Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.436.13ON48848825260.0
Smik_6.4706.13ON48848824440.0
Skud_16.166.13ON48848824410.0
YPL262W (FUM1)6.13ON48848824360.0
SAKL0E00946g6.13ON49349520050.0
Kpol_1045.766.13ON48548719900.0
KLTH0C11462g6.13ON49246019860.0
KNAG0E027506.13ON49849119790.0
TDEL0G045806.13ON48446119730.0
Kwal_56.223626.13ON49349219630.0
KLLA0D00902g6.13ON49249219610.0
Kpol_1032.46.13ON46746019520.0
ACR013C6.13ON48847319540.0
TPHA0J002706.13ON49646119500.0
Ecym_30166.13ON48946419480.0
CAGL0A01045g6.13ON48348719360.0
NCAS0D026206.13ON49346119300.0
KAFR0B065206.13ON49546519230.0
ZYRO0C07964g6.13ON50546019020.0
TBLA0G010006.13ON46545918240.0
NDAI0I024706.13ON47546318150.0
TBLA0A071306.13ON50045917540.0
Ecym_24524.197ON4821941116e-05
SAKL0D09746g1.354ON4642751072e-04
KLLA0B13189g4.197ON4821921072e-04
SAKL0B04972g4.197ON4821911053e-04
NDAI0J019504.197ON4821911000.001
Skud_12.4434.197ON4821891000.001
Kwal_47.180664.197ON482191990.001
Kpol_1042.164.197ON482189980.002
NCAS0J012004.197ON482189980.002
CAGL0B02794g4.197ON482189980.002
TDEL0E017604.197ON482191980.002
YLR359W (ADE13)4.197ON482189980.002
Suva_10.4594.197ON482189970.002
KLTH0A03344g4.197ON482191970.003
Smik_12.4464.197ON482189970.003
NDAI0G059401.354ON462203960.004
KNAG0B058404.197ON482189960.004
KLLA0A08404g1.354ON461203960.004
TPHA0B010404.197ON482189950.004
AEL019W1.354ON469202950.005
NCAS0A090101.354ON462199940.006
TBLA0A083204.197ON482189920.012
ABL006C4.197ON482197910.015
Ecym_27491.354ON470275900.019
TDEL0D022201.354ON465203900.019
KNAG0I015601.354ON462203900.020
CAGL0I08987g1.354ON461198900.022
Skud_8.701.354ON463199890.024
ZYRO0B07964g4.197ON482189880.034
ZYRO0G00748g1.354ON462202880.036
Kpol_1018.1251.354ON460203870.041
TPHA0A021901.354ON463245870.050
Suva_15.2011.354ON463199850.075
TBLA0F034801.354ON466186850.076
KAFR0A062304.197ON482189850.083
Smik_8.831.354ON463185840.10
YHR018C (ARG4)1.354ON463199800.32
KLTH0G19338g1.354ON465167790.44
Kwal_27.127821.354ON465192770.75
KAFR0A009501.354ON464202761.0
YNL239W (LAP3)2.5ON454125714.0
Skud_14.1002.5ON483125705.2
ZYRO0C12606g3.438ON113072689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.43
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   977   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   946   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   944   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   942   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   776   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   771   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   769   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   766   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   764   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   760   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   759   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   756   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   757   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   755   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   754   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   750   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   748   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   745   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   737   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   707   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   703   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   680   0.0  
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    47   6e-05
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    46   2e-04
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    46   2e-04
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    45   3e-04
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    43   0.001
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    43   0.001
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    43   0.001
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    42   0.002
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    42   0.002
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    42   0.002
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    42   0.002
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    42   0.002
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    42   0.002
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    42   0.003
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    42   0.003
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    42   0.004
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    42   0.004
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    42   0.004
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    41   0.004
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    41   0.005
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    41   0.006
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    40   0.012
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    40   0.015
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    39   0.019
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    39   0.019
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    39   0.020
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    39   0.022
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    39   0.024
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    39   0.034
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    39   0.036
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    38   0.041
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    38   0.050
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    37   0.075
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    37   0.076
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    37   0.083
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    37   0.10 
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    35   0.32 
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    35   0.44 
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    34   0.75 
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    34   1.0  
YNL239W Chr14 (200569..201933) [1365 bp, 454 aa] {ON}  LAP3Cyste...    32   4.0  
Skud_14.100 Chr14 (189127..190578) [1452 bp, 483 aa] {ON} YNL239...    32   5.2  
ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} simil...    31   9.9  

