DS +L     +   D  ++ +   K +I  ++  S
Sbjct: 236 TTHLSGTPLCQFGLN----------DSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS 285

Query: 268 KRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQ 326
                ++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +   +  P     +   
Sbjct: 286 -----VQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSV 340

Query: 327 VHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWK 386
             +N  +E     K+    K TA +V + IPVP          S+G  ++VPE++A+LWK
Sbjct: 341 RSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWK 400

Query: 387 LRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEIL------KGPVQIKFQIPYFTT 440
              + G  E ++SA               T+P +N   L      + P+ + F+I  F+ 
Sbjct: 401 FAKYQGLTENTLSA--------------LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSN 446

Query: 441 SGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
           SG+ VR+ K++E    Y +  WV+YI++SG  Y +R
Sbjct: 447 SGLVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  185 bits (469), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 142/506 (28%), Positives = 239/506 (47%), Gaps = 70/506 (13%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ L+S+  +  +  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           I+      +             + FL++L E+L  +     E  +++ F+I YELLD V+
Sbjct: 57  IKSAKNLWIVAVSRSNADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIVL 115

Query: 120 DYGIPQITETKMLKQY----------------------------ITQXXXXXXXXXXXXR 151
           + G+P  TE   +                               ++Q             
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 152 NATRPPVALTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKL 211
            A+  P    +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + L
Sbjct: 176 IASEAP----SNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231

Query: 212 SGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKV 271
           SGMP  + G+ND                + ST   D+     T+KK +I  ++  S    
Sbjct: 232 SGMPVCRFGLND--------------ALSVSTPFGDDDEYQVTNKK-AIPKAAAGS---- 272

Query: 272 NIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSN 330
            + LED KFHQCV+L KF++E+ I FI PDG F+LM Y +   +  P     +   V SN
Sbjct: 273 -VMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSN 331

Query: 331 SRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSF 390
           S I+     K+    K TA +V++ IPVP +  +     S+G  K+VPE+SAI+WK   +
Sbjct: 332 S-IDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKY 390

Query: 391 PGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKI 450
            G  E S+SA   +P         K    N  +  + P+ +KF+I  F+ SG+ VR+  +
Sbjct: 391 QGLTENSISAT-AVP--------MKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNV 441

Query: 451 NEPKLQYKSYPWVRYITQSGDDYTIR 476
           +E    YK   W++Y+++SG  Y +R
Sbjct: 442 SERDRNYKMVKWIKYLSKSG-AYEVR 466

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  185 bits (469), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 144/518 (27%), Positives = 242/518 (46%), Gaps = 70/518 (13%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A+      G+ ++S+ ++  +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPIL--TLGSTTFHHIK 58

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
               D   +             + FL+KL  +L  Y     EE +++ F+I++ELLD +M
Sbjct: 59  STRGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLDVMM 117

Query: 120 --DYGIPQITETKMLKQYITQXXXXXXXXXXXXRNA------------------TRPPVA 159
               GIP +TE  ++   ++              N                   + P + 
Sbjct: 118 CGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLL 177

Query: 160 LTNSVS------------WRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
             NS S            WRP+GI HKKNE  L + E IN+L+++ G VL++ + G + +
Sbjct: 178 RRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSIDL 237

Query: 208 NSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDK--KPSITSSST 265
            + LSG P  + G+ND    S    D        S   + +  DV+ DK  K  ++ +S 
Sbjct: 238 ETHLSGTPICQFGLNDSLSVSGVDSDM-----YGSHNHNHHFGDVNFDKTDKKQLSMASV 292

Query: 266 ASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVN 324
            S     + LED KFHQCV L KF+ ++II F+PPDG  +LM Y +   +  P     + 
Sbjct: 293 GS-----VILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIV 347

Query: 325 VQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAIL 384
               + + +E     K+    + +A NV + IPVP +        ++GS K++PE+SA++
Sbjct: 348 TNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMI 407

Query: 385 WKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIP-KNNAEI-----LKGPVQIKFQIPYF 438
           W+   F G  E ++SA               TIP K+N ++      K P+ + F+I  F
Sbjct: 408 WRFNKFNGLTENTLSAV--------------TIPTKDNTQLSLQQWSKPPMSLDFEILMF 453

Query: 439 TTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
           + SG+ VRY  I E   +YK+  W++YI++SG  Y IR
Sbjct: 454 SNSGLVVRYFTITERDQKYKAVKWIKYISRSG-SYEIR 490

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  184 bits (467), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 244/512 (47%), Gaps = 74/512 (14%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SAV      G+ ++S+ +++++  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56

Query: 60  IQHN----DLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115
           I+ N    DL+LV             + FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 57  IRSNVHGDDLWLVSVTRSNINCGAV-WEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114

Query: 116 DEVM-DYGIPQITE----TKMLKQYITQXXXXXXXXXXXXRNATRPPVA----------- 159
           D ++ + G P  T+     K +    ++            +N+T P +            
Sbjct: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174

Query: 160 ------------LTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
                       +   + WRP+GISHKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234

Query: 208 NSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDK-KPSITSSSTA 266
            + LSG P  + G+ND                + S    D     D  K K +I  ++  
Sbjct: 235 VTHLSGTPVCQFGLND----------------SLSVKNDDYGDSFDYIKNKKAIPKAAAG 278

Query: 267 SKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNV 325
           S     + LED KFHQCV L KF+ ++II F+PPDG  +LM Y + + I  P     +  
Sbjct: 279 S-----VLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVT 333

Query: 326 QVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILW 385
              S + +E     K+    K TA NV + IPVP +        S+GS K+ PE+ A+LW
Sbjct: 334 YSSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLW 393

Query: 386 KLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPK-NNAEILKGPVQIKFQIPYFTTSGIQ 444
               + G  E ++SA     +I+     SK  P+ N  +  K P+ + F+I  F+ SG+ 
Sbjct: 394 TFNKYNGLTENTLSA----VTIT-----SKDAPRLNIQQWQKPPISLDFEIMMFSNSGLV 444

Query: 445 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
           VRY  I E + +YK+  W+RY+++SG  Y IR
Sbjct: 445 VRYFTIKESE-RYKTVKWIRYVSKSG-SYEIR 474

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  181 bits (458), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 137/543 (25%), Positives = 238/543 (43%), Gaps = 110/543 (20%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S +Y  D   +PL+ + ++    +S  ++   L      +  ++P   ++ G+ +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEESIELFQQAHSKHPMVP-VFHYKGIHFVYI 56

Query: 61  QHNDLYLVXXXXXXXXXX--------XXXFTFLHKLVEVLSDYLKT--VEEESIRDNFVI 110
           + +  Y +                      T+L     +L  Y  +  +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEVMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRP-------------- 156
           IYELLDE +D+G+PQ+T+  +++ YI              +  ++               
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 157 ---PVALTNSVSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLS 212
                  T+++SWRP+GI + KNE FLD++E I   M   K ++ ++ + G ++  S LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVN 272
           GMP LK+G++                                     ITSS    + +  
Sbjct: 237 GMPKLKIGLS------------------------------------KITSSLPKEREQF- 259

Query: 273 IELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQV 327
             + + KFHQCV L   + + I++FIPPDG+F L  Y+L   ++      L+  DV  + 
Sbjct: 260 --MNNAKFHQCVSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEE 316

Query: 328 HSNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPE 379
               +I I        K +++ + + I IP+         D A  P FK   G++ +   
Sbjct: 317 KKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLT 376

Query: 380 KSAILWKLRSFPGGK---EYSMSAELGL-------------------PSISNG---NDGS 414
              +LW++ S  GG    E+SM  E  L                   P +  G    +  
Sbjct: 377 DDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELY 436

Query: 415 KTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
           K + +N        V ++F+IPY+T SG++V+YLKI E +LQY S+PWVRY T + ++Y 
Sbjct: 437 KQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYA 496

Query: 475 IRL 477
            ++
Sbjct: 497 YQI 499

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  175 bits (443), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 140/513 (27%), Positives = 244/513 (47%), Gaps = 69/513 (13%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA+      G+ ++++  +  +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
              +D   +             + FL+KL  V+ D     +E ++++NF+  YE+LD V+
Sbjct: 59  SDGSDSLWLVAVSRSNANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDTVL 117

Query: 120 DYG-IPQITE-----TKML----KQYITQXXXXXXXXXXXXRNATRP---------PVAL 160
           + G IP  TE     +KM     KQ                 N + P         P  L
Sbjct: 118 EEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFL 177

Query: 161 T---------------NSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDV 205
           T               +++SWRP GI +KKNE  L++ E I++L+++ G +L+S + G +
Sbjct: 178 TRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTI 237

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDV-DTDKKPSITSSS 264
            + + LSGMP  + G+ND  +  ++ DDS               ++V D   K +I  ++
Sbjct: 238 DLTTHLSGMPICQFGLND-SLSVEFGDDS--------------ISEVEDFANKKAIPKAA 282

Query: 265 TASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDV 323
                   + LED KFHQCV L KF  +++I F+PPDG  +LM Y +   +  P     +
Sbjct: 283 AG-----RVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPI 337

Query: 324 NVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAI 383
              +   + I+     K+    K +A +V + IPVP          S+G  K+VPE+SA+
Sbjct: 338 VTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAM 397

Query: 384 LWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGI 443
           +WK   + G  E ++SA + +PS       S T      +  + P+ + F+I  F+ SG+
Sbjct: 398 IWKFTKYTGLTENTLSA-VTVPS-------SDTTQLTVQQWPRPPMSLNFEIMMFSNSGL 449

Query: 444 QVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
            VRY K+++   +Y++  W++YI++SG  Y IR
Sbjct: 450 VVRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  173 bits (438), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 123/423 (29%), Positives = 213/423 (50%), Gaps = 45/423 (10%)

Query: 82  FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM-DYGIPQITE-TKMLKQYITQX 139
           + FL+KL  +L +Y    +EE +++ F+I++ELLD ++   GIP  TE +K++ +   + 
Sbjct: 82  WEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLDVMLGSCGIPLETEPSKVIAKMSVKP 140

Query: 140 XXXXXXXXXXX---------RNATRPPVALT--------------NSVSWRPEGISHKKN 176
                                N    P  L               N  SWRP+ I HKKN
Sbjct: 141 AKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHDSNFSFNDFSWRPKDIKHKKN 200

Query: 177 EAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSN 236
           E  L + E IN+L+ + G +L++ + G + + ++LSG P  + G+ND    S  L  + +
Sbjct: 201 EVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLND----SLTLGSNDS 256

Query: 237 LPPAASTTTSDNKTD-VDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKII 295
              + +  T +NK+  +D++    + S ++      N+ LED KFHQCV L KF+ E+II
Sbjct: 257 EYSSRNGRTGNNKSSMLDSNLSNKVLSKASVG----NVILEDCKFHQCVSLDKFDRERII 312

Query: 296 TFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEI 354
            F+PPDG  +LM Y +   +  P     +     +   ++     K+    + +A  V +
Sbjct: 313 KFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLFPGRLSAKGVVL 372

