Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.447.125ON54951827290.0
YPL260W7.125ON55151825200.0
Smik_6.4677.125ON54851825110.0
Skud_16.187.125ON55051824950.0
NCAS0E021307.125ON52651320830.0
NDAI0E036707.125ON52250919380.0
TDEL0H028707.125ON58752219260.0
CAGL0H09108g7.125ON53251019060.0
SAKL0F05390g7.125ON59551719030.0
KNAG0L009407.125ON54952618610.0
KLLA0D14355g7.125ON58850918400.0
ZYRO0C05192g7.125ON58852618380.0
KLTH0F12540g7.125ON59551018090.0
Kwal_55.208327.125ON57551517660.0
TBLA0A009307.125ON58651417220.0
Ecym_83527.125ON57951817160.0
KAFR0L004607.125ON51150516460.0
Kpol_322.77.125ON53449716010.0
TPHA0C016107.125ON55151215560.0
ADL019W7.125ON52547014110.0
Kpol_1062.587.125ON4914434691e-51
TPHA0F026206.70ON91899790.56
ADR279C2.362ON81796790.63
TBLA0H03030singletonON22935750.87
YLR457C (NBP1)7.531ON31994741.6
NCAS0B058602.362ON84680751.9
AFR429C1.524ON258103732.1
SAKL0B02288g8.68ON1228117742.4
TBLA0A00250singletonON49435732.7
Smik_15.893.149ON45184732.7
TBLA0E043708.254ON67647732.8
TBLA0B05400singletonON181835733.3
Skud_4.8061.19ON38584713.8
KNAG0D037004.81ON208124704.0
SAKL0E05720g2.362ON86997714.8
KAFR0G032004.238ON1869157715.2
Ecym_83564.39ON1811124715.3
KLLA0A04884g4.105ON105984698.2
Suva_11.3315.702ON189868698.2
KLLA0C13926g2.205ON78495698.6
NCAS0B029708.409ON154122668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.44
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...  1055   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   975   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   971   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   965   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   806   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   751   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   746   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   738   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   737   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   721   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   713   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   712   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   701   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   684   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   667   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   665   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   638   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   621   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   603   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   548   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   185   1e-51
TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {O...    35   0.56 
ADR279C Chr4 complement(1177905..1180358) [2454 bp, 817 aa] {ON}...    35   0.63 
TBLA0H03030 Chr8 (741174..741863) [690 bp, 229 aa] {ON}                33   0.87 
YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}...    33   1.6  
NCAS0B05860 Chr2 complement(1112137..1114677) [2541 bp, 846 aa] ...    33   1.9  
AFR429C Chr6 complement(1208115..1208891) [777 bp, 258 aa] {ON} ...    33   2.1  
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    33   2.4  
TBLA0A00250 Chr1 complement(35814..37298) [1485 bp, 494 aa] {ON}...    33   2.7  
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    33   2.7  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...    33   2.8  
TBLA0B05400 Chr2 (1268360..1269490,1269492..1273817) [5457 bp, 1...    33   3.3  
Skud_4.806 Chr4 complement(1419440..1420597) [1158 bp, 385 aa] {...    32   3.8  
KNAG0D03700 Chr4 complement(673981..674607) [627 bp, 208 aa] {ON...    32   4.0  
SAKL0E05720g Chr5 complement(468851..471460) [2610 bp, 869 aa] {...    32   4.8  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    32   5.2  
Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar ...    32   5.3  
KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} simil...    31   8.2  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    31   8.2  
KLLA0C13926g Chr3 (1195709..1198063) [2355 bp, 784 aa] {ON} simi...    31   8.6  
NCAS0B02970 Chr2 complement(513418..513882) [465 bp, 154 aa] {ON...    30   8.8  

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score = 1055 bits (2729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/518 (100%), Positives = 518/518 (100%)

Query: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120
           LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNERN 180
           STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNERN
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNERN 180

Query: 181 KNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTM 240
           KNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTM
Sbjct: 181 KNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTM 240

Query: 241 SQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKF 300
           SQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKF
Sbjct: 241 SQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKF 300

Query: 301 KSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLEN 360
           KSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLEN
Sbjct: 301 KSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLEN 360

Query: 361 LMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKL 420
           LMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKL
Sbjct: 361 LMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKL 420

Query: 421 LESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFY 480
           LESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFY
Sbjct: 421 LESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFY 480

Query: 481 DSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQNT 518
           DSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQNT
Sbjct: 481 DSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQNT 518

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/518 (91%), Positives = 501/518 (96%), Gaps = 1/518 (0%)

Query: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MF+SAGQQHPQIVPKEEESILNYLLEVRS+LAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120
           LDDIRKNSH+TPAKSAATLIHSTELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVE-KNTGPNYDEDGNDDQLREIDNER 179
           STVESLLEHLNESNVFTHHDLSPIKERLEEI KIVE KN+ P YDEDGNDD+LREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180

Query: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239
            KN+IEEDLLLRAKLKHCKDEYD LE KLEEIDPSLSTVMEKLF+IRRGLLSLVASAKKT
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240

Query: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299
           MS+S++N +SLLQ+ NDL+TNN  L DDKHLVSQEYV+EKL+ LKNEL+ELESNRD+SGK
Sbjct: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300

Query: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359
           FKSLESH+VAE GQSVLNGLLDDCHDLVNDLSHQ NGGLTLDP LQPIYEQLIDIKTTLE
Sbjct: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419
           NLMITRRWTLRETDLFSYQKKLNEID+KR+ GKFPTK+QDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479
           LLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQN 517
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEE+AQN
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQN 518

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/518 (91%), Positives = 503/518 (97%), Gaps = 1/518 (0%)

Query: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MF+SAGQQHPQIVPKEEESILNYLLEVRS+LAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120
           LDDIRKNSH+TPAKSAATLIH+TELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVE-KNTGPNYDEDGNDDQLREIDNER 179
           STVESLLEHLNESNVFTHHDLSPIKERL+EI KIVE KN+   Y+EDGNDD+LREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180

Query: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239
            KN+IEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLS+VMEKLF+IRRGLLSLVASAKKT
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKKT 240

Query: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299
           MS+S+ NI+SLL++ ND + NNN LMDDKHLVSQEYV+EKL+ LK+ELNELESNRD+SGK
Sbjct: 241 MSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300

Query: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359
           FKSLE+H+VA NGQSVLNGLLDDCHDL+NDLSHQTNGGL+LDP LQPIYEQLIDIKTTLE
Sbjct: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419
           NLMITRRWTLRETDLFSYQKKLNEID+KR+ GKFPTK+QDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479
           LLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQN 517
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEERAQN
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQN 518

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/518 (91%), Positives = 500/518 (96%), Gaps = 2/518 (0%)

Query: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MFSSAGQ HPQIVPKEEESILNYLLEVRS+LAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFSSAGQ-HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 59

Query: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120
           LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASL
Sbjct: 60  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVE-KNTGPNYDEDGNDDQLREIDNER 179
           STVESLLEHLNESNVFTHHDLSPIKERL+EI KIVE KN+ P Y+ED ND ++REIDNER
Sbjct: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNER 179