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/488 (97%), Positives = 476/488 (97%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHP            TFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300
           AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420
           VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PENMLGPK
Sbjct: 481 PENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/488 (93%), Positives = 468/488 (95%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLR +NSSCKA +QSSYK NIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPK+SKAIQ+AADEVA+GKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSK+VHP            TFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I+ ELIPEL NLKNALEAKSKEF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300
           AH+LKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGY+ELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420
           VCVQVMGNNAAITF GSQGQFELNVFKPVMIANLLNSIRLI DA+ SFR+HCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PENMLGPK
Sbjct: 481 PENMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/488 (93%), Positives = 468/488 (95%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLRFSN +CKA+LQSSYKVN+RRMNSTFR ETDAFGEINVPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAA+VNESLGGLDPK+SKAIQQAADEV +GKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSK+VHP            TFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I+ ELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300
           AH+LKTLSFLAQGGTAVGTGLNTKPGFD+KIAEQIS ETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGY+ELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420
           VCVQVMGNNAAITF GSQGQFELNVFKPVMIANLLNSIRLI D++ SFR+HCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PENMLGPK
Sbjct: 481 PENMLGPK 488

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/488 (93%), Positives = 469/488 (96%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLRF+N SCK  ++SSYK+NIRRMNS+FRTETDAFGEI+VPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPK+SKAIQQAADEVA+GKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHP            TFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I+ ELIPELTNLKNALEAKSKEF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300
           AH+LKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGY+ELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420
           VCVQVMGNNAAITF GSQGQFELNVFKPVMIANLLNSIRLI DA+ SFR+HCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PE+MLGPK
Sbjct: 481 PEHMLGPK 488

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/495 (76%), Positives = 423/495 (85%), Gaps = 10/495 (2%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNST-------FRTETDAFGEINVPADKYWGAQTQRS 53
           MLR + ++ + +L SS   +IR ++++       +R ETDAFGEI VPADKYWGAQTQRS
Sbjct: 1   MLRITAAANRNLLPSS---SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRS 57

Query: 54  FQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDD 113
           F+NFKIGGARERMP  +V AFGVLKKSAAIVNESLG LDP++SK IQ+AADEV  GKL D
Sbjct: 58  FENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMD 117

Query: 114 HFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVM 173
           HFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ GSKQVHP            TFP+VM
Sbjct: 118 HFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVM 177

Query: 174 HIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQV 233
           HIAA  +I   L+PELT L+++ + KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 178 HIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQL 237

Query: 234 ENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEAL 293
            NGI RV  +L  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEAL
Sbjct: 238 TNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 297

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
           AAHDA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPT
Sbjct: 298 AAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357

Query: 354 QNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCV 413
           QNEA+TQVCVQVMGNNAAITF G+ GQFELNVFKPVMI+NLL+S+RL+ADAS SFR+HCV
Sbjct: 358 QNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCV 417

Query: 414 EGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEK 473
           +GIKANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL EK
Sbjct: 418 DGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEK 477

Query: 474 EFDEWVVPENMLGPK 488
           EFDEWV+PE M+GPK
Sbjct: 478 EFDEWVIPEKMIGPK 492

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/487 (76%), Positives = 416/487 (85%), Gaps = 4/487 (0%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLR +       +Q+ Y  N++     FR ETD FGEI VPA+KYWGAQT+RSF+NFKIG
Sbjct: 1   MLRSAIRPNTVRVQTRYISNLK----GFRVETDGFGEIKVPANKYWGAQTERSFENFKIG 56

Query: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120
           G+RERMP  +V AFGVLKK AAIVN  LGGLDP  SK IQQAADEVA GKL+DHFPLVVF
Sbjct: 57  GSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVF 116

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIE+ GG +GSK++HP            TFPTVMHIAA  Q
Sbjct: 117 QTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQ 176