Query: 355 LIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGS 414
            IPVP          S+G+ K+VP ++A++WK   + G  E ++SA + +PS     + +
Sbjct: 373 HIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VTVPS----KEVN 427

Query: 415 KTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
           +T  +  A   + P+ + F+I  F+ SG+ VRY  I+E    YK+  W++Y+++SG  Y 
Sbjct: 428 QTTLQQWA---RPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG-SYE 483

Query: 475 IRL 477
           +R 
Sbjct: 484 VRF 486

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  169 bits (428), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 145/554 (26%), Positives = 234/554 (42%), Gaps = 126/554 (22%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S+++  D    PL+ + ++    +   + F     ++ + SN+  P + H G+ ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYLVXXXX-XXXXXXXXXFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYELLDE 117
             + LY V                +L+    +L  YL+   ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 VMDYGIPQITETKMLKQYI-----------------------TQXXXXXXXXXXXXRNAT 154
            +D+GIPQ+T+  +++  I                        +            ++  
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 155 RPPVALTNS---------VSWRPEGISHKKNEAFLDIVESINMLMTQKG-QVLRSEIIGD 204
           +      NS         +SWRP+GI + KNE F+D++ES   +M  K  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSS 264
           +   S LSGMP +K+ IN      K L D      +A                       
Sbjct: 236 IICRSYLSGMPVVKICIN------KMLKDRDQFLSSA----------------------- 266

Query: 265 TASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLI 319
                         KFHQCV L    ++  I FIPPDG F L  Y++   I       LI
Sbjct: 267 --------------KFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLI 312

Query: 320 WCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADT--------PTFKYSH 371
              V V+     +++I  K +   K +++AT ++I +P+ D  +T        P FK   
Sbjct: 313 EYKV-VEKPKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDF 371

Query: 372 GSLKYVPEKSAILWKLRSFPGGKE---YSMSAELGL-------------------PSISN 409
           GS+ +      +LWK     GG     +SM  E  L                   P +  
Sbjct: 372 GSILFNLSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLRE 431

Query: 410 GNDGSKTIPKNNAE--ILKGPVQ----IKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWV 463
           G    +     + E   +  PV+     +F++PYFT+SG++V YLKI E +LQY+S+PWV
Sbjct: 432 GVRMEELYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWV 491

Query: 464 RYITQSGDDYTIRL 477
           RY T +  +Y  ++
Sbjct: 492 RYKTINDTEYAFQM 505

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  166 bits (420), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 126/489 (25%), Positives = 207/489 (42%), Gaps = 114/489 (23%)

Query: 48  PCLNHNGLEYLFIQHNDLYLVXXXXXXXXXX-XXXFTFLHKLVEVLSDYL-KTVEEESIR 105
           P L+H G +Y++IQ + LY +              F +L +L ++   YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEVMDYGIPQITETKMLKQYITQXXXXXXX---XXXXXRNATR------- 155
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+                   A R       
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 156 ----PPVA------------LTNSVSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLR 198
               P  A             T+++SWRP GI + KNE FLD+VE +  LM  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKP 258
           +++ G +   S LSGMP L +G+N                                    
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN------------------------------------ 244

Query: 259 SITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTI--K 316
                  A  R    ++    FHQCV L +   ++ ITF+PPDG+F L +Y+L+     +
Sbjct: 245 ----KMVAQDRDFTSQVH---FHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQ 297

Query: 317 PLI---WCDVNVQVHSN----SRIEIHCKAKAQIKRKSTATNVEILIPVP--------DD 361
           PLI    C   V+         R+ +        K +   + +++ +P+         D 
Sbjct: 298 PLIKLEECRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDL 357

Query: 362 ADTPTFKYSHGSLKYVPEKSAILW---KLRSFPGGKEYSMSAELGL----------PSIS 408
           +  P FK   G + +      +LW   K +   G + ++M ++  L            +S
Sbjct: 358 SFPPRFKCDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLS 417

Query: 409 NGNDGSKTIPKNNAEIL------------KGPVQIKFQIPYFTTSGIQVRYLKINEPKLQ 456
              D     P    E L               +++ F++PY T SG++V +LKI EP+LQ
Sbjct: 418 TSMDPLPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQ 477

Query: 457 YKSYPWVRY 465
           Y+S+PW+RY
Sbjct: 478 YQSFPWIRY 486

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  165 bits (418), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 139/509 (27%), Positives = 232/509 (45%), Gaps = 67/509 (13%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ ++S+ + + +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHN--DLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
           I+ N  D   +             + FL+K   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115

Query: 118 VMDYG-IPQITETKMLKQYIT---------------QXXXXXXXXXXXXRNATRPPVALT 161
           V+  G IP  TE   +   I+                             N + P     
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 162 NSVS--------------WRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
           N+ S              WRP GI +KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 NSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTAS 267
            + LSG P  + G+ND    S    DS  L     T    NK  V     P   + S   
Sbjct: 236 TTHLSGTPICQFGLNDSP--SVEFGDSLWL----DTQEFHNKKAV-----PKAAAGS--- 281

Query: 268 KRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQV 327
                + LED KFHQCV L KF  E+II F+PPDG  +LM Y +   +  L +    V  
Sbjct: 282 -----VMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVVT 335

Query: 328 HSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKL 387
              S +E     K+    K +A +V + IPVP          S+G  K+  E++A++W+ 
Sbjct: 336 PCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRF 395

Query: 388 RSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRY 447
             + G  E ++SA + +P+       S T      +  + P+ + F+I  F+ SG+ VRY
Sbjct: 396 NKYHGLTENTLSA-VTVPT-------SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRY 447

Query: 448 LKINEPKLQYKSYPWVRYITQSGDDYTIR 476
            ++++   +Y+   W++YI++SG  Y +R
Sbjct: 448 FRVSDKDEKYRVVKWIKYISKSG-SYEVR 475

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  164 bits (416), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 123/418 (29%), Positives = 203/418 (48%), Gaps = 53/418 (12%)

Query: 82  FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDY-GIPQITETKMLKQYITQX- 139
           + FL+K   +L+ +     E ++++ F+  YELLD +++  G+P  TE   +   ++   
Sbjct: 81  WEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLDLMLNVDGVPLDTELSSVSAKMSTKP 139

Query: 140 ---------------XXXXXXXXXXXRNATRPPVALTNS----VSWRPEGISHKKNEAFL 180
                                     RN     V   N+      WRP GI +KKNE FL
Sbjct: 140 LHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDTMNTEPSNYPWRPNGIKYKKNEIFL 199

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240
           +I E I++L+++   +L++ + G V + S LSG P  + G+ND    S  +D+       
Sbjct: 200 NINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTCQFGLND----SLSVDE------- 248

Query: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300
            +   SD+    +    P  T+ +        + LED KFH+CV L KF  ++II F+PP
Sbjct: 249 PNYYNSDDNGFRNQQNIPRATAGT--------VVLEDCKFHECVSLDKFNRDRIIKFVPP 300

Query: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSR--IEIHCKAKAQIKRKSTATNVEILIPV 358
           DG  +LM Y +   I        NV ++S SR  ++     K+    K +A +V + IPV
Sbjct: 301 DGHIELMKYHVRDNINLPFKVTPNV-INSRSRTGLDYRITLKSLFPSKLSANDVVLKIPV 359

Query: 359 PDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIP 418
           P          S+G  ++VPE+S I+WK   + G  E  +SA        + ND ++ + 
Sbjct: 360 PSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSA-----VTVSSNDTTQLML 414

Query: 419 KNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
           +  A   + P+ + F+I  F+ SG+ VRYLKI E   +Y++  W++YI++SG  Y +R
Sbjct: 415 QQWA---RPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG-SYEVR 468

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  164 bits (416), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 111/380 (29%), Positives = 186/380 (48%), Gaps = 54/380 (14%)

Query: 82  FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYITQX-X 140
           + FL+ + ++L  Y    EE ++ D+F++ YELLD V+D G+PQ TE   +   +++   
Sbjct: 79  WEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPA 137

Query: 141 XXXXXXXXXXRNATRPPVALTNSVS-------------WRPEGISHKKNEAFLDIVESIN 187
                      N+ R     T +VS             WR EGI +KKNE +LD++E ++
Sbjct: 138 TGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLS 197

Query: 188 MLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSD 247
           +L+ + G +L++ + G V+  + LSGMP    G ND     +        P         
Sbjct: 198 LLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQSLRQRSPRRQYAPRV------- 250

Query: 248 NKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLM 307
                 TD++ S+              LED KFHQCV+L+KF+ E++I F+PPDG+F+LM
Sbjct: 251 ----FGTDERESVV-------------LEDCKFHQCVQLNKFDQERVIRFVPPDGEFELM 293

Query: 308 NYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTF 367
            Y +   ++P       V   +   IE     ++    K +A +VE+ IP P    +   
Sbjct: 294 KYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKV 353

Query: 368 KYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEIL-- 425
             S G  K+VPE++AI+WK+  F G  E ++SA     +I++          + A++L  
Sbjct: 354 NVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA----VTIADEQG-------HYAQVLDQ 402

Query: 426 --KGPVQIKFQIPYFTTSGI 443
             + P+ +K +I  F+T+ +
Sbjct: 403 WPRPPISMKLEIMMFSTAAL 422

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  161 bits (408), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 142/552 (25%), Positives = 225/552 (40%), Gaps = 123/552 (22%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S V+  D    PL+ R  +    ++  + +      +  QS    P +   G+ Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLKS---IAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 61  QHNDLYLVXXXXXXXXXXXX-XFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYELLDE 117
             + LY V                +L+    +L  YLK   V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 VMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNA---TRPPV---------------- 158
            +DYGIPQ+T+  +++  I               ++   + P +                
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 159 ------------ALTNSVSWRPEGISHKKNEAFLDIVESINMLMTQK-GQVLRSEIIGDV 205
                         T ++SWRP+GI + KNE F+DI+E  + LM  K  QV ++ + G +
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSST 265
              S LSGMP +++ IN      K L D                                
Sbjct: 236 NCRSYLSGMPIVRVCIN------KMLKDK------------------------------- 258

Query: 266 ASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLI-WCD 322
                 ++ L   KFHQCV L    ++  I FIPPDG F L  Y+L   I   P+I   D
Sbjct: 259 ------DLFLGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLID 312

Query: 323 VNV-QVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGS 373
             + +     R+ +    +   K +++AT ++I IP          D    P FK  HGS
Sbjct: 313 YKINERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGS 372

Query: 374 LKYVPEKSAILWKLRSFPGGK---EYSMSAELGL-------------------PSISNGN 411
           + +      +LW  +   GG     YSM  E  L                   P +  G 
Sbjct: 373 VFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGA 432

Query: 412 D------GSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRY 465
                    K+  +   +     +  +F++PY+T+SG++V YLKI+E  L+Y+S+ WVRY
Sbjct: 433 HLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRY 492

Query: 466 ITQSGDDYTIRL 477
            T +  +Y  ++
Sbjct: 493 KTINDTEYAYQV 504

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  160 bits (406), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 167/317 (52%), Gaps = 24/317 (7%)