Query: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239
            +N+IEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLF+IRRGLLSLVASAKKT
Sbjct: 180 KQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 239

Query: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299
           MS+S+ NI+SLLQ+HNDL+ N+NDLMDDKHLVSQEYV+EKL+ LKNEL+ELESNRD+SGK
Sbjct: 240 MSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 299

Query: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359
           FKSLE+H+V E GQSVLNGLLDDCHDL++DLSHQTNGGL LDP LQP YEQLIDIKTTLE
Sbjct: 300 FKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLE 359

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419
           NLMITRRWTLRETDLFSYQKKLNEIDSKR+ GKFPTK+QDSKGQSILLYLLRRCYAIIYK
Sbjct: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 419

Query: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479
           LLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 420 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIF 479

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQN 517
           YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERA N
Sbjct: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERALN 517

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/513 (78%), Positives = 450/513 (87%), Gaps = 17/513 (3%)

Query: 9   HPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ VPKEEE ILNYLL+VRS L+KLKQNRTQYLNSKDVQ TYQ+VLTKVRELD+IRKNS
Sbjct: 10  HPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEIRKNS 69

Query: 69  HDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLE 128
           HDTP+KSA TLIHS ELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 70  HDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 129

Query: 129 HLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQ---LREIDNERNKNRIE 185
           HL+ESN+FTHHDLSPIK+RL EI KIVEK+ G   DE  NDD+   L++ID ERNKN+IE
Sbjct: 130 HLSESNIFTHHDLSPIKDRLNEISKIVEKSCGKLPDEQLNDDEEQNLKDIDTERNKNKIE 189

Query: 186 EDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSNV 245
           +DLLLRAKL+HC DEY  +ESKLEEIDPSL++ MEKLF+IRRGLLSL AS KK M+Q + 
Sbjct: 190 QDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTKKNMNQGS- 248

Query: 246 NISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLES 305
                L    +LE        +KHLVSQEYVN+KL AL+ E+  LE+NRDESGKFKSLE+
Sbjct: 249 -----LTSEKELE--------NKHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSLET 295

Query: 306 HKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITR 365
           ++VAENGQ+VLNGLLDDC DL+NDLSHQTNG L LDPTLQPIYE LIDIKTTLENLMITR
Sbjct: 296 NEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMITR 355

Query: 366 RWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLESSE 425
           RWTLRETDLF+YQK+L EID+ RV+G+FPTK  DSKGQ ILLYLLRRCYAIIYKLLESSE
Sbjct: 356 RWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESSE 415

Query: 426 PVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGN 485
           PVSE+LQP+HNQLSTVRRCL+ELKRMGGV+N+RELYPYQMKLASLDNLR DG FYDS+GN
Sbjct: 416 PVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEGN 475

Query: 486 IPEGQGILNALLAECFDIMHELKVEAEERAQNT 518
           IPEGQG LNALLA CFDIMHELKVEAEER + +
Sbjct: 476 IPEGQGTLNALLAACFDIMHELKVEAEEREEQS 508

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/509 (73%), Positives = 432/509 (84%), Gaps = 23/509 (4%)

Query: 9   HPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ+VPKEEE IL YLL+VR+ L  LK+NRTQYLNS+ VQ TYQ VLTKVRELD+IRKN+
Sbjct: 14  HPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEIRKNN 73

Query: 69  HDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TP+ SA TLIHS ELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 74  HATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 133

Query: 129 HLNESNVFTHHDLSPIKERLEEIRKIVEKNTGP--NYDEDGNDD---QLREIDNERNKNR 183
           HLNESN+FTHHDL PIKERL++I KIVE++       D +G+D     L E + E+N+N+
Sbjct: 134 HLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETELEQNQNK 193

Query: 184 IEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQS 243
           IE+DLLLRAKL+HC DEY  +ESKLEEIDPSL++++EKLF+IRRGLLSLVASAKK     
Sbjct: 194 IEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAKKN---- 249

Query: 244 NVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSL 303
               S L QK           +D+KHL+S EY+N+KL  L+ E  +LESNRDE GKFKSL
Sbjct: 250 ----SLLSQKE----------LDEKHLISPEYLNKKLLELEKEFKDLESNRDEFGKFKSL 295

Query: 304 ESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMI 363
           E+ ++ ENGQ+VL GL DDC+DL+NDLSHQTNG LTLDP LQP+YEQLI+IKTTLE LMI
Sbjct: 296 ETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKLMI 355

Query: 364 TRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLES 423
           TRRWTLRETDLF+YQKKL EID+ RVKGKFP+K+ DSKGQ I+LYLLRRCYAIIYKLLE 
Sbjct: 356 TRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLLEC 415

Query: 424 SEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSD 483
           SEPVSE+LQP+HNQLSTVRRCLL++KR+GGV+NERELYPYQMKLASLDNLR DGIFYDSD
Sbjct: 416 SEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYDSD 475

Query: 484 GNIPEGQGILNALLAECFDIMHELKVEAE 512
           GNIPEGQG LNALLA CFDI+HE+KVEAE
Sbjct: 476 GNIPEGQGTLNALLAACFDIVHEMKVEAE 504

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/522 (72%), Positives = 437/522 (83%), Gaps = 31/522 (5%)

Query: 3   SSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 62
           +++  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD
Sbjct: 8   AASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELD 67

Query: 63  DIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLST 122
            IRK++HDTP+ SA TLIHSTELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASLST
Sbjct: 68  QIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127

Query: 123 VESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGN----DDQLREIDN- 177
           V+ LLEHLNESNVFT HDL PI+ERL EI KIVE ++  N     N    D++L E D  
Sbjct: 128 VQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRK 187

Query: 178 ---ERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVA 234
              ERNKN+IEEDLLLRAKL+HC DEY + ESK+EEIDP L+T+MEKLF+IRRGLLSL A
Sbjct: 188 FYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAA 247

Query: 235 SAKKTMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNR 294
           S+K+    SN ++                   +K  +SQE+V+E++  L+++L ELES+R
Sbjct: 248 SSKR----SNPSL-------------------EKSPLSQEHVHEQVEKLESQLTELESHR 284

Query: 295 DESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDI 354
           DE+GKFKSLE+ KV + GQ+VLNGLLDDCHDL++DLSHQ NGG+ LD  LQPIYEQLIDI
Sbjct: 285 DENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDI 344

Query: 355 KTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCY 414
           KT+LENL++TRRWTLRETDLF++QK+L+EIDS RV GKFPT +  SKGQSILLYLLRRC+
Sbjct: 345 KTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCF 404

Query: 415 AIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR 474
           AIIYKLLESSEPVSE+LQP+HNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+LR
Sbjct: 405 AIIYKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLR 464

Query: 475 TDGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQ 516
           TDG FYDSDGNIPEGQG LNALLAECFDI+HELK+EA+ERA+
Sbjct: 465 TDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAE 506

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/510 (72%), Positives = 422/510 (82%), Gaps = 17/510 (3%)

Query: 2   FSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 61
            S +G  HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65

Query: 62  DDIRKNSHDTPAK--SAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYAS 119
           D IRK+S D   +   A TLIH T++HNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYAS
Sbjct: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125