Query: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I + L+PELT+L++AL AKS EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 177 ISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI 236

Query: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300
               + L FLAQGGTAVGTGLNTK G+  +IA +ISKETGL F+TAPNKFEALAAHDAIV
Sbjct: 237 ERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIV 296

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 356

Query: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420
           VCVQVMGNNAA+TF G+ GQFELNVFKPV+I+NLL+S++L+ DASRSFR+HCVEGIKANE
Sbjct: 357 VCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANE 416

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
            +I ELL +SLMLVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 417 AKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 476

Query: 481 PENMLGP 487
           PE MLGP
Sbjct: 477 PEKMLGP 483

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/460 (80%), Positives = 403/460 (87%)

Query: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88
           R ETDAFGEINVPADKYWGAQTQRS +NFKIGGARERMP P+V AFG+LKKSAAIVNESL
Sbjct: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92

Query: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LDPK+SK IQQAADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GGK+
Sbjct: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152

Query: 149 GSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208
           G+K +HP            TFP+VMHIAA  +I   L+PELT L+++   KSKEFE IVK
Sbjct: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  +L  L FLAQGGTAVGTGLNTK GF 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272

Query: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
            KIAEQ+SKETG+ F+TAPNKFEALAAHDAIVECSGALNTLACSLFKIA DIRYLGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388
           CGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITF G+ GQFELNVFKP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           VMI+NLL+S+RL+ DA  SFR+HCV+GI+AN  +I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPENM+GPK
Sbjct: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/491 (75%), Positives = 418/491 (85%), Gaps = 8/491 (1%)

Query: 6   NSSCKAILQSSY-KVNIRR-------MNSTFRTETDAFGEINVPADKYWGAQTQRSFQNF 57
           NSS KA ++ +  + N+RR        N  FR ETD+FGEINVPAD+YWGAQTQRSFQNF
Sbjct: 7   NSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNF 66

Query: 58  KIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPL 117
           KIGG RE++P P+V AFG+LKKSAA VNE+LG LD  ++  I+ AADEVA GKL DHFPL
Sbjct: 67  KIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPL 126

Query: 118 VVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAA 177
           VVFQTGSGTQSNMNANEVISNRAIE+LGG++GSKQVHP            TFPTVMHIAA
Sbjct: 127 VVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAA 186

Query: 178 SLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 237
           + +I  +LIPEL NLK+AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQQVENGI
Sbjct: 187 TTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 246

Query: 238 QRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHD 297
           QRV  +L  L FLAQGGTAVGTGLNTK GFD  +AE++SKETGL F+TAPNKFEALAAHD
Sbjct: 247 QRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHD 306

Query: 298 AIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEA 357
           AIVE SGALNTLACSLFKIAQDIRYLGSGPRCGY EL+LP NEPGSSIMPGKVNPTQNEA
Sbjct: 307 AIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEA 366

Query: 358 LTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIK 417
           +TQVCVQVMGNN+ ITF GSQGQFELNV+KP+MI+NLL+SIRL+ DAS+SFRIHC+  +K
Sbjct: 367 MTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLK 426

Query: 418 ANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDE 477
           AN+ +I E L KSLMLVTALNPKIGYDAA+KVAKNAH K ITLKESALELGVLTEKEFDE
Sbjct: 427 ANKDKIDENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDE 486

Query: 478 WVVPENMLGPK 488
           WV+PENM+ PK
Sbjct: 487 WVIPENMISPK 497

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/461 (79%), Positives = 407/461 (88%)

Query: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87
           FR ETDAFGEI V AD+YWGAQTQRS +NF+IGG RERMP P+V AFGVLKKSAA+VNES
Sbjct: 23  FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82

Query: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
           LG LDPKV++ I+QAADEVA GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 83  LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142

Query: 148 IGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207
           +GSKQ+HP            TFP+VMHIAA  +I + L+PEL +L+++L+AKSKEF  IV
Sbjct: 143 LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQV NGI RV  +L  L +LAQGGTAVGTGLNTK GF
Sbjct: 203 KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262

Query: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
             KIAEQ+SKETGL F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 263 AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322