Query: 162 NSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           N ++WRP+GI HKK+E FL + E IN+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKF 280
           ND  G+ S+  D+   L      + S      D   K  I  ++  S     + LED KF
Sbjct: 256 NDSLGMQSE--DEKKWLAQQQRHSGS------DFGNKNFIPKAAAGS-----VLLEDCKF 302

Query: 281 HQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKA 339
           H+CV L KF    II F+PPDG  +LM Y +   I  P     +      ++ I+     
Sbjct: 303 HECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDYRITL 362

Query: 340 KAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMS 399
           K+    K +A +V + IPVP          S+G  K+VPE++A++W+   + G  E ++S
Sbjct: 363 KSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTLS 422

Query: 400 AELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS 459
           A     ++S     S T   N  +  + P+ ++F++  F+ SG+ VRY  I+    ++++
Sbjct: 423 A----VTVST----SDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRA 474

Query: 460 YPWVRYITQSGDDYTIR 476
             W++YI+++G  Y +R
Sbjct: 475 VKWIKYISKAG-SYEVR 490

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  160 bits (404), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 130/513 (25%), Positives = 228/513 (44%), Gaps = 70/513 (13%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M +AV      G+ L+ + ++  +  +  D F      +    N+  P L      + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRV---QVINNDNIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
           +    + L+LV             + +L+KL  ++  Y  T  E+ ++D F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRSNADSGAI-WEYLYKLNSLMEVYGLT-HEDILKDEFIVCHELLDI 115

Query: 118 VMDY-GIPQITE------------TKMLKQYITQXXXXXXXXXXXXRNAT---RPPVALT 161
            +   G+P  TE             ++L     +             N+T    P     
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 162 NS----------------VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDV 205
           NS                + WR   I +KKNE  ++++E IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSST 265
            + + LSGMP  ++G+ND         ++++       +  D   DV  D+         
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQG--GENAHWTNEDRASNRDAMPDVSGDR--------- 284

Query: 266 ASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PL-IWCDV 323
                  + LE  KFHQCV L K+  + +I FIPPDG+F+LM Y +S  +  P  I   V
Sbjct: 285 -------VILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQV 337

Query: 324 NVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAI 383
            +  H  + +    K K+   RK +A NV + IPVP          S G  K++PE++ +
Sbjct: 338 TLTSHGTA-LSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCM 396

Query: 384 LWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGI 443
           +W    F G  E  ++A+  +P+ S  +   K       +  + P+ + F++  F+ +G+
Sbjct: 397 VWSFHRFNGSTENHLNAQT-VPTQSIASQSIK-------QWTRPPMSLDFKVLMFSNTGL 448

Query: 444 QVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476
            VRYLK+ E  + Y +  W++YI+ +G  Y +R
Sbjct: 449 IVRYLKVQEKNMHYNTIKWIKYISAAG-SYEVR 480

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  157 bits (397), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 166/317 (52%), Gaps = 24/317 (7%)

Query: 162 NSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           N ++WRP+GI HKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPVCRFGL 255

Query: 222 NDK-GIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKF 280
           ND  G+ S   +D  N       +  D  +    + K     ++  S     + LED KF
Sbjct: 256 NDSLGMQS---EDQENW-----LSQQDQHSHNGFENKNCFPKAAAGS-----VLLEDCKF 302

Query: 281 HQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKA 339
           H+CV + KF    II F+PPDG  +LM Y +   I  P     +      ++ ++     
Sbjct: 303 HECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEVDYRITL 362

Query: 340 KAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMS 399
           K+    K +A +V + IPVP          S+G+ K+VPE++A++W+   F G  E ++S
Sbjct: 363 KSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTENTLS 422

Query: 400 AELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS 459
           A     ++S     S T   +  +  + P+ + F++  F+ SG+ VRY  I+    ++++
Sbjct: 423 A----VTVST----SDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRA 474

Query: 460 YPWVRYITQSGDDYTIR 476
             W++YI++SG  Y +R
Sbjct: 475 VKWIKYISKSG-SYEVR 490

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  156 bits (394), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 165/317 (52%), Gaps = 24/317 (7%)

Query: 162 NSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           N ++WRP+GI+HKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKF 280
           ND  G+ S+  D+   L      +        + + K  I  ++  S     + LED KF
Sbjct: 256 NDSLGMQSE--DEKKWLAQQQHHSRG------NFESKNFIHKAAAGS-----VLLEDCKF 302

Query: 281 HQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKA 339
           H+CV L KF     I F+PPDG  +LM Y +   I  P     +      ++ I+     
Sbjct: 303 HECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRITL 362

Query: 340 KAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMS 399
           K+    K +A +V + IPVP          S+G  K+VPE++A++W+   + G  E ++S
Sbjct: 363 KSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLS 422

Query: 400 AELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS 459
           A     ++S     S T   N  +  + P+ + F++  F+ SG+ VRY  I     ++++
Sbjct: 423 A----VTVST----SDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRA 474

Query: 460 YPWVRYITQSGDDYTIR 476
             W++YI++SG  Y +R
Sbjct: 475 VKWIKYISRSG-SYEVR 490

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 66/130 (50%), Gaps = 5/130 (3%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
            +H D   +             + FL+KL  V++ Y +   EE++++ F+I++E+LD ++
Sbjct: 59  SRHGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIML 117

Query: 120 -DYGIPQITE 128
              GIP  TE
Sbjct: 118 GGNGIPIDTE 127

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  151 bits (381), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 116/430 (26%), Positives = 195/430 (45%), Gaps = 73/430 (16%)

Query: 82  FTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM-DYGIPQITETKMLKQYIT--- 137
           + FL+KL  +L+ Y     EE + + F++ YE++D ++    +P  TE   +   I+   
Sbjct: 81  WEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDVMLTSNAMPINTELSSIASKISYRL 139

Query: 138 -QXXXXXXXXXXXXRNATRPPVALTNS---------------VSWRPEGISHKKNEAFLD 181
            +             N    P  LT +               + WRP GI +KKNE FL 
Sbjct: 140 PKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQSDIPWRPTGIKYKKNEVFLY 199

Query: 182 IVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAA 241
           + E IN+L+++   +L++ + G + + S LSG P  + G+ND      YL  + N     
Sbjct: 200 VNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLND------YLSMTGN---NI 250

Query: 242 STTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPD 301
           S    + + D   D+  S     T      ++++ED  FHQCV L KF +E++I F+PPD
Sbjct: 251 SNRGDEFRHDFMDDEDLS-----TGRSSSSSVKIEDCTFHQCVSLDKFNDERLINFVPPD 305

Query: 302 GKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEI---HCKAKAQIKRKS------TATNV 352
           G F+LM Y +          D+N+      R+ I    C  + +I  KS      +A + 
Sbjct: 306 GSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSAADA 357

Query: 353 EILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGND 412
            + IP+P          S G   +    +  +WK   + G  E  +  E           
Sbjct: 358 MLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILE----------- 406

Query: 413 GSKTIPKNNAEIL------KGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 466
              T+P ++ +IL      + P+ + F+I  F+ SG+ V+YLK+ E   +Y+   W++Y+
Sbjct: 407 ---TVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYV 463

Query: 467 TQSGDDYTIR 476
           ++SG  Y IR
Sbjct: 464 SKSG-SYEIR 472

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  152 bits (383), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 134/552 (24%), Positives = 230/552 (41%), Gaps = 120/552 (21%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAID-KFPTLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M+S     D   +PL+ R  R   P+  +D     L ++L+       P    NG  Y  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHNDLYLVXXXXXXXXXX-XXXFTFLHKLVEVLSDYLKT-VEEESIRDNFVIIYELLDE 117
           I  ++LY                  +L ++ ++   ++   + + ++RDNF +I+E+++E
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIEE 117

Query: 118 VMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATR--PP-------------VALTN 162
             DYGI Q+T   ++  +I               +     PP               +T+
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 163 SVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGI 221
           +VSWRP+GI + KNE FLD++E +  +M  +  V+R+ +I G +   S LSGMP L +G+
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 222 NDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFH 281
           N                                             ++ V+  ++ LKFH
Sbjct: 238 N------------------------------------------KLMQKNVHF-MKRLKFH 254

Query: 282 QCVRLSKF--ENEKIITFIPPDGKFDLMNYRLSTTI--KPLI-----WCDVNVQVHSNSR 332
           +CV L     E   +I FIPPDG+F+L NY+L+  +  +P+I           + +  ++
Sbjct: 255 ECVDLHTLIKEESPVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQ 314

Query: 333 IEIHCKAKAQIKRKSTATNVEILIPVP----------DDADTPTFKYSHGSLKYVPEKSA 382
            ++  KA      K+  +  E+LI +P          D    P FK   G + +     +
Sbjct: 315 DKLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGS 374

Query: 383 ILWKLRSFPGG---KEYSMSAELGL-------------------PSISNG--------ND 412
           I+WK+ +  GG   K Y +     +                   P +  G          
Sbjct: 375 IIWKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQY 434

Query: 413 GSKTIPKNNAEILK------GPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 466
             KT   +  E  K        + + F+IPY+  SG++V Y KI EP+L Y+S+PWVRY 
Sbjct: 435 HGKTTEYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYK 494

Query: 467 TQSGDDYTIRLT 478
           T + ++Y  +++
Sbjct: 495 TVNDNEYIYQVS 506

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  150 bits (379), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 166/318 (52%), Gaps = 24/318 (7%)

Query: 161 TNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLG 220
           +N ++WR  GI HKK+E FL + E +N+L+++ G +L+S + G + + + L+G P  + G
Sbjct: 195 SNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDIVTHLNGTPVCRFG 254

Query: 221 INDK-GIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLK 279
           +ND  G+ S+  D+ + L      + S      D   K  +  ++  S     + LED K
Sbjct: 255 LNDSLGMQSE--DEKNWLAQQHQHSRS------DFGNKNFLPKAAAGS-----VLLEDCK 301

Query: 280 FHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCK 338
           FH+CV + KF    II FIPPDG  +LM Y +   I  P     +      ++ I+    
Sbjct: 302 FHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEIDYRIT 361

Query: 339 AKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSM 398
            K+    K +A +V + IPVP          S+G  K+VPE++A++W+   + G  E ++
Sbjct: 362 LKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTL 421

Query: 399 SAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYK 458
           SA     ++S     S T   +  +  + P+ + F++  F+ SG+ VRY  I+    +++
Sbjct: 422 SA----ATVST----SDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHR 473

Query: 459 SYPWVRYITQSGDDYTIR 476
           +  W++YI++SG  Y +R
Sbjct: 474 AVKWIKYISKSG-SYEVR 490

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  147 bits (370), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 128/509 (25%), Positives = 214/509 (42%), Gaps = 127/509 (24%)

Query: 48  PCLNHNGLEYLFIQHNDLYLVXXXXXXXXXX-XXXFTFLHKLVEVLSDYL-KTVEEESIR 105
           P L +   +Y+FIQ + LY +              F++L++L  +   YL + + +  I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 106 DNFVIIYELLDEVMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPV------- 158
            NF +I+EL+DE +  G PQ+T+  +++ YI +            R AT           
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYI-KVQVVKDSPEPATREATVTNTKKNKKKD 159