Query: 120 LSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNER 179
           LSTV+ LLEHL ESNVFTHHDL PIKERL+EI KIVEK+     +++    + +EID ER
Sbjct: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVA--EFKEIDTER 183

Query: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239
           NKNRIE+DLLL+AKL+HC DEY+ LESKLEEI P LS +ME+LFK+RRGLLSL AS+KK 
Sbjct: 184 NKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKN 243

Query: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299
           +   N    + L              D KH++SQEY++  L   K E+ ++E+ RDE+G+
Sbjct: 244 IPDENYKEPAKLD-------------DSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQ 290

Query: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359
           F S  + K  + GQ++LNGLLDDC+DL+NDLSHQTNGGLTLDP LQPIYE+LIDIKTTLE
Sbjct: 291 FVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLE 350

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419
           NLMITRRWTLRETDLF+YQK+L EID+ RV GKFPTK+ DSKGQSI+LYLLRRCYAIIYK
Sbjct: 351 NLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYK 410

Query: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479
           LLESSEPVSE+LQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR DG F
Sbjct: 411 LLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKF 470

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKV 509
           YDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 471 YDSDGNIPEGQGILNALLAGCFDILHELKV 500

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/517 (71%), Positives = 423/517 (81%), Gaps = 35/517 (6%)

Query: 9   HPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ VPKEEE ILNY L+VRS L+KLKQNR+Q+LNSKDV  TYQ VLTKVRELDD RK+S
Sbjct: 5   HPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTRKSS 64

Query: 69  HDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLE 128
           H+TPA SA TLIHS +LHNRVDSVLDDVFQL+SL FLTVGLKNSAPATYASLSTV+ LLE
Sbjct: 65  HNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 124

Query: 129 HLNESNVFTHHDLSPIKERLEEIRKIVEKNT-------------GPNYDEDGNDDQLREI 175
           HLNESNVFTHHDL PIKERL+E+ +IVEKN+              P   ED  D +L++ 
Sbjct: 125 HLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIELKKA 184

Query: 176 DNERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVAS 235
           D E++KN++EEDLLLRAKLKHC  EY  +ESKLEEIDP+L ++MEKLF+IRRGLLSL AS
Sbjct: 185 DIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLAAS 244

Query: 236 AKKTMSQSNVNISSLLQKHNDLETNNNDLMDDK---HLVSQEYVNEKLTALKNELNELES 292
            K+                      + + ++DK   H VS  +VN KL  L+ EL+ELES
Sbjct: 245 TKRN-------------------ARSKESLEDKKRTHTVSPNFVNSKLNELQVELSELES 285

Query: 293 NRDESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLI 352
           +RD SGKFKSLE+ KV E GQSVLNGLLDDCHDL+NDLSHQT+ G++LD  LQPIY+ LI
Sbjct: 286 HRDPSGKFKSLETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLI 345

Query: 353 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRR 412
           DIKTTLENL++TRRWTLRETDLF+YQK+L EID+ RV GKFPT++ DSKGQSILLYLLRR
Sbjct: 346 DIKTTLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRR 405

Query: 413 CYAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 472
           CYAIIYKLLESSEPVSEALQ +HNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLDN
Sbjct: 406 CYAIIYKLLESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDN 465

Query: 473 LRTDGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509
           +R DG FYD+DGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 466 MRVDGKFYDADGNIPEGQGTLNALLAECFDILHELKI 502

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/526 (69%), Positives = 437/526 (83%), Gaps = 17/526 (3%)

Query: 1   MFSS--AGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKV 58
           M SS     Q  Q VPKEEE ILNY L+VR+ L++LK+NRTQYLNS +VQ TYQ VLTKV
Sbjct: 1   MISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKV 60

Query: 59  RELDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYA 118
           RELD IRK +HD  A +  TLIH+ +LHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYA
Sbjct: 61  RELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYA 120

Query: 119 SLSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTG-PNYDEDG--NDDQ--LR 173
           SLSTVESLL+HL E+ ++THHDL PIK+RL EI KIVE++    N  +D   ND++  ++
Sbjct: 121 SLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIK 180

Query: 174 EIDNERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLV 233
           +ID ER +N++E++LLL+AKLKHC D Y+ +ESKLE+IDP+L++VMEKLF+IRRGLLSLV
Sbjct: 181 DIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLV 240

Query: 234 ASAKKT---MSQSNVNISSLLQKHNDLETN-NNDLMDD--KHLVSQEYVNEKLTALKNEL 287
           AS++     +S+ +++ SS     +++     N+L  +  K+ +S + V EK   L+N+L
Sbjct: 241 ASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDL 300

Query: 288 NELESNRDESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGG----LTLDPT 343
             LE++RDE GKFKSLE+ KVAENGQ VLNGLLDDC+DLV+DLSHQ   G    L++DP+
Sbjct: 301 KNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPS 360

Query: 344 LQPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQ 403
           LQP+YE+L++IKTTLENLMITRRWTLRETDLFSYQKKLNEID+ RV G+FPT+T DS+GQ
Sbjct: 361 LQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQ 420

Query: 404 SILLYLLRRCYAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPY 463
           SILLYLLRRCYAIIYKLLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPY
Sbjct: 421 SILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPY 480

Query: 464 QMKLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509
           QMKLASLDNLR DGIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 481 QMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/509 (70%), Positives = 413/509 (81%), Gaps = 15/509 (2%)

Query: 9   HPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++RKNS
Sbjct: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65

Query: 69  HDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TP+ SA TLIHS+ELHNRVDSV+DDVFQL+SL FLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125

Query: 129 HLNESNVFTHHDLSPIKERLEEIRKIVEKNT--------GPNYDEDGNDDQLREIDNERN 180
           HLNESNV+THHDL PIKERL E+  IVE+N           N D D   +   + D E N
Sbjct: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185

Query: 181 KNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTM 240
           KN+IEEDLLLRAKLKHC DEY+ +ESKLEEI P L + ME LF+IRRGLLSL +S K+  
Sbjct: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPH 245

Query: 241 SQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKF 300
            +  V   ++L   ++     N L D       + ++EKL  L+ +L +LES+RD +GKF
Sbjct: 246 QKQLVPDPAVLSVESEASEKKNVLPD-------QVIDEKLKQLQEQLEKLESHRDINGKF 298

Query: 301 KSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLEN 360
           KSLE+ KV E GQ+VLNGLLDDCHDLVNDLSHQ +GG++LD  LQPIY+QL+DIKTTLEN
Sbjct: 299 KSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358

Query: 361 LMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKL 420
           L++TRRWTLRETDLF+YQKKL EID+ RV GKFPT   DSKGQSILLYLLRRCYAIIYKL
Sbjct: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKL 418

Query: 421 LESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFY 480
           LESSEPVSE+LQ VHNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R DG FY
Sbjct: 419 LESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478

Query: 481 DSDGNIPEGQGILNALLAECFDIMHELKV 509
           D+DGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 479 DTDGNIPEGQGTLNALLAECFDIIHELKI 507

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/526 (66%), Positives = 419/526 (79%), Gaps = 37/526 (7%)

Query: 8   QHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+RK+
Sbjct: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73