Query: 159 ----------------------ALTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQV 196
                                   T+++SWRP+GI + KNE +LD++E +  L+  +   
Sbjct: 160 SKKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMN 219

Query: 197 LRSEII-GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTD 255
           ++S  + G ++  S LSGMP L +G+N                                 
Sbjct: 220 IKSNTVYGYIQCRSYLSGMPMLTIGLN--------------------------------- 246

Query: 256 KKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTI 315
               + S +    R+ N       FHQCV L +   +K+I+F PPDG+F L NY+L+  +
Sbjct: 247 ---KLNSENEYFMRRAN-------FHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNM 296

Query: 316 K--PLIW---CDVNVQVHSNS----RIEIHCKAKAQIKRKSTATNVEILIPVP------- 359
              P+I    C V ++         R+ +        K + + + + I +P+        
Sbjct: 297 SDPPMIKLEDCKVKLKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWD 356

Query: 360 -DDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGG---KEYSMSAELGL----------P 405
            D +  P FK   G + +      +LW++    GG   K   M +E  L           
Sbjct: 357 VDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQ 416

Query: 406 SISNGND-----------------GSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYL 448
            +SN  D                      P + A +LK    ++F+IPY+T SG++V +L
Sbjct: 417 QLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALLK----VEFEIPYYTISGLKVEFL 472

Query: 449 KINEPKLQYKSYPWVRYITQSGDDYTIRL 477
           KI E +LQ++S+PWVRY T + D Y  +L
Sbjct: 473 KIEEKQLQFQSFPWVRYKTINHDIYAYQL 501

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  137 bits (344), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 123/510 (24%), Positives = 229/510 (44%), Gaps = 71/510 (13%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +AV      G+ ++S+ ++  +  S  D F   +++ L+ +S ++   L      Y+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
                L++V             + FL+K   +L+ Y +   EE +++ F++ +ELLD ++
Sbjct: 59  TPGEGLWVVSVSRNNENSAAT-WEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTMV 116

Query: 120 DYG-IPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSW------------ 166
           + G IP  T+   +   I+             R   R     T++ ++            
Sbjct: 117 EGGGIPSETDPHRI---ISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRAS 173

Query: 167 RPEGIS---H--------KKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMP 215
            P GIS   H        K+NE  + + ESI++L+++ G +L++ + G + + +KL G  
Sbjct: 174 NPGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAA 233

Query: 216 DLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIEL 275
             + G+ND    S   D+SSN           +K D    K+   T+    +     + L
Sbjct: 234 VCQFGLND----SLSTDNSSN-----------SKWDPLRSKETQGTNLEMKNAHVGTVLL 278

Query: 276 EDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEI 335
            D KFHQCV L +F+ ++II F PP+G  +LM Y +   +         V   +N+  + 
Sbjct: 279 RDCKFHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDY 338

Query: 336 HCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKE 395
               K+    K +A NV + IPVP          S+G+ K++PE++A++WK   + G  E
Sbjct: 339 RVTIKSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTE 398

Query: 396 YSMSAELGLPSISNGNDGSKTIPKNNAEIL------KGPVQIKFQIPYFTTSGIQVRYLK 449
             +SA               T+P  +   L      + P+ + F+I  ++ +G+ VRY  
Sbjct: 399 NKLSA--------------ITVPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFT 444

Query: 450 I---NEPKLQYKSYPWVRYITQSGDDYTIR 476
           +   +    ++K+  W++Y++ SG  Y +R
Sbjct: 445 VLDKHNNNTKFKTVKWIKYVSHSG-SYEVR 473

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  133 bits (334), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 112/383 (29%), Positives = 161/383 (42%), Gaps = 115/383 (30%)

Query: 161 TNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKL 219
           T +VSWR +GI + KNE FLD+VES+  LM  K +V+R  +I G +K  S LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLK 279
            +N      K L D       A                                     K
Sbjct: 282 ALN------KILQDDKQFLGHA-------------------------------------K 298

Query: 280 FHQCVRLS--------------------KFENEKIITFIPPDGKFDLMNYRLSTTIK-PL 318
           FHQCV L+                     F N+K I FIPPDG+F L  Y L   +K P 
Sbjct: 299 FHQCVSLNSINIKDLEKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPP 358

Query: 319 IWCDVNVQVHSN---SRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTF 367
           +    +  +  N    R++I  K +   KR+++ + + I IP+         D +  P F
Sbjct: 359 VINMTSFDIKPNFKKFRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRF 418

Query: 368 KYSHGSLKYVPEKSAILWKLRSFPGG---KEYSMSAELGL-------------------P 405
           K   G + +   +  ++W++ +  GG    E  M AE  L                   P
Sbjct: 419 KSDVGKVLFNISEDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPP 478

Query: 406 SISNG-------------NDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINE 452
            + NG              D   T  K   +     V ++F+IPY T SG++V YLKI E
Sbjct: 479 PLRNGPKLEELYEEMHENEDAEDTALKMKTQY----VFMQFEIPYSTCSGLKVEYLKIEE 534

Query: 453 PKLQYKSYPWVRYITQSGDDYTI 475
             L+Y+S+PWVRY T + D+Y  
Sbjct: 535 DLLKYQSFPWVRYKTLNDDEYAF 557

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 69/142 (48%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQ-SNLIPPCLNHNGLEYLF 59
           M+S ++  D   +PL+S+  +       +   P ++   +E  +   PP +  +   Y++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IQHNDLYLVXX---XXXXXXXXXXXFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYEL 114
           ++ + L+ V                  +L +L  +L +Y K   + +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  +++ YI
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYI 136

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  127 bits (318), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 152/353 (43%), Gaps = 90/353 (25%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + +NE FLD+VE +  LM     +++  +I G +   S LSGMP LK+  N
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN 275

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                                          + K     S S              KFHQ
Sbjct: 276 KL-----------------------------SQKDEQFISHS--------------KFHQ 292

Query: 283 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHC 337
           CV      NEK I FIPPDG F L  Y L   +K      L+   V  ++    +I++ C
Sbjct: 293 CVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKLVSFGVKPKL-KKYKIQMSC 350

Query: 338 KAKAQIKRKSTATNVEILIPVPD-------DADTPT-FKYSHGSLKYVPEKSAILWKLRS 389
             +   K +++ + + + IP+         D   P  FK   G + +      +LW +  
Sbjct: 351 TIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEV 410

Query: 390 FPGGK---EYSMSAELGL-------------------PSISNGNDGSKTIPKNNAEILKG 427
             GG    + SM+AE  L                   P + +G    +   + + E  KG
Sbjct: 411 MKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNE--KG 468

Query: 428 P-------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 473
           P       + +KF+IPY T SG+QV YLKI+E +LQY+S+PWVRY T + ++Y
Sbjct: 469 PSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 67/140 (47%), Gaps = 9/140 (6%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S ++  D + +PL+S+  +    L  I +    +   E Q     P ++ +   ++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHNDLYLVXXXXXXXXXXXXXF--TFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELLD 116
           + + L  V                TFL +   +L  YL    +++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EVMDYGIPQITETKMLKQYI 136
           E +D+G+ QIT+  +++ YI
Sbjct: 116 ESIDFGVIQITDASIMRDYI 135

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  127 bits (318), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 157/359 (43%), Gaps = 90/359 (25%)

Query: 161 TNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKL 219
           T  VSWR +GI + KNE FLD+VE +  L   K +V+R  +I G +   S LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLK 279
            +N      K L   +                                       +   K
Sbjct: 293 ALN------KLLQRDAQF-------------------------------------MSHSK 309

Query: 280 FHQCVRLSKFENEKIITFIPPDGKFDLMNYRLS-----TTIKPLIWCDVNVQVHSNSRIE 334
           FHQCV L    NEK + FIPPDG+F L  Y L      T I  +   ++  Q+    ++ 
Sbjct: 310 FHQCVALETL-NEKELEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLR 367

Query: 335 IHCKAKAQIKRKSTATNVEILIPVPD-------DADTPT-FKYSHGSLKYVPEKSAILWK 386
           I    +   K +++ + + + IP+         D   PT FK + G + +      +LW+
Sbjct: 368 ILLTIETHFKTRNSTSILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWE 427

Query: 387 LRSFPGGK---EYSMSAELGL-------------------PSISNGND----GSKTIPKN 420
           +    GG    ++SM AE  L                   P +  G       ++T  + 
Sbjct: 428 IGQMRGGHGETQFSMVAEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQK 487

Query: 421 NAEILKGPVQ-----IKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
           + E+L   +Q     + F+IPY T SG++V YLKI E +LQY+S+PWVRY T S ++Y 
Sbjct: 488 DPEVLVKSIQSQLVGMDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/394 (27%), Positives = 161/394 (40%), Gaps = 130/394 (32%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLM-TQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD++E +  L+  + G V RS I G +   S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                 K L +                                         +  ++FHQ
Sbjct: 309 ------KLLQNDKQF-------------------------------------ISQVQFHQ 325

Query: 283 CVRLSKFEN----------------------EKIITFIPPDGKFDLMNYRLSTTIK--PL 318
           CV L   E                       E  I FIPPDG F L +Y L   I+  P+
Sbjct: 326 CVSLDSIEKVIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPM 385

Query: 319 I-WCDVNVQVH-SNSRIEIHCKAKAQIKRKSTATNVEILIPVPD-------DADTPT-FK 368
           +  C   +       +++I    +   K  ++ + +++ IP+         D   P  FK
Sbjct: 386 VKLCSFEITPKWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFK 445

Query: 369 YSHGSLKYVPEKSAILWKLRSFPGGKEY-------------SMSAELGL----------- 404
            S+G + Y      +LW++    GGK +             +M+AE GL           
Sbjct: 446 TSNGRVVYNISDDFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERK 505

Query: 405 --------PSISNG-------------NDGSKTI---PKNNAEILKGPVQIKFQIPYFTT 440
                   P +  G             NDG  ++   PKNN  +L     + F+IPY T 
Sbjct: 506 ERETSMNPPPLRTGPKLEDIYKETHEENDGYNSVGQKPKNNLNLL----SMDFEIPYCTC 561

Query: 441 SGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
           SG++V YLKI+E +LQY+S+PWVRY T + D+Y 
Sbjct: 562 SGLKVEYLKIDEDQLQYQSFPWVRYKTINDDEYA 595

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 71/141 (50%), Gaps = 10/141 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S++Y  D   +PL+S+  +    L  +++   L      QS    P ++     +++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHNDLYLVXXXXXXXXXXX---XXFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELL 115
           + + LY V                 T+L +L ++  DY+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEVMDYGIPQITETKMLKQYI 136
           DE +DYGI Q+TE  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/361 (28%), Positives = 162/361 (44%), Gaps = 73/361 (20%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +   M  K  V+R  +I G++   S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
              I  + +   SN+      +       +D+ +  S   +     +K N E + L    
Sbjct: 310 --KILKQDVQFLSNVKFHQCVS-------LDSIRARSNPPAVEEDGKKKNEEADTLG--- 357