Query: 68  SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLL 127
           +H+TP+ SA TLIH+ ELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPA Y+SLSTV+ LL
Sbjct: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133

Query: 128 EHLNESNVFTHHDLSPIKERLEEIRKIVEKNT----------------GPNYDEDGNDDQ 171
           EHLNESNVFT HDL PIKERL EI+KIVEK+                  P+ DE      
Sbjct: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEAD---- 189

Query: 172 LREIDNERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLS 231
            R +  E  +N+IEEDLLLRAKL+HC DEY + E+K+E +DPSLS +M+KLF+IRR LLS
Sbjct: 190 -RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLS 248

Query: 232 LVASAKKTMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELE 291
           L ASAKKT S ++                    +++KH+++ E VN ++  L+ ELNE+E
Sbjct: 249 LAASAKKTTSSASAEKE----------------LENKHVLAPESVNTRVELLQKELNEIE 292

Query: 292 SNRDESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQL 351
           S RDE+GKFKS ES + AE GQ+VLNGLL DC+DL+ DLSHQ NGG+ LDP LQPIY +L
Sbjct: 293 SYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKL 352

Query: 352 IDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLR 411
           IDIKTTLENL+ITRRWTLRETDLF+YQK+L EIDS RV  KFPT + D+KGQ+ILLYLLR
Sbjct: 353 IDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLR 412

Query: 412 RCYAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 471
           RCYAIIYKLLESSEPVSE+LQP+HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD
Sbjct: 413 RCYAIIYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLD 472

Query: 472 NLRTDGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQN 517
            LR DG FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEE+ ++
Sbjct: 473 GLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTES 518

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/510 (69%), Positives = 412/510 (80%), Gaps = 23/510 (4%)

Query: 8   QHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62

Query: 68  SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLL 127
           SH  PA SA TLIH+ ELHNRVDSVLDDVFQL+SL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 128 EHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDE--DGNDDQLREIDNERNKNRIE 185
           EHL+ESNVFTHHDL PIKERL+EI +IV +++  +  E  DG  D   +I +E+++N+IE
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRID-FAKIQDEKDRNKIE 181

Query: 186 EDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKK-TMSQSN 244
           EDLLLRAKL+HC  EY+ +ESKLEEIDP L + MEKLF++RRGLLSL AS K+  MS+  
Sbjct: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQG 241

Query: 245 VNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLE 304
           V                        L+ QE + ++L  L+ EL E+ES+RD SGKF SLE
Sbjct: 242 VKTPD-------------------SLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLE 282

Query: 305 SHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMIT 364
           + ++A  GQ+VLNGLLDDCHDL+NDLSH  N  ++LD  LQPIY+ LIDIKTTLENL++T
Sbjct: 283 TGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT 342

Query: 365 RRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLESS 424
           RRWTLRETDLFSYQK+L+EID  RV GKFPT+  D+KGQ+ILLYLLRRCYAIIYKLLE S
Sbjct: 343 RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECS 402

Query: 425 EPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDG 484
           EPVSEALQ +HNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DG FYD DG
Sbjct: 403 EPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDG 462

Query: 485 NIPEGQGILNALLAECFDIMHELKVEAEER 514
           NIPEGQG LNALLAECFDI+HELK+EAEER
Sbjct: 463 NIPEGQGTLNALLAECFDILHELKIEAEER 492

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/515 (66%), Positives = 406/515 (78%), Gaps = 30/515 (5%)

Query: 7   QQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRK 66
            +HPQ VP EEE+ L Y LEVR+ L++LKQNR+QYLNSK+V + YQ VLTKVRELD+IRK
Sbjct: 2   HKHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRK 61

Query: 67  NSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESL 126
            SH  P  SA TLIH+ ELHNRVDSVLDDVFQL+SL FLTVGLKNSAPATYASLSTV+ L
Sbjct: 62  RSHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121

Query: 127 LEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQL--REIDNERNKNRI 184
           LEHL+ESNVFTHHDL PIKERL+EI +IV +++      + N+  +   +I +E+++N+I
Sbjct: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGEINNGSIDFTKISDEKDRNKI 181

Query: 185 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSN 244
           EEDLLLRAKLKHC  EY  +ESKLEEIDP L   MEKLF++RRGLLSL AS K+      
Sbjct: 182 EEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKR------ 235

Query: 245 VNISSLLQKHNDLETNNNDLMDDKH-----LVSQEYVNEKLTALKNELNELESNRDESGK 299
                            N ++ D H      +SQE V EKL +L+ +L ++ES R+ SG 
Sbjct: 236 -----------------NAMLKDGHKAPESPLSQESVKEKLHSLEAKLTQIESQRNASGY 278

Query: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359
           F S ++ ++ E GQSVLNGLLDDCHDL+NDLSH  N  +TLD  LQPIY+ LI+IKTTLE
Sbjct: 279 FVSADTGEIVERGQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLE 338

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419
           NL++TRRWTLRETDLF+YQK+L+EID  RV GKFPT++ D+KGQ+ILLYLLRRCYAIIYK
Sbjct: 339 NLLVTRRWTLRETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYK 398

Query: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479
           LLE SEPVSEALQ +HNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DG F
Sbjct: 399 LLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKF 458

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514
           YD DGNIPEGQG LNALLAECFDI+HELK+EAE R
Sbjct: 459 YDEDGNIPEGQGTLNALLAECFDILHELKIEAEYR 493

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/514 (64%), Positives = 415/514 (80%), Gaps = 27/514 (5%)

Query: 9   HPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD+IRKNS
Sbjct: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73

Query: 69  HDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLE 128
             TPAK+A TLIH ++LHNRVDSVLDDVFQL+SLCFLTVG+KNSAPATY+SLSTV+ LLE
Sbjct: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133

Query: 129 HLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDD----------QLREIDNE 178
           HLNES +FT HDL PIKERL+EI++IVEK++  N  ++ ND           +L EI+NE
Sbjct: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRN--DEFNDSALVGLSKQEHELIEIENE 191

Query: 179 RNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKK 238
           R +NRIEEDLL+RAKL+ C ++++ +ES+LE+I+P+LS++++KL+ IRRGLLSL +    
Sbjct: 192 RTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTND 251

Query: 239 TMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESG 298
           T+S+S+         +N + + N+++ D  H   +E V   L  +K +L E+ES RDE+G
Sbjct: 252 TLSKSD---------NNHIASTNHNVSDKSH---KELV---LLKMKKQLVEIESQRDENG 296

Query: 299 KFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTL 358
            +KSLE++KV   GQ ++N L+DDC+DL+NDLSH  NG +  DP LQ IY+ LIDIKT L
Sbjct: 297 YYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNL 356

Query: 359 ENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIY 418
            NLM+TRRWTLRETDLFSYQKKL EIDS RV GKF + T D+KGQSI+LYLLRRCYAIIY
Sbjct: 357 ANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIY 416

Query: 419 KLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGI 478
           KLLESSEP+SE+LQ +H QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD LR DG 
Sbjct: 417 KLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGK 476

Query: 479 FYDSDGNIPEGQGILNALLAECFDIMHELKVEAE 512
           FYD++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 477 FYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 90/179 (50%), Gaps = 18/179 (10%)

Query: 256 DLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLESHKVAENGQSV 315
           D++TN  +LM  +    +E     L + + +L E++S R  +GKFKS  S      GQS+
Sbjct: 351 DIKTNLANLMVTRRWTLRE---TDLFSYQKKLAEIDSLR-VNGKFKSATSDA---KGQSI 403

Query: 316 LNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITRRWTLRETD-- 373
           +  LL  C+ ++  L   +     +  +LQ I+ QL    +T+   ++T +     TD  
Sbjct: 404 ILYLLRRCYAIIYKLLESSE---PISESLQSIHTQL----STVRRCLMTLKRLGGVTDIK 456

Query: 374 -LFSYQKKLNEIDSKRVKGKFPTKTQD-SKGQSILLYLLRRCYAIIYKLLESSEPVSEA 430
            L+ YQ KL  +D  R+ GKF     D  +GQ IL  +L  C+ ++++L   +E  S +
Sbjct: 457 ELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSS 515

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/518 (65%), Positives = 410/518 (79%), Gaps = 21/518 (4%)

Query: 4   SAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 63
           S+  Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD 
Sbjct: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61

Query: 64  IRKNSHDTPAK--SAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLS 121
           IRK +H++        TLIHS +LHNRVDSV+DDVFQL+SLCFLTVGLKNSAPATYASLS
Sbjct: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121

Query: 122 TVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQL--REIDNER 179
           TV+SLL+HLNESNV+TH+DL PIKERL+EI +IVEKN+  N   DG D      +++++R
Sbjct: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKR 181

Query: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239
            +N IEE+LLLRAKL++C   Y+ +E+KLE I   L   ME+LF+IRRGLLSL ASAK  
Sbjct: 182 KENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSR 241

Query: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299
           + Q               E + ND  D+  ++S E +NE+L AL+ EL ++ S+R+ESGK
Sbjct: 242 VEQE--------------EQDEND--DELCILSHEKINERLKALETELADVRSHRNESGK 285

Query: 300 FKSL-ESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTL 358
           F S+ + + V E GQ VLNGLLDDCHDL+ DLSHQT+ GL LDP +QPIY+ L+ IKT L
Sbjct: 286 FVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTIL 345

Query: 359 ENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIY 418
           ENL++TRRWTLRETDLF+YQKKL E+DS RV GKFP+++ DSKGQ+ILLYLLRRCYAIIY
Sbjct: 346 ENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIY 405

Query: 419 KLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGI 478
           KLLESSEPVSE+L+ +HNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R DG 
Sbjct: 406 KLLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGK 465

Query: 479 FYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQ 516
           FYD DGNIPEGQG LNALLAECFDI+HE+K+EAE R +
Sbjct: 466 FYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREE 503

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 139/308 (45%), Gaps = 32/308 (10%)

Query: 140 DLSPIKERLEEIRKIV------EKNTGPNYDEDGNDDQLREIDNERNKNRIEEDLLLRAK 193
           DL P  ERL +IR+ +       K+     ++D NDD+L  + +E+   R++    L  +
Sbjct: 216 DLQPFMERLFQIRRGLLSLAASAKSRVEQEEQDENDDELCILSHEKINERLKA---LETE 272

Query: 194 LKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSNVNISSLLQK 253
           L   +   +     +   DP+   V EK   +  GLL       + +S      S+ L  
Sbjct: 273 LADVRSHRNESGKFVSVNDPN--DVPEKGQFVLNGLLDDCHDLIRDLSHQT---SAGLDL 327

Query: 254 HNDLETNNNDLMDDKHLVSQEYVNEKLT-------ALKNELNELESNRDESGKFKSLESH 306
              ++   +DL+  K ++    V  + T         + +L EL+S R  +GKF S  S 
Sbjct: 328 DPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKLAELDSLR-VNGKFPSESSD 386

Query: 307 KVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITRR 366
                GQ++L  LL  C+ ++  L   +     +  +L+ I+ QL  ++  L  L + R 
Sbjct: 387 S---KGQAILLYLLRRCYAIIYKLLESSE---PVSESLERIHNQLSTVRHCL--LELKRM 438

Query: 367 WTL-RETDLFSYQKKLNEIDSKRVKGKFPTKTQD-SKGQSILLYLLRRCYAIIYKLLESS 424
             +  E +L+ YQ KL  +D+ RV GKF     +  +GQ  L  LL  C+ I++++   +
Sbjct: 439 GGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFDILHEMKIEA 498

Query: 425 EPVSEALQ 432
           E   EA Q
Sbjct: 499 EVREEAAQ 506

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/505 (64%), Positives = 393/505 (77%), Gaps = 38/505 (7%)

Query: 11  QIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHD 70
           Q VPKEEE  L+YLL+VR  L+ LKQNR+Q+LNSKD+Q TYQ VLTKVRELD+IR+  H 
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 71  TPAKS-AATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLEH 129
              ++   T +HS ELHNRVD+VLDDVFQL+SLCF+T GLKNSAPATYASLSTV+SLLEH
Sbjct: 70  NSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLEH 129

Query: 130 LNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDG-----NDDQLREIDNERNKNRI 184
           L ES ++THHDL PIKERL+EI KIV++N   N  +D      +D+++  IDNERNKN+I
Sbjct: 130 LIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRIDNERNKNKI 189

Query: 185 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSN 244
           E++LLL+AKL HC  EY+ +ES+LEE+DPS ++++EKLF+IRR L+SLV      +S+SN
Sbjct: 190 EQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVE-----ISKSN 244

Query: 245 VNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLE 304
             +                         Q+ +++KL  L+ +LNE+E+NRD  G F S+E
Sbjct: 245 TGV-------------------------QDQIDKKLKHLQLQLNEIENNRDPDGNFVSIE 279

Query: 305 SHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMIT 364
           S      G +VLNGL DDCHDL++DL+H T     LDP LQ +Y+ LID+K +LENLM+T
Sbjct: 280 SGNPIIKGSNVLNGLSDDCHDLISDLTHHTKT--FLDPDLQNVYDNLIDVKGSLENLMVT 337

Query: 365 RRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLESS 424
           RRWTLRETDLFSY KKLNEID+ RV GKFPTK+  +KGQ+ILLYLLRRCY +IYKLLESS
Sbjct: 338 RRWTLRETDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESS 397

Query: 425 EPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDG 484
           EPVSEALQP+HNQLSTVRRCLL+LKRMGGVNNERELYPYQMKLASLDNLR DG FYDS G
Sbjct: 398 EPVSEALQPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKG 457

Query: 485 NIPEGQGILNALLAECFDIMHELKV 509
           NIPEGQGILNALLA CFDI+HELK+
Sbjct: 458 NIPEGQGILNALLAGCFDILHELKI 482

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/497 (64%), Positives = 389/497 (78%), Gaps = 23/497 (4%)

Query: 13  VPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHDTP 72
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79

Query: 73  AKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLEHLNE 132
           A  + T+IH+  LHN+VDS+LDDVFQL+SLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139

Query: 133 SNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNERNKNRIEEDLLLRA 192
           SN+FT+HDL PIK+RL+EI  IVE N+  NYD D  +    E + +RNKN+IEEDLLLRA
Sbjct: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPA-DETEEKRNKNKIEEDLLLRA 198