Query: 283 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC---DVNVQVHSNSRIEIHC 337
                   N+  I FIPPDG+F L  Y L   +K  P+I     ++  ++H   +I+IH 
Sbjct: 358 --------NKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLHK-FKIKIHV 408

Query: 338 KAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLRS 389
             +   K  ++ + + + IP+         D +  P FK   G++ +      +LW++ +
Sbjct: 409 IIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGT 468

Query: 390 FPGG---KEYSMSAELGL-------------------PSISNG-------------NDGS 414
             GG      SM AE  L                   P +  G              D  
Sbjct: 469 MNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSD 528

Query: 415 KTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
           +   +   E L   + + F++PY T SG+++ YLKI E +LQY+S+PWVRY T S D+Y 
Sbjct: 529 EVSTRKKNESL---LTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYA 585

Query: 475 I 475
            
Sbjct: 586 F 586

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEE--QSNLIPPC--LNHNGLE 56
           M+S+++  D   +P++ +  R      A+   P+L++  +E  +SN + P   LN    +
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFIQHNDL-YLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYE 113
           +L I+ + L +L              FT+L +  ++L DYL    +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEVMDYGIPQITETKMLKQYI 136
           L+DE +D+G+ Q T++ ++K Y+
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYV 137

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  118 bits (296), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 161/366 (43%), Gaps = 80/366 (21%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                 K L+  +     +S                S+ S  T  KR+   E ED     
Sbjct: 320 ------KILNRDAQFLSNSSFHQC-----------VSLDSIKTIEKRE---EKED----D 355

Query: 283 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLIWCDVNVQVH---SNSRIEIHC 337
              L    + K + F+PPDG+F L  Y L   +K  P+I    + Q+       +I+I  
Sbjct: 356 DTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLK-DFQIKPKLKKFKIQIET 414

Query: 338 KAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLRS 389
           K +   K  ++ + + + IP+         D +    FK + G + +      +LW++++
Sbjct: 415 KIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQA 474

Query: 390 FPGGKEY----------------SMSAELGLPSISNGN--DGSKTIPKNNAEILKGP--- 428
             G +E+                SM AE  L +    +     K    N   +  GP   
Sbjct: 475 MKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLE 534

Query: 429 --------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQ 468
                               V I F+IPY T SG+++ YLK+ EP+LQY+S+PWVRY T 
Sbjct: 535 ELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTT 594

Query: 469 SGDDYT 474
           S D+Y 
Sbjct: 595 SDDEYA 600

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%), Gaps = 5/95 (5%)

Query: 47  PPCLNHNGLEYLFIQHNDLYLVXXXXXXXXXXXXXFT---FLHKLVEVLSDY--LKTVEE 101
           PP L+ N   ++ ++ + L+ V              T   FL +   +L +Y  +K + +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYI 136
           + I DN +++ EL+DE +D+GI Q+T+  ++K YI
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYI 136

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 97/369 (26%), Positives = 158/369 (42%), Gaps = 104/369 (28%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD++E +  LM    G++ ++ I G++K    LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                 K + +                                         + + KFHQ
Sbjct: 276 ------KLIKNDEQF-------------------------------------ISNSKFHQ 292

Query: 283 CVRLSKFE------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWCDVNVQVH 328
           CV ++  +            + K I FIPPDG+F L  Y L   ++  P+I    N+++ 
Sbjct: 293 CVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIK 351

Query: 329 ---SNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYV 377
                 +I+IH   +   K++++ + + I IP+         D    P FK   G + + 
Sbjct: 352 PKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFN 411

Query: 378 PEKSAILWKLRSFPGG-----------------KEY-----SMSAELGLPSISNG----- 410
                ++W++ S  GG                 +EY      M   +  P +  G     
Sbjct: 412 ISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEE 471

Query: 411 -----NDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRY 465
                +D      KN   I +  + +KF++PY T SG++V YLKI E ++ Y+S+PWVRY
Sbjct: 472 IYEQTHDNRDEHDKNG--ISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRY 529

Query: 466 ITQSGDDYT 474
            T + D+Y 
Sbjct: 530 KTINDDEYA 538

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S ++  D   +PL+S+  +    L+ I +F  L  + +E     PP        Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKL--NYKENG---PPVFTVLEWHYVFI 55

Query: 61  QHNDLYLVXXXXXXXXXXXXXFT---FLHKLVEVLSDYLK--TVEEESIRDNFVIIYELL 115
           + + L+ +                  +L +L  +L  Y    +++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEVMDYGIPQITETKMLKQYI 136
           DE MD+GI Q+T+  ++K YI
Sbjct: 116 DESMDFGIVQLTDPSIIKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  116 bits (290), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 98/360 (27%), Positives = 154/360 (42%), Gaps = 92/360 (25%)

Query: 163 SVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGI 221
           SVSWR +GI + KNE FLD++E +   M     +++  +I G++   S LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFH 281
           N K I+                           DK+                 L   KFH
Sbjct: 282 N-KIIYQ--------------------------DKQF----------------LSSCKFH 298

Query: 282 QCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIH 336
           QCV     +  K++ F+PPDG F L  Y L   +       LI  +V  ++    ++++ 
Sbjct: 299 QCVMPDSVDEGKVLEFVPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLF 357

Query: 337 CKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLR 388
              ++  K+ ++ T + I IP+         D +     +   G + +      +LW++ 
Sbjct: 358 VTIESTFKKTNSTTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIG 417

Query: 389 SFPGGK-EYSMSAELGL-------------------PSISNG---NDGSKTI--PKNNAE 423
           +  GG  +  M A+  L                   P +  G    +  K I   K N  
Sbjct: 418 AMKGGNSQLKMGADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNF 477

Query: 424 ILKGP---------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
             KG          +++ F+IPY T+SG++V YLKI EP LQY+++PWVRY T S D Y 
Sbjct: 478 TRKGESSDETKGNLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  115 bits (289), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 161/365 (44%), Gaps = 78/365 (21%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++   S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                      +SN     S   S N  +   +K+ +   S  A+               
Sbjct: 313 KILNRDPQFMSNSNFHQCVS-LDSINTIEKGQEKEQNTGDSQAAA--------------- 356

Query: 283 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC-DVNVQVH-SNSRIEIHCK 338
                   + + I F+PPDG+F L  Y L   +K  P+I   D  ++     S+I+I  K
Sbjct: 357 --------DAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTK 408

Query: 339 AKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLRSF 390
            +   K  ++ + + + IP+         D +    FK ++G + +      +LW++++ 
Sbjct: 409 IQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTM 468

Query: 391 PGGKE----------------YSMSAELGLPSISNGNDGSKTIPK--NNAEILKGP---- 428
            G +E                 SM AE  L +    +   + +    N   +  GP    
Sbjct: 469 KGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLEE 528

Query: 429 -------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQS 469
                              V I F+IPY T SG++V YLK+ EP+LQY+S+PWVRY T +
Sbjct: 529 LYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVN 588

Query: 470 GDDYT 474
            ++Y 
Sbjct: 589 DEEYA 593

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S+++  D D +P++S+  R      A+    ++LS  ++   +  PP L  N   ++ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFT---FLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           ++ + L+LV              T   FL +   +L  Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYI 136

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  112 bits (280), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 98/379 (25%), Positives = 163/379 (43%), Gaps = 102/379 (26%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFSK---YLDDSS--NLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELED 277
              I ++   ++ +SS        S  T +   + ++D    + +++ A +         
Sbjct: 318 --KILNRDPQFMSNSSFHQCVSLDSINTIEKDEEKNSDDDAGLQAATDARE--------- 366

Query: 278 LKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC-DVNVQVH-SNSRI 333
                            I FIPPDG+F L  Y L   +K  P++   D  ++      +I
Sbjct: 367 -----------------IEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKI 409

Query: 334 EIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILW 385
           +I  K +   K  ++ + + + IP+         D +    FK + G + +      +LW
Sbjct: 410 QIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLW 469

Query: 386 KLRSFPGGKEY-------------------SMSAELGL-------------------PSI 407
           ++++  G +E+                   SM AE  L                   P +
Sbjct: 470 EIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPL 529

Query: 408 SNG------------NDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKL 455
             G               S   P++        V I F+IPY T SG++V YLK+ EP+L
Sbjct: 530 RTGPRLEELYRQVHDQQTSHVTPRDKL------VNIDFEIPYCTCSGLKVEYLKVEEPQL 583

Query: 456 QYKSYPWVRYITQSGDDYT 474
           QY+S+PWVRY T S ++Y 
Sbjct: 584 QYQSFPWVRYKTVSDEEYA 602

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 73/142 (51%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S+++  D + +PL+S+  R      A+    ++LS  ++   +  PP L+ N   ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFT---FLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           ++ + L+ V              T   FL +   +L  Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYI 136

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 95/376 (25%), Positives = 154/376 (40%), Gaps = 115/376 (30%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FL+++E +   M     V++  +I G+++    LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                                        V+ DK+                 L + KFHQ
Sbjct: 313 KI---------------------------VNEDKQF----------------LANCKFHQ 329

Query: 283 CVRLSKFE--NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWCDVNVQVH---------S 329
           CV L+  E  + K + F+PPDG+F L  Y L   ++  P++   VN +V           
Sbjct: 330 CVSLASLESSDHKDVEFVPPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKL 388

Query: 330 NSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKS 381
              IE H       K  +  + + + +P+         D +     K   G++ +     
Sbjct: 389 LLTIETH------FKTTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDD 442

Query: 382 AILWKLRSFPGGK---EYSMSAELGL-------------------PSISNG--------- 410
            +LW++ S  GG    + SM  E  L                   P +  G         
Sbjct: 443 FLLWEVGSMSGGHGETQLSMGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQ 502

Query: 411 -NDGSKTIPKNNAEILKGPVQ-----------IKFQIPYFTTSGIQVRYLKINEPKLQYK 458
            ++       N   + +  +Q           + F++PY T+SG++V YLKI EP+L+Y+
Sbjct: 503 IHEDDDDDDGNTEPVAEHRLQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQ 562

Query: 459 SYPWVRYITQSGDDYT 474
           S+PWVRY T S  +Y 
Sbjct: 563 SFPWVRYTTLSDAEYA 578

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 66/139 (47%), Gaps = 8/139 (5%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLS-AIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M+S +Y  D + + L+S+  +    L   I +F  L       SN  P    H+   + +
Sbjct: 1   MSSVLYILDENLETLISKNIKAVPSLEYPIAQFKKLYG-----SNAPPVIDYHDLFTFTY 55

Query: 60  IQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELLDE 117
           IQ + L  V               +L    EVL +YL  K +++  + DN V+I EL++E
Sbjct: 56  IQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIEE 115

Query: 118 VMDYGIPQITETKMLKQYI 136
            +D+G  Q+T++ +L  YI
Sbjct: 116 TIDFGAIQVTDSGLLADYI 134

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  110 bits (276), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 104/386 (26%), Positives = 160/386 (41%), Gaps = 119/386 (30%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                 K L+                       + P   S+S              KFHQ
Sbjct: 312 ------KLLN-----------------------RDPQFMSNS--------------KFHQ 328