Query: 193 KLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSNVNISSLLQ 252
           KLKHC DEY+ + SKLEEI P LS++MEKL+ IRR LLSL + ++K  ++          
Sbjct: 199 KLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDTRE--------- 249

Query: 253 KHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLESHKVAENG 312
                        D     S +   E L++L+ EL ELES+RDE+G FKSLE+ +V   G
Sbjct: 250 -------------DFSQFNSSKESQEALSSLEQELEELESHRDENGNFKSLETGEVVLKG 296

Query: 313 QSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITRRWTLRET 372
           Q+VL GL+D+CHDL+ND ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+T
Sbjct: 297 QNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDT 356

Query: 373 DLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEALQ 432
           DLF YQKKL  ID+KRV GKFPTK+ D+KGQ+ILLYLLRRCYAIIYKLLESS PVSE+LQ
Sbjct: 357 DLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESLQ 416

Query: 433 PVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQGI 492
            +HNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR DG F+D++G IPEGQG 
Sbjct: 417 SIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGT 476

Query: 493 LNALLAECFDIMHELKV 509
           LNALLAECFDIMHEL++
Sbjct: 477 LNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/512 (60%), Positives = 384/512 (75%), Gaps = 29/512 (5%)

Query: 13  VPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN----- 67
           VP+ E  IL YL++VR  L +LK NR++YLNSK+V+  +Q VLTKVRELDDIRK+     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 68  -SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESL 126
              D+  +   TL+ +  LHN+VDS++DDVFQL+SLCFLTVGLKNSAPATY SLSTV+ L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 127 LEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDN-ERNKNRIE 185
           LEHL+ESN+FT+HDL PIKERL+EI KIV+ N+  NY+ + ++    ++D+ E  +N IE
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYEFNEDEINPNQVDDDEIKQNLIE 196

Query: 186 EDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSNV 245
           EDLLLRAKLK C DE+  + SKLEEIDP L+++MEKL+ IRR LLSL +   K  +  N+
Sbjct: 197 EDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPTHKIDTTENI 256

Query: 246 NISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLES 305
           +I            NNN           E   + L  L +EL ELE++RDE G FKSLE+
Sbjct: 257 SI-----------FNNN-----------EESRKMLKHLSDELTELETHRDEDGNFKSLET 294

Query: 306 HKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITR 365
           ++V   GQ+ L GL+D+CHDL+ND ++ +     LD  LQPIY  LI+IKT L NLMITR
Sbjct: 295 NEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITR 354

Query: 366 RWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLESSE 425
           RWTLRETDLF YQK+L EID +RV GKFP+++ ++KGQSILLYLLRRCYAIIYKLLESSE
Sbjct: 355 RWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSE 414

Query: 426 PVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGN 485
           PVSE+LQP+HNQLST RRCLL LKRMGGVN+ RELYPYQ+KLASLD LR DG FYDS G 
Sbjct: 415 PVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGE 474

Query: 486 IPEGQGILNALLAECFDIMHELKVEAEERAQN 517
           IPEGQG LNALLAECFD++HEL++E+EE   N
Sbjct: 475 IPEGQGTLNALLAECFDMLHELEIESEESVDN 506

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/470 (61%), Positives = 351/470 (74%), Gaps = 25/470 (5%)

Query: 49  TTYQHVLTKVRELDDIRKNSHDTPAKSAA-TLIHSTELHNRVDSVLDDVFQLISLCFLTV 107
            TYQ VLTKVR LD +RK  H     +   TLIHS  LHNRVDSVLDDVFQL+SL FLTV
Sbjct: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61

Query: 108 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDG 167
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERL+EI +IVEKN+  +  ED 
Sbjct: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVED- 120

Query: 168 NDDQLREIDNERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRR 227
            +  L E+  E+  N++EEDLL+RAKL+HC D Y  ++SK   I P L  + +KLF IRR
Sbjct: 121 -EAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRR 179

Query: 228 GLLSLVASAK--KTMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKN 285
            LLSL ASAK  +   + +   S+     N L +                   +L  L++
Sbjct: 180 ELLSLAASAKTDRAAGEGSTERSTTPASPNTLAS-------------------RLKDLES 220

Query: 286 ELNELESNRDESGKFKSLE-SHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTL 344
            + E+ES+RD+SGKF S +    V + GQS LNGLLDDC +L  DLSHQT+G L LDP L
Sbjct: 221 MILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQL 280

Query: 345 QPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQS 404
           QPIYE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+D+ RV  K P+ +  SKGQ+
Sbjct: 281 QPIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQA 340

Query: 405 ILLYLLRRCYAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQ 464
           ++LYLLRRCYA IYKLLESSEPVSE+LQ +HNQLSTVRRCL ELKRMGGV++ER+LYPYQ
Sbjct: 341 LILYLLRRCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQ 400

Query: 465 MKLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514
           MKLASLDN+R DG FYD+DGNIPEGQG LNALLAECFDI+HE+K+EAE R
Sbjct: 401 MKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVR 450

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 7/126 (5%)

Query: 312 GQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITRRWTL-R 370
           GQ+++  LL  C+  +  L   +     +  +LQ I+ QL  ++  L  L   R   +  
Sbjct: 338 GQALILYLLRRCYATIYKLLESSE---PVSESLQKIHNQLSTVRRCLFEL--KRMGGVDS 392

Query: 371 ETDLFSYQKKLNEIDSKRVKGKFPTKTQD-SKGQSILLYLLRRCYAIIYKLLESSEPVSE 429
           E DL+ YQ KL  +D+ RV GKF     +  +GQ  L  LL  C+ I++++   +E   E
Sbjct: 393 ERDLYPYQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREE 452

Query: 430 ALQPVH 435
            L  V+
Sbjct: 453 QLPQVN 458

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  185 bits (469), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 135/443 (30%), Positives = 232/443 (52%), Gaps = 70/443 (15%)

Query: 115 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEK----------------- 157
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RL+EI  I+E                  
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 158 -----------------NTG----PNYDEDGNDDQLREIDNERNKNRIEEDLLLRAKLKH 196
                            N+G    P    D  + +L++ D+   K  I ++L        
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQEL------DD 186

Query: 197 CKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVAS-AKKTMSQSNVNISSLLQKHN 255
           C   ++ +E K + ID +LS++++K+  +R+ LL +V S  K    Q  V          
Sbjct: 187 CYKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCFV---------- 236

Query: 256 DLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLESHKVAE-NGQS 314
                   L D  H+ S    ++KL  ++  L+ ++    E  + +S  +      NGQ 
Sbjct: 237 --------LKDPNHM-SNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQR 287

Query: 315 VLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITRRWTLRETDL 374
           +LNGL+D C ++++D+       +  D     ++E+ + +K  LE +++T R +L+  DL
Sbjct: 288 ILNGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDL 346

Query: 375 FSYQKKLNEIDSKRVKGKFPTKTQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSEALQP 433
           F+  K+L++++ + ++       +DS + +SI+++ LRRC+ IIYK+LESSEPV   L+P
Sbjct: 347 FNLHKELSKLEKRTIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRP 403

Query: 434 VHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQGIL 493
           ++NQLST+ R LL+LK  GGV    +L P ++KL ++ + R +  F D  GNIP GQ  L
Sbjct: 404 LYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRAL 463

Query: 494 NALLAECFDIMHELKVEAEERAQ 516
           NALL EC +++  L+++ E R +
Sbjct: 464 NALLHECMELLKILEIDFEGRTR 486

>TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {ON}
           Anc_6.70 YLR273C
          Length = 918

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 287 LNELESNRDESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDP---- 342
           L + E N D   KF   E++  ++ G S L+ L+++ +    DL  ++N   T  P    
Sbjct: 172 LRQFEINNDNDSKFPFFENNDDSDEGDSELDHLINNSYLFSKDLFFKSNKNYTFSPKPMN 231

Query: 343 ---TLQPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQ 378
               +       ID  T+L   + T+ W L ++++ S++
Sbjct: 232 QNQNIDDAINDFIDC-TSLHRAVTTKNWKLLKSNVSSFE 269

>ADR279C Chr4 complement(1177905..1180358) [2454 bp, 817 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL095W
           (PMT1) and YDL093W (PMT5); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 817

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 39/96 (40%), Gaps = 9/96 (9%)

Query: 111 NSAPATYASLSTVESL-LEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGND 169
           N+ P T+  L     + L+H+   +    HD  P      + +K V     P ++ D ND
Sbjct: 381 NTVPTTFEGLEHGTKIRLKHVLTGHRLHSHDHKPPVSVSSDWQKEVSGYGFPEFEGDAND 440

Query: 170 DQLREIDNERNK--------NRIEEDLLLRAKLKHC 197
           D + EID E++           IE    LR  +  C
Sbjct: 441 DWIVEIDQEKSTPGEARERVRAIETKFRLRHAMTGC 476

>TBLA0H03030 Chr8 (741174..741863) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 141 LSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREI 175
           ++P KE+L +   + ++N GP+Y   GNDDQ + I
Sbjct: 54  MTPFKEQLVDFIPLTKENPGPSYYGVGNDDQEKPI 88

>YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}
           NBP1Spindle pole body (SPB) component, required for the
           insertion of the duplication plaque into the nuclear
           membrane during SPB duplication; essential for bipolar
           spindle formation; component of the Mps2p-Bbp1p complex
          Length = 319

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 20/94 (21%)

Query: 414 YAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNL 473
           Y I+  LL+SS         +H   +  RR +  L R        E+ P ++ L+     
Sbjct: 210 YRILEDLLDSSN--------IHPSYTKSRRTMSNLAREND-----EIKPLKIDLSPSPIR 256

Query: 474 RTDGIF-------YDSDGNIPEGQGILNALLAEC 500
           RT+ +F       Y+ DGNIPE Q +   +   C
Sbjct: 257 RTNSLFTSSPMKTYNRDGNIPEMQPLQENISPAC 290

>NCAS0B05860 Chr2 complement(1112137..1114677) [2541 bp, 846 aa]
           {ON} 
          Length = 846

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 9/80 (11%)

Query: 126 LLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNERNKNRI- 184
           LL    +  + +H   +P+ E   + +K V     P +  DGNDD + EID ++ +  I 
Sbjct: 406 LLHSTTQCRLHSHDYPAPVSES-TDWQKEVSCYGYPGFPGDGNDDWIVEIDQKQTEPGIA 464

Query: 185 -EEDLLLRAKLK------HC 197
            E+ + L+ K +      HC
Sbjct: 465 REQIIALKTKFRLKHAATHC 484

>AFR429C Chr6 complement(1208115..1208891) [777 bp, 258 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL207W
          Length = 258

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 7/103 (6%)

Query: 194 LKHCKDEYD-TLESKLE-EIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSNVNISSLL 251
           L  C    D TL+S+L+  +   +S VM  +  +RR L+ L+ S  K++ ++ V  +  +
Sbjct: 3   LGACAAGADLTLDSRLKLWVLLPISVVMILVGVVRRYLMILLTSKVKSVPRATVTENQYI 62

Query: 252 QKHNDLETNNNDLMDDKHLVSQEYVNEKLT-----ALKNELNE 289
            K   + TN + L ++   + QEY+   L+     ALK +  E
Sbjct: 63  SKAIAMLTNGSSLHEEAFRMRQEYLAGVLSEGKYLALKGKAAE 105

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 49/117 (41%), Gaps = 4/117 (3%)

Query: 21  LNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHDT--PAKSAAT 78
           LNY L  R  L KL         +   +   ++V T  R    +R   HD   P K    
Sbjct: 492 LNYKL--REVLVKLDDLSANQRETNKERKLRENVATLKRLFPGVRGLVHDLCHPKKDKYA 549

Query: 79  LIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLEHLNESNV 135
           +  ST L    DSV+ D F +   C   +  + S  A++  L T++++  +L  SN 
Sbjct: 550 VAVSTVLGKNFDSVIVDNFSVAQECISYLKRQRSGVASFIPLDTIDAITANLPVSNT 606

>TBLA0A00250 Chr1 complement(35814..37298) [1485 bp, 494 aa] {ON}
           Ty-like retrotransposon; ribosomal frameshifting site
           uncertain
          Length = 494

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 141 LSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREI 175
           ++P KE+L +   + + N GP+Y   GNDDQ + I
Sbjct: 109 MTPFKEQLVDFTPLTKGNPGPSYYGVGNDDQEKPI 143

>Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W
           (REAL)
          Length = 451

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 271 VSQEYVNEKLTALKNELNELESNRDESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDL 330
           +S++ + + L AL  ++ ELESNRD+  K  + +  +++E G   LN LL +    ++DL
Sbjct: 218 ISKQSIFKDLEALSFQIVELESNRDKLIKISNTDIRELSE-GIKELNNLLTERKKTLHDL 276

Query: 331 SHQTNGGLTLDPTLQPIYEQLIDI 354
           S Q         T + I  +L D+
Sbjct: 277 STQQKNLQATVTTFETIISELYDV 300

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 100 ISLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 140
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54

>TBLA0B05400 Chr2 (1268360..1269490,1269492..1273817) [5457 bp, 1818
           aa] {ON} 
          Length = 1818

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 141 LSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREI 175
           ++P KE+L +   + ++N GP+Y   GNDDQ + I
Sbjct: 438 MTPFKEQLVDFIPLTKENPGPSYYGVGNDDQEKPI 472

>Skud_4.806 Chr4 complement(1419440..1420597) [1158 bp, 385 aa] {ON}
           YDR532C (REAL)
          Length = 385

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 14/84 (16%)

Query: 276 VNEKLTALKNELNELESNRDESGKFKSLES-HKVAENGQSVLN-------GLLDDCHDLV 327
           +NEK+  +KNE++ +   + E  K +  E+ HK AE  Q +LN       G +++C D +
Sbjct: 132 LNEKVNHVKNEISTVYETKIEQIKTEIQETGHKFAEK-QDLLNELYLETTGDIENCWDSL 190