Query: 283 CVRLSKFE------------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLI--- 319
           CV L                      + K I FIPPDG+F L  Y L   +K  P+I   
Sbjct: 329 CVSLDSINIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQ 388

Query: 320 WCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSH 371
             ++  ++    +I+I  K +   K  ++ + + + IP+         D +    FK + 
Sbjct: 389 GFEIKPKL-KKFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANL 447

Query: 372 GSLKYVPEKSAILWKLRSFPGGKE---------------YSMSAELGL------------ 404
           G + +      +LW++ +  G +E                SM AE  L            
Sbjct: 448 GKVVFNLSDDFLLWEIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEE 507

Query: 405 -------PSISNGNDGSKTIPKNNAEIL-----KGP----VQIKFQIPYFTTSGIQVRYL 448
                  P +  G    +   + + E +       P    V + F+IPY T SG++V YL
Sbjct: 508 LKTSMNPPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYL 567

Query: 449 KINEPKLQYKSYPWVRYITQSGDDYT 474
           K+ EP+LQY+S+PWVRY T S D+Y 
Sbjct: 568 KVEEPQLQYQSFPWVRYKTISDDEYA 593

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNL-IPPCLNHNGLEYLF 59
           M+S+++  D D +PL+S+  R      AI    ++LS  ++  +   PP L+ NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYLVXXXXXXXX---XXXXXFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYEL 114
           ++ + L+ +                  FL +   +L  Y +   + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYI 136

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score = 99.4 bits (246), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 116/503 (23%), Positives = 217/503 (43%), Gaps = 101/503 (20%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M SA+      G+ ++S+ YR++I  S  + F   + +     N+  P L      +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVIN---NFNVRSPILTLGSTTFHHI 57

Query: 61  QH-------NDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYE 113
           +        ++L+LV             + FL KL  +L  Y  T  E  ++D F+ ++E
Sbjct: 58  RSTANDPTDDELWLVCVNRNNANSAAI-WEFLQKLNLILQQYGIT-SESKLKDEFMTVHE 115

Query: 114 LLDE-VMDYGIPQITETKMLKQYI-------TQXXXXXXXXXXXXRNA--TRPPVALTNS 163
           +LD  ++  GI Q T+ K +   +       T             RN   T P    +  
Sbjct: 116 ILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLI 175

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIND 223
            + R +  +HKKNE F  + ES+N+L+++ G +L++ + G +++ S L+G P  +     
Sbjct: 176 PTNRHD--AHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQF---- 229

Query: 224 KGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQC 283
                + +DD +                                      ++ D KF QC
Sbjct: 230 -----ELVDDQT--------------------------------------KITDFKFDQC 246

Query: 284 VRLSKFENEKIITFIPPDGKFDLMNYRLST-------TIKPLIWCDVNVQVHSNSRIEIH 336
           +   +    + +     DG+ +++NY +          I P++     V+   + RI + 
Sbjct: 247 IEKVQ---SRTVRVAATDGELEIVNYHVRDDKINIPFKITPIV---STVKDTVDYRISL- 299

Query: 337 CKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEY 396
              K+   +  +AT+V + IPVP +        S+G  K+  E++A++W    F G  E 
Sbjct: 300 ---KSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTEN 356

Query: 397 SMSAELGLPSISNGNDGSKTIPKNNAEILKGP-VQIKFQIPYFTTSGIQVRYLKINEP-K 454
           ++SA     +I+   DG + +   N E    P +Q+ F+I  ++ SG+ +R L I +  K
Sbjct: 357 TLSA----ITIA---DGRQIM---NLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDK 406

Query: 455 LQYKSYPWVRYITQSGDDYTIRL 477
            +YK+  W++YI+++G  Y +R 
Sbjct: 407 RRYKASRWIKYISRAG-SYEMRF 428

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 82.4 bits (202), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 111/258 (43%), Gaps = 62/258 (24%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E    +M  K  ++R  +I G +     LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                 K L                                           L  L+FHQ
Sbjct: 347 ------KLLQKDQQF-------------------------------------LSQLRFHQ 363

Query: 283 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHC 337
           CV L   +N++I  FIPPDG+F L  Y L   +K      LI  ++  ++    +I+I+ 
Sbjct: 364 CVSLETIQNKEI-EFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKLKK-FKIQINL 421

Query: 338 KAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLRS 389
                 K +++ + + + IP+         D   +P FK + G +K+      +LW++ S
Sbjct: 422 SITTFFKVQNSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGS 481

Query: 390 FPGGKE---YSMSAELGL 404
             GG      +M+AE  L
Sbjct: 482 MKGGHGENIKAMTAEFFL 499

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 7/92 (7%)

Query: 389 SFPGGKEYSMSAELGLPS----ISNGNDGSKTIPKNNAEILKGP--VQIKFQIPYFTTSG 442
           S P     +  A +  P+    + N    +K IP   A +   P  + + F+IPY+  SG
Sbjct: 564 SIPSTGTTNAGANIATPASTSVVKNDTSSNKEIPLKKA-LSNKPQYLTVDFEIPYYACSG 622

Query: 443 IQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
           ++V YLKI E +L Y+S+PWVRY T +  DY 
Sbjct: 623 LKVEYLKIEEEQLLYQSFPWVRYKTTNDKDYV 654

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 67/143 (46%), Gaps = 13/143 (9%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIP---PCLNHNGLEY 57
           M S ++  D + +PL+S+  R      AI  F +++    +  +      P ++ N   +
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDLYLVXXXXXX--XXXXXXXFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYE 113
           + I+ + L  +                 +L K   +L  +LKT  +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEVMDYGIPQITETKMLKQYI 136
           L+DE +D+GI Q+T+  ++K Y+
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYV 137

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 113/265 (42%), Gaps = 50/265 (18%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +   M  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFSKYLDDSSNLPPAA--------STTTSDNKTDVDTDKKPSITSSSTASKRKVNIE 274
                 K L + S     A         +    +  D D D   ++  +    +R     
Sbjct: 355 ------KILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNENENHDER----- 403

Query: 275 LEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLI---WCDVNVQVHS 329
                          + +K I FIPPDG F L  Y L   +K  P+I     D+  ++ S
Sbjct: 404 ---------------DRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-S 447

Query: 330 NSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKS 381
             +++IH   +   K  +  + + + IP+         D +    FK   G + +    +
Sbjct: 448 KYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDN 507

Query: 382 AILWKLRSFPGGK-EYSMSAELGLP 405
            ++W++ S  GG  E +MS     P
Sbjct: 508 FLIWEIGSMKGGHGEVTMSMMAEFP 532

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 38/46 (82%)

Query: 429 VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 474
           ++I F+IPY+T SG+++ YLKI EP+LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 76/165 (46%), Gaps = 34/165 (20%)

Query: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLE---EQSNLIP--------PC 49
           M+S ++  D + +P+L++  R     S  + F  LL   E   +Q N I         P 
Sbjct: 1   MSSCIFILDENLEPILNKNIR-----SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLPI 55

Query: 50  LNHN---------------GLEYLFIQHNDLYLVXXXXXXXXXXXXX-FTFLHKLVEVLS 93
           LN N               G ++L I+ + L  V              F++L +  ++L 
Sbjct: 56  LNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLK 115

Query: 94  DYLKT--VEEESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYI 136
            YL    +++  + DNF+++ ELLDE +D+GI Q T++ ++K YI
Sbjct: 116 SYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYI 160

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 67/166 (40%), Gaps = 63/166 (37%)

Query: 163 SVSWRPEGISHKKNEAFLDIVESINMLMTQKGQ----------VLRSEIIGDVKVNSKLS 212
           +V WR   + H  NE +LD+VESI++++  K +          ++   IIG   V S L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVN 272
           G P +++ I+  G                                               
Sbjct: 261 GNPIVEMKIDMAG----------------------------------------------- 273

Query: 273 IELEDLKFHQCVRL------SKFENEKIITFIPPDGKFDLMNYRLS 312
            +LE +  H+CV+        +FEN K+I F+PPDG F L +Y ++
Sbjct: 274 NDLESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 142/333 (42%), Gaps = 72/333 (21%)

Query: 162 NSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMP--DLKL 219
           + V WR  GI++  NE F+D+ E IN ++ +KG++L   I G + +N+ LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLK 279
           G+ D  +              +   T+ ++  ++ DK  SI             +L   K
Sbjct: 267 GLLDHKL--------------SHLNTTFHRCILE-DKANSIN------------DLIAGK 299

Query: 280 FHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKP--LIWCDVNVQVHSNSRIEIHC 337
           F +            +TF+PPDG+  L  Y L    +   L   DVN+Q     R++   
Sbjct: 300 FTK------------LTFVPPDGRTRLCQYTLPLVKRDSNLGIIDVNLQSSLGKRLD-EF 346

Query: 338 KAKAQIKRKSTATNVE-----ILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKL-RSFP 391
           + +  +   +T   +E     I +           + +HG ++    +  + W L ++  
Sbjct: 347 EVRVTVGMSTTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMTRGEVNWHLDKNMV 406

Query: 392 GGKEYSMS--AELGLPSISNGNDGSKTI----PKNNAEILKGPVQIKF------QIPYFT 439
            G    +   AEL     SN    S++     P ++   L  P  IK       Q+P   
Sbjct: 407 CGSMAVLRCIAELEPELASNDQTSSRSSVVQPPSSHLTSLLQPSFIKCYYEHKSQLP--- 463

Query: 440 TSGIQVRYLKI--NEPKLQYKSYPWVRYITQSG 470
            SGI+++ + +    PK   K +  V+Y+T++G
Sbjct: 464 -SGIKLQSIDVVNGGPK---KPFKGVKYLTKTG 492

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 75/183 (40%), Gaps = 58/183 (31%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLM------TQKGQVLRSEIIGDVKVNSKLSGMPDL 217
           V WR + I   +NE ++D+ E++ + +      + + ++L   I G V V+S + G+P L
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPML 232

Query: 218 KLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELED 277
           ++             D  ++ P                                      
Sbjct: 233 EVSFGGC--------DFKDIIP-------------------------------------- 246

Query: 278 LKFHQCVRLSKF--ENEKIITFIPPDGKFDLMNYR--LSTTIKPLIWCD-VNVQVHSNSR 332
            KFH CV +++F   +  II FIPPDGKF LM Y   LS+    LI C+  N   +SN  
Sbjct: 247 -KFHDCVEVNEFLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDE 305

Query: 333 IEI 335
            EI
Sbjct: 306 FEI 308

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 62/164 (37%), Gaps = 67/164 (40%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLR----------SEIIGDVKVNSKLSG 213
           V WR  G+ +  NE ++D+ ESI+++  + G+  R            I G   V   LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MP--DLKLGI--NDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKR 269
            P  DL+L +  ND G+            PA                             
Sbjct: 271 NPTVDLQLDLAGNDLGV------------PA----------------------------- 289