Query: 328 NDLSHQTNGG-----LTLDPTLQP 346
           N+L   TN G        DP L P
Sbjct: 191 NELKRFTNKGDDNISTDKDPVLNP 214

>KNAG0D03700 Chr4 complement(673981..674607) [627 bp, 208 aa] {ON}
           Anc_4.81 YGL033W
          Length = 208

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 13/124 (10%)

Query: 40  QYLNSKDVQTTYQHVLTKVRELDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQL 99
           +YLNS+           K   ++DI +N H    K+AA  + + E     D ++ +VF  
Sbjct: 18  KYLNSQ----------CKPFAVNDIIQNLHGQFGKAAA--LKALESLTSQDRIVCNVFGK 65

Query: 100 ISLCFLTVGLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNT 159
           IS+      L   APAT   LS +E  +E L E  +    D   +++ +    +  + N 
Sbjct: 66  ISIYCCKDVLPEGAPATEIDLSKLEE-IEQLREKVMELERDRKGLQDTVASFNRSPDNNE 124

Query: 160 GPNY 163
            PN 
Sbjct: 125 LPNM 128

>SAKL0E05720g Chr5 complement(468851..471460) [2610 bp, 869 aa] {ON}
           similar to uniprot|P33775 Saccharomyces cerevisiae
           YDL095W PMT1 Transfers mannose residues from dolichyl
           phosphate-D-mannose to specific serine/threonine
           residues of proteins in the secretory pathway acts in
           complex with Pmt2p dolichyl phosphate-D-mannose:protein
           O-D- mannosyltransferase
          Length = 869

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 11/97 (11%)

Query: 111 NSAPATYASLS-TVESLLEHLNESNVFTHHD-LSPIKERLEEIRKIVEKNTGPNYDEDGN 168
           N  P T+A+L+  ++  L+H+N       HD  +P+ E   + +K V       +D D N
Sbjct: 418 NIVPTTFANLTDGMKIRLKHINTHRRLHSHDHKAPVSES-ADWQKEVSCYGFEGFDGDAN 476

Query: 169 DDQLREIDNERN-----KNRI---EEDLLLRAKLKHC 197
           DD + EID + +     +NR+   E    LR  +  C
Sbjct: 477 DDFVVEIDKDASAPGEAQNRVRALETKFRLRHAMTGC 513

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1869

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 196 HCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKK---TMSQSNVNISSLLQ 252
             K++Y+ LE K ++++ SL  V  +L +I +   +L A+ KK   T + +   I +   
Sbjct: 762 RLKNDYEFLEGKHKKVEKSLENVSTRLIEITKDKENLTAANKKITETFASNKKKIEAYES 821

Query: 253 KHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRD--ESGKFKSLESHKVAE 310
           K N LE+   D+   K     E   E +  +  EL  LE N++  ES K       KV +
Sbjct: 822 KINTLESKLRDITSKK-----EQAEEGINKMSRELFNLEKNKEDIESAK------KKVEK 870

Query: 311 NGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPI 347
                L  + ++   L N L+ +     +LD  LQ +
Sbjct: 871 ELNKELENMKNENKKLDNTLAKKEKELQSLDEELQKL 907

>Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar to
           Ashbya gossypii ADL022C
          Length = 1811

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 64/124 (51%), Gaps = 26/124 (20%)

Query: 177 NERNKNR-----IEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLS 231
           ++R+K+R     +EE   L AK++   ++Y TLE K  ++D               G +S
Sbjct: 323 SDRDKDRDIVLLLEEGNKLEAKIRQMSEDYKTLEFKSGQLD---------------GQVS 367

Query: 232 LVASAKKTMSQSNVNISSLLQKH----NDLETNNNDLMDDKHLVSQEYVNEKLTALKNEL 287
           +++S K+++++    +SS LQ      N L+   +  +DD     ++ + ++LT L  +L
Sbjct: 368 ILSSEKRSLNEKVEELSSQLQSSKAEINTLKGELSSKIDDAE--KRDEIQQELTLLNKQL 425

Query: 288 NELE 291
           NEL+
Sbjct: 426 NELK 429

>KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 1059

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 18/84 (21%)

Query: 72  PAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGL------KNSAPATYASLSTVES 125
           PA ++  L+  T+L +            +SL FLT+         N  PA    ++T   
Sbjct: 99  PAAASNLLVTITKLMSN-----------LSLIFLTINSDAIGADSNKIPAWRNPVNTCIK 147

Query: 126 LLEHLNESNVFTHH-DLSPIKERL 148
           LL+H NESN+F    D S I ERL
Sbjct: 148 LLQHCNESNLFEWRTDNSEIAERL 171

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
           (REAL)
          Length = 1898

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 25  LEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHDTPAKSAATLIHSTE 84
           +++  TL +LK N  + +NS  ++T  + VL   R+ D+IRK  +DT +K  +     T 
Sbjct: 61  IQITVTLDELKTNSAKKINS--LKTEMEDVL---RQNDEIRKERNDTSSKFESVQREKTH 115

Query: 85  LHNRVDSV 92
           L N ++S+
Sbjct: 116 LSNELESI 123

>KLLA0C13926g Chr3 (1195709..1198063) [2355 bp, 784 aa] {ON} similar
           to uniprot|P40850 Saccharomyces cerevisiae YNL085W MKT1
           Protein involved in propagation of M2 dsRNA satellite of
           L-A virus forms a complex with Pbp1p that is involved in
           posttranscriptional regulation of HO endonuclease
          Length = 784

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 265 MDDKHLVSQEYVNE-----KLTALKNELNELESNRDESGKFKSLESHKVAENGQSVLNGL 319
           M   +L   EY++      +L  LKN    +      + +F+ ++SH+V       L   
Sbjct: 191 MQLAYLYEMEYIDAIYGPTELLMLKNVPKFIVGMEFPNKEFRFVDSHRVLSELNCNLEDF 250

Query: 320 LDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDI 354
           +D C  + NDL  +T   L + P++Q ++E  +D+
Sbjct: 251 VDICMAIGNDLQPRTLPPLQVYPSVQ-LFETALDM 284

>NCAS0B02970 Chr2 complement(513418..513882) [465 bp, 154 aa] {ON}
           Anc_8.409 YDR201W
          Length = 154

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 56/122 (45%), Gaps = 10/122 (8%)

Query: 167 GNDDQLREIDNERNKNRIEEDLLLRAKLKHCKDEYDTLESKL---EEIDPSLSTVMEKLF 223
           G+ D L+   N    N + E +L   ++     EYD   +KL   EE+DP + T+ EKL 
Sbjct: 21  GSVDTLK--SNSEENNYLTETMLQSRRVFELVPEYDVQRAKLSLIEEVDPVVKTLEEKL- 77

Query: 224 KIRRGLLSLVASAKKTMSQS-NVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTA 282
              R  LS +    +T+ QS  +N   L   H   +  + D+  D  +V     NE+L  
Sbjct: 78  ---RKSLSKMQRELETLQQSCELNELRLNNTHTTGQEGDVDMSSDNLVVMASSTNEELET 134

Query: 283 LK 284
           LK
Sbjct: 135 LK 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,131,420
Number of extensions: 2812295
Number of successful extensions: 15589
Number of sequences better than 10.0: 855
Number of HSP's gapped: 16178
Number of HSP's successfully gapped: 1100
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)