Query: 270 KVNIELEDLKFHQCVRLSKFENEKI--ITFIPPDGKFDLMNYRL 311
                     FH+CV L   +N     + FIPPDG+F+LM Y +
Sbjct: 290 ----------FHECVELDNHQNPSNCDLRFIPPDGRFNLMQYSI 323

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 59/157 (37%), Gaps = 51/157 (32%)

Query: 158 VALTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQ---VLRSEIIGDVKVNSKLSGM 214
           V    +V WR     +  NE ++D+VE++N  + QKG    ++   + G + V   LSG 
Sbjct: 134 VEAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGN 193

Query: 215 PDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIE 274
           P ++L +   G     LD+S+                                       
Sbjct: 194 PTVQLKLRTSG---HPLDNSA--------------------------------------- 211

Query: 275 LEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL 311
                 H+CV L +      + F+PPDG+F L  Y +
Sbjct: 212 -----LHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 73/170 (42%), Gaps = 53/170 (31%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKG------------------QVLRSEIIGDV 205
           V WR   + +  NE ++D++E I+++  ++                   +++R++IIG++
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSST 265
            V S LS  P +++ + D+                     SD KT            S  
Sbjct: 316 NVRSYLSDNPMVEVTLVDR-------------------NYSDQKTGW----------SEN 346

Query: 266 ASKRKVNIELEDLKFHQCVRL--SKFENEKI--ITFIPPDGKFDLMNYRL 311
              +++N+ L    FH CV +   K  N+    I FIPPDGKF LM Y +
Sbjct: 347 DLFKQLNLGLP--MFHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 62/163 (38%), Gaps = 52/163 (31%)

Query: 154 TRPPVALTNSVSWRPEGISHKKNEAFLDIVESINMLMTQK---GQV--LRSEIIGDVKVN 208
            + P A    V WR  G+ +  NE ++D+VE++++++ +    G++  +R  + G V   
Sbjct: 176 AKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFR 235

Query: 209 SKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASK 268
           S LSG P + L +  +G                                           
Sbjct: 236 SHLSGNPVIALNLRLRG------------------------------------------- 252

Query: 269 RKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL 311
                +L     HQC   S       + F+PPDGKF LM+Y +
Sbjct: 253 ----HDLGMPALHQCCLDSYQGRPDQLRFVPPDGKFQLMHYSI 291

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 90/262 (34%), Gaps = 79/262 (30%)

Query: 82  FTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYELLDEVMDYGIPQITETKMLKQY---- 135
           F FL  +  +L+ Y     ++   I  N+  +  L + ++D G P IT+   LK+     
Sbjct: 96  FVFLQTVDTILNQYFGKDVLKASKITKNYDRVTLLFNSMVDAGEPDITDLNRLKEIVPLK 155

Query: 136 -----------------ITQXXXXXXXXXXXXRNATRPPVALTN---SVSWRPEGISHKK 175
                            I+              +     V+  N   +V WR  G+ +  
Sbjct: 156 NNFARVINSTASSIGKTISNAEGNQMFSKHSSNSRIGSSVSYANRDRTVPWRSAGVKYTN 215

Query: 176 NEAFLDIVESINMLMTQKGQV-----LRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKY 230
           NE ++D+ E++N+++ +         +   I G+V     LS  P ++L +N  G     
Sbjct: 216 NELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVELDLNTNG----- 270

Query: 231 LDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFE 290
                                                      +L    FH+CVR    +
Sbjct: 271 ------------------------------------------HDLGIPAFHRCVRTEGSD 288

Query: 291 -NEKIITFIPPDGKFDLMNYRL 311
            +   + FIPPDG F LM Y +
Sbjct: 289 FHPGTLRFIPPDGDFCLMEYNI 310

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 67/157 (42%), Gaps = 47/157 (29%)

Query: 166 WRPEGISHKKNEAFLDIVESINMLMTQK----GQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           WR + + H  NE ++D+VES++++   K     ++ RS+      VN  L G   ++  +
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 222 NDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFH 281
           N   +    L+ S N              D+     PS                    FH
Sbjct: 263 NGNPLVELQLELSGN--------------DIG---HPS--------------------FH 285

Query: 282 QCVRLSKF----ENEKI--ITFIPPDGKFDLMNYRLS 312
           +CV + ++    +N  I  + FIPPDGKF LM+Y ++
Sbjct: 286 ECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 52/153 (33%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLM--TQK-GQV--LRSEIIGDVKVNSKLSGMPDLK 218
           V WR  G+ +  NE ++D+VE+I++++  T+K GQ+  +R  I G V   S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDL 278
           L +N  G                                                +L   
Sbjct: 246 LKLNLHG-----------------------------------------------HDLGVP 258

Query: 279 KFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL 311
             H C +     + + + F+PPDGKF LM Y +
Sbjct: 259 ALHPCCQAQYTGSPENLQFVPPDGKFRLMQYTI 291

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 88/219 (40%), Gaps = 40/219 (18%)

Query: 280 FHQCVRLS-------------KFENEKIITFIPPDGKFDLMNYRL----STTIKPLIWCD 322
           FH CV                 F+ ++++ F+PPDGKF L  Y +       +   +  D
Sbjct: 273 FHACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRD 332

Query: 323 VNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD-----------DADTPTFKYSH 371
             +QV     + ++ K + ++ R     ++ ++ PV D           D++    + +H
Sbjct: 333 GLIQVSFEDGLGLN-KDEFEV-RLHVRESIAVVDPVEDLVVTLQFSNGNDSNVKMLRATH 390

Query: 372 GSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQI 431
           G+     E     W+  S     E S      LP +    D SK + +     L   V +
Sbjct: 391 GTFVGQDEDRQCSWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLT-SVAV 442

Query: 432 KFQIPYFTTSGIQVRYLKIN--EPKLQYKSYPWVRYITQ 468
           ++  P    SG +V  L ++   P+++ K +  VR +T+
Sbjct: 443 RYGYPGELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 67/153 (43%), Gaps = 49/153 (32%)

Query: 164 VSWRPEGIS-HKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           V WR    S H+ NE ++D++E+ ++++ +K   LR        VN  + G  D++  +N
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLR-------LVNGDICGAVDVRSYLN 251

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
           D  + S  L+            T  N+  +     PS+                    H+
Sbjct: 252 DNPLVSVKLN------------TMGNEIGI-----PSL--------------------HE 274

Query: 283 CVRLS---KFENEKIITFIPPDGKFDLMNYRLS 312
           CV ++   +F    I TFIPPDGKF L+ Y ++
Sbjct: 275 CVEINDDGEFTPSNI-TFIPPDGKFRLLEYSIN 306

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 61/161 (37%), Gaps = 53/161 (32%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLM-----TQKGQVLRSEIIGDVKVNSKLSGMPDLK 218
           V WR   + +  +E ++DI+E+++++          Q++   I G V V S LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDL 278
           + ++  G                                                E+   
Sbjct: 252 MDMDLAG-----------------------------------------------NEMYAP 264

Query: 279 KFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLI 319
             HQCV + +  +   + FIPPDG  +L+NY +   + P +
Sbjct: 265 SMHQCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNPKV 304

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 62/152 (40%), Gaps = 49/152 (32%)

Query: 164 VSWRPEGIS-HKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           V WR    S H+ NE ++D++E+ +++   K   LR        VN  + G  D++  +N
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLR-------LVNGNIHGTVDVRSYLN 251

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
           +  + S  L+            T  N   V T                          H+
Sbjct: 252 NNPLVSVKLN------------TMGNDIGVPT-------------------------LHE 274

Query: 283 CVRLSKFENEKI---ITFIPPDGKFDLMNYRL 311
           CV + K + E +   ITFIPPDGKF L+ Y +
Sbjct: 275 CVEI-KDDGEFLPSNITFIPPDGKFRLLEYSV 305

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 61/137 (44%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR++R+   D  L  +  F +L+++L  +   +      N + Y++ 
Sbjct: 5   AASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV----EGNHVRYVYR 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L+ L + +++ L + +E  I D+   I    DEV+ 
Sbjct: 61  PFDDYYIILITNRQSNIIEDLST-LNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVI 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +   +  +  Y+T
Sbjct: 120 MGYKENLSSTQVTTYLT 136

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD   D  +  +  F TL+++  +Q   +        + Y++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L+  V+ +   LK + EE + D+   I    DE++ 
Sbjct: 61  PFDDYYIILITNLHSNIIQDMDT-LNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +K ++ 
Sbjct: 120 MGYKENLSLTQIKTFLA 136

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 3/36 (8%)

Query: 280 FHQCV-RLSKFENEKI--ITFIPPDGKFDLMNYRLS 312
           FH CV + S  + EKI  ++FIPPDG+F LM Y ++
Sbjct: 314 FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 47/149 (31%)

Query: 164 VSWRPEGIS-HKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           V WR    S H+ NE +LD++E+ +++  +K   +R        VN  + G  D++    
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIR-------LVNGNIHGTLDVR---- 247

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
                  YL+D+  +    +T  +D          PS+                    H+
Sbjct: 248 ------SYLNDTPLVLVKLNTMGNDIGI-------PSL--------------------HE 274

Query: 283 CVRLS--KFENEKIITFIPPDGKFDLMNY 309
           CV ++     +   ITFIPPDGKF L+ Y
Sbjct: 275 CVEINDGGVFSPSNITFIPPDGKFRLLEY 303

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 56/161 (34%)

Query: 164 VSWRPEGIS-HKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           V WR    S H+ NE ++D++E+ +++  +K   LR        +   + G+ D++  +N
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLR-------LLTGSIHGIVDVRSYLN 251

Query: 223 DKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQ 282
           D  + +  L+   N              D+     PS+                    H 
Sbjct: 252 DNPLVAVKLNTMGN--------------DIGI---PSL--------------------HD 274

Query: 283 CVRLSKFENEKI-----ITFIPPDGKFDLMNYR--LSTTIK 316
           CV +    N+ +     ITFIPPDGKF L+ Y   LS+ +K
Sbjct: 275 CVEI----NDGVFSPSNITFIPPDGKFRLLEYSVDLSSQVK 311

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 78/203 (38%), Gaps = 15/203 (7%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++R+   +  +  +  F  L+S++          L    + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRYVYR 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++              T L+     ++ YL + +E  I DN   I    DE++ 
Sbjct: 61  PFDNYYIILITNRQSNIIQDLST-LNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVT 119

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
            G  +      ++ Y+              RN     +  T     R + I+ K+ E  L
Sbjct: 120 MGYKENLSISQVETYLAMESHEERIQEIIERNK---EIEATEERKRRAKEIARKEQERKL 176

Query: 181 DI----VESINMLMTQKGQVLRS 199
            I     E+ N++   + + + S
Sbjct: 177 GIYGGEFETANLVANSQNRFMAS 199

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPL+SR+++D   D  +  +  F  L+++   Q   +        + Y++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFV----EEEHVRYVYK 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L+   + ++ +LK   E+ I DN   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQSNIIQDMDT-LNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 56/153 (36%), Gaps = 52/153 (33%)

Query: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKG----QVLRSEIIGDVKVNSKLSGMPDLKL 219
           V WR   +S+  NE ++D+VE++ + + Q       V    I G + +   L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLK 279
            ++  G   K         P+A                                      
Sbjct: 255 NLHSAGHAFK---------PSA-------------------------------------- 267

Query: 280 FHQCVR-LSKFENEKIITFIPPDGKFDLMNYRL 311
            H+C+   S   +   + FIPPDGKF L+ Y +
Sbjct: 268 LHRCLDPSSSSFDSSSLRFIPPDGKFTLLEYTI 300

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 54/137 (39%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD   D     +  F  L++    Q   +        + Y++ 
Sbjct: 101 AVSIVTRQGKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRYVYK 156

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L    + ++ YL + +E  I +N   I    DEV+ 
Sbjct: 157 PFDDYYIILITNRQSNIIQDLDT-LKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVIT 215

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 216 MGYKENLSISQINTYLS 232

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 33.1 bits (74), Expect = 0.69,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 53  NGLEY-----LFIQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDN 107
           N LEY     ++ ++  LY +                +H+ VE +  Y   V E  I  N
Sbjct: 50  NILEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFN 109

Query: 108 FVIIYELLDEVM--DYGIPQITETKMLKQYIT 137
           F   YE+L+EV+  D  + + ++  +L+  +T
Sbjct: 110 FTKAYEILNEVLVCDGSMTETSKQAILRSVMT 141

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD   D  +  +  F  L++    +   +        + Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRYIYI 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L+   + ++  LK   EE + ++   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQSNIIQDMDT-LNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 76/194 (39%), Gaps = 12/194 (6%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++R+   D  +  +  F  L+S +      +        + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L+   + ++ YL + +E  + DN   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQSNIIQDLST-LNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVV 119

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGISHKKNEAFL 180
            G  +      +  Y++             RN     +  T     R + I+ +++E   
Sbjct: 120 MGYKENLTAAQVSTYLSMESHEERIQEIIERN---KELEATEERKRRAKEIARREHERKA 176

Query: 181 DIVES-INMLMTQK 193
            I  S +N+ +T K
Sbjct: 177 GIYPSEVNVPLTNK 190

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 64/159 (40%), Gaps = 43/159 (27%)

Query: 164 VSWRPEGISHKKNEAFLDIVESI-----NMLMTQKGQVLRSEIIGDVKVN--SKLSGMPD 216
           V WR   I + KNE ++D+ E I     N +  +KG+   +     ++VN  S +  M  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 217 LKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELE 276
              G+ D      YL+ +  +    +T  +D  T       PS+                
Sbjct: 319 YITGVID---VRSYLNGNPIVEMKLNTCGNDMGT-------PSL---------------- 352

Query: 277 DLKFHQCVRLS---KFENEKI---ITFIPPDGKFDLMNY 309
               H CV L      +++K+   + FIPPDGKF L  Y
Sbjct: 353 ----HPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 272 NIELEDLKFHQCVRLSKF----ENEKIITFIPPDGKFDLMNYRLS 312
             +L     H CV L        +   + FIPPDGKF LM Y ++
Sbjct: 279 GCDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 57/139 (41%), Gaps = 12/139 (8%)

Query: 4   AVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLE-----YL 58
           AV      GKPLLSR++R+     + D+   LLS+   Q  +      H  +E     Y+
Sbjct: 5   AVSIVTRQGKPLLSRQFRE----ISKDRVTELLSNF--QGLVAKSSSQHTFVEDEHVRYV 58

Query: 59  FIQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           +   +D Y++              T L    + ++ YL + +E  I +N   I    DEV
Sbjct: 59  YKPFDDYYIILITNRQSNIIQDLDT-LKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEV 117

Query: 119 MDYGIPQITETKMLKQYIT 137
           +  G  +      +  Y++
Sbjct: 118 ITMGYKENLSMTQINTYLS 136

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 57/137 (41%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR++R+   D  L  +  F +L++++      +        + Y++ 
Sbjct: 5   AASITTRTGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFV----EDEHVRYVYR 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQSNIIMDLST-LNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVV 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLSITQVNTYLS 136

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L+S++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFV----EDKHVRYVYR 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++              T L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 61  PFDNYYIILITNRQSNIIKDLAT-LNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly
           similar to uniprot|Q00381 Saccharomyces cerevisiae
           YJR058C APS2 Small subunit of the clathrin- associated
           adaptor complex AP-2 which is involved in protein
           sorting at the plasma membrane related to the sigma
           subunit of the mammalian plasma membrane clathrin-
           associated protein (AP-2) complex
          Length = 148

 Score = 31.6 bits (70), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 26/54 (48%)

Query: 85  LHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYITQ 138
           +H  VEVL  +   V E  I  NF   Y ++DE+   G  Q T  K L + I Q
Sbjct: 90  IHLFVEVLDSFFGNVCELDILFNFYKTYLVMDEMFIAGEIQTTSKKELLERIGQ 143

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD   D     +  F  L+++   Q   +        + Y++ 
Sbjct: 5   AVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVANSSSQHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++              T L+   + ++  L++ +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQSNIIQDLDT-LNLFSQTVNSSLRSFDENEIFENAFEILGSFDEIIA 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 58/159 (36%), Gaps = 8/159 (5%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++ D   D  +  +  F  L++    +   +        + YL+ 
Sbjct: 5   AASITTRNGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYK 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D YL+              T L    + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLIIITNRQSNIIQDLST-LSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIV 119

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVA 159
            G  +      ++ Y+T             RN      A
Sbjct: 120 MGYKENLTMAQVETYLTMESHEERIQEIIERNKESEATA 158

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 6/104 (5%)

Query: 33  PTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVL 92
            T+LS   +  N+    L +N  + ++ ++  LY V                +H+ VE +
Sbjct: 39  ATILSRKPKMCNI----LEYNDHKVVYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETM 94

Query: 93  SDYLKTVEEESIRDNFVIIYELLDEVM--DYGIPQITETKMLKQ 134
             Y   V E  I  NF   Y +LDEV+  D  I + ++ ++LK 
Sbjct: 95  DRYFGNVCELDIIFNFNKAYSILDEVLICDGSITETSKKEVLKH 138

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L+S++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYR 60

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++              T L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 61  PFDNYYIILITNRQSNIIKDLAT-LNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>AGL161C Chr7 complement(394886..397198) [2313 bp, 770 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR144C
           (ACF2)
          Length = 770

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 200 EIIGDVKVNSKLSGMPDLKLGINDKGI--FSKYLDDSSNLPPA-----ASTTTSDNKTDV 252
           ++ G V  NSKL+G+ DL +GI    +  +  YLDD+  +P A      S    DNK D 
Sbjct: 613 KLWGQVTNNSKLAGIGDLMIGILRTSLNHYFLYLDDNRTMPAAFIKNKVSGILFDNKVDH 672

Query: 253 DT 254
            T
Sbjct: 673 AT 674

>CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170c APS1 Clathrin coat assembly protein AP19
          Length = 156

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 51/115 (44%), Gaps = 14/115 (12%)

Query: 12  GKPLLSRRYRDDIPLSAIDKF-------PTLLSDLEEQSNLIPPCLNHNGLEYLFIQHND 64
           GK  LS+ Y    PLS  +K        PT+L+   +  N+    L ++  + +F ++  
Sbjct: 14  GKVRLSKWYA---PLSTKEKAKIIKDLTPTILARKPKMCNI----LEYSDHKVVFRRYAS 66

Query: 65  LYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           LY +                +H+ VE +  Y + V E  I  NF   Y++LDE++
Sbjct: 67  LYFICGITIGHDNELLTLELIHRYVETMDTYFENVCELDIIFNFHKAYDILDELV 121

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHDGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L++++      +        + Y++ 
Sbjct: 58  AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFV----EDKHVRYVYR 113

Query: 61  QHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++              T L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 114 PFDNYYIILITNRQSNIIKDLST-LNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 172

Query: 121 YG 122
            G
Sbjct: 173 MG 174

>Kwal_14.2607 s14 complement(831030..831500) [471 bp, 156 aa] {ON}
           YLR170C (APS1) - clathrin-associated protein complex,
           small subunit [contig 224] FULL
          Length = 156

 Score = 30.8 bits (68), Expect = 4.8,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 4/86 (4%)

Query: 34  TLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLS 93
           T+L+   + SN+    L +   + ++ ++  LY +                +H+ VE + 
Sbjct: 40  TVLARKAKMSNI----LEYQDHKVVYKRYASLYFICGISPDVDNELLTLEVIHRYVEAMD 95

Query: 94  DYLKTVEEESIRDNFVIIYELLDEVM 119
            Y   V E  I  NF   YE+L+EV+
Sbjct: 96  SYFNNVCELDIIFNFNKAYEILNEVL 121

>YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}
           APS1Small subunit of the clathrin-associated adaptor
           complex AP-1, which is involved in protein sorting at
           the trans-Golgi network; homolog of the sigma subunit of
           the mammalian clathrin AP-1 complex
          Length = 156

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 30  DKFPTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVXXXXXXXXXXXXXFTFLHKLV 89
           D  PT+L+   +  N+I     +N  + ++ ++  LY +                +H+ V
Sbjct: 36  DLTPTILARKPKMCNIIE----YNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFV 91

Query: 90  EVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           E +  Y   V E  I  NF  +Y++L+E++
Sbjct: 92  ETMDTYFGNVCELDIIFNFSKVYDILNEMI 121

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 48/114 (42%), Gaps = 8/114 (7%)

Query: 12  GKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLV 68
           GKPLLSR++RD   D  +  +  F  L++++      +        + Y++   +D Y++
Sbjct: 13  GKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFV----EDEHVRYVYKPFDDYYII 68

Query: 69  XXXXXXXXXXXXXFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYG 122
                         T L+   + ++  L   +E  I DN   I    DE++  G
Sbjct: 69  LITNRQSNIVQDLST-LNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVVMG 121

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 12/102 (11%)

Query: 44  NLIPPCLNH-----NGLEY-----LFIQHNDLYLVXXXXXXXXXXXXXFTFLHKLVEVLS 93
           NL+P  L+      N LEY      + ++  LY +                +HK VE + 
Sbjct: 36  NLVPLILSRKAKMCNILEYSDHKVAYRRYASLYFICGITPDVDNELLTLEIIHKYVETMD 95

Query: 94  DYLKTVEEESIRDNFVIIYELLDEVM--DYGIPQITETKMLK 133
            Y   V E  I  NF   Y++L+E++  D  + + ++T +LK
Sbjct: 96  QYFGNVCELDIIYNFTKAYDILNEMIMCDGSLAETSKTVVLK 137

>TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa]
           {ON} Anc_5.21 YMR300C
          Length = 511

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 331 SRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFK 368
           +RIE+  K    IK K +   ++++IPVPD A T   +
Sbjct: 281 TRIEMGTKLAENIKSKMSPDEIDVVIPVPDTARTCALQ 318

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,222,587
Number of extensions: 2276198
Number of successful extensions: 9875
Number of sequences better than 10.0: 140
Number of HSP's gapped: 10045
Number of HSP's successfully gapped: 207
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)