Query: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITF G+ GQFELNVFK
Sbjct: 323 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382

Query: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           PVMI+NLL+S+RL+ADAS SFR+HCV+GI AN  RI +L+ +SLMLVTALNPKIGYDAAS
Sbjct: 383 PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPENM+GPK
Sbjct: 443 KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/492 (74%), Positives = 412/492 (83%), Gaps = 4/492 (0%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNST----FRTETDAFGEINVPADKYWGAQTQRSFQN 56
           M + +  +    L S  K  +   +S+    +R ETDAFGEI VP DK WGAQTQRS +N
Sbjct: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60

Query: 57  FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFP 116
           FKIGG RERMP P+V AFG+LKKSAAIVNESLG LDPKVSK IQ AADEV +GKL DHFP
Sbjct: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120

Query: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIA 176
           LVVFQTGSGTQSNMNANEVISNRAI+++GG++GSK +HP            TFP+VMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 177 ASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236
           A  ++   L+PEL  L++A   K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NG
Sbjct: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 237 IQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296
           I RV H+L  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNE 356
           DA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 357 ALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGI 416
           A+TQVCVQVMGNNAAITF G+ GQFELNVFKPVMI+NLL+SIRL+ DA  SFR+HCVEGI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420

Query: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476
           +ANE +I +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVL+  EFD
Sbjct: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480

Query: 477 EWVVPENMLGPK 488
           EWVVPENM+GPK
Sbjct: 481 EWVVPENMVGPK 492

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/492 (75%), Positives = 416/492 (84%), Gaps = 5/492 (1%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNS----TFRTETDAFGEINVPADKYWGAQTQRSFQN 56
           MLR S  S + + Q+     + R+ S    ++R ETDAFGEI VP+DKYWGAQTQRS QN
Sbjct: 1   MLRNSIVS-RGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQN 59

Query: 57  FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFP 116
           FKIGG RERMP P+V AFGVLKKSAA+VNE LG LDP+++K I+QAADEVA GKL +HFP
Sbjct: 60  FKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFP 119

Query: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIA 176
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GSK++HP            TFP+VMHIA
Sbjct: 120 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 179

Query: 177 ASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236
           A  +I   L+PEL  LK AL+ KS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENG
Sbjct: 180 AVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 239

Query: 237 IQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296
           I RV  +L  L FLAQGGTAVGTGLNTK GF   IAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 240 IARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299

Query: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNE 356
           DA+VE SGALNTLA SLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359

Query: 357 ALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGI 416
           A+TQVCVQVMGN+AAITF G+ GQFELNVFKPVMI+NLL+SIRL+ DAS SFRIHCVEGI
Sbjct: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGI 419

Query: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476
           KANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+ +EFD
Sbjct: 420 KANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFD 479

Query: 477 EWVVPENMLGPK 488
           +WV+PE M+GPK
Sbjct: 480 QWVIPEKMIGPK 491

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/460 (79%), Positives = 402/460 (87%)

Query: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87
           FR ETD FGEI VPADKYWGAQTQRS++NFKIGG RERMP P+V AFGVLKKSAAIVNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
            G LD  +SK IQQAADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 148 IGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207
           +GSK++HP            TFPTVMHIAA  +I   LIP++T LK+AL  KSKEFEHIV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ H+L  L FLAQGGTAVGTGLNTK GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
             +IAEQ+SKETG++F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITF G+ GQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           PVMI+NLL+SIRL+ DA  SF IHCVEGI+ANE +I++LL +SLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           KVAKNAHKKGITLKESALELGVLTE EFDEWVVPE MLGP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/473 (76%), Positives = 407/473 (86%), Gaps = 6/473 (1%)

Query: 22  RRMNST------FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75
           RR+ ST      FR ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 15  RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 74

Query: 76  VLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEV 135
           VLKKSAA+VNE LG L+P ++KAIQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 75  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 134

Query: 136 ISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNA 195
           ISNRAIE+LGG++GSKQVHP            TFP+VMHIAA  +I + L+PEL  L+ +
Sbjct: 135 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 194

Query: 196 LEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGT 255
            + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H  ++L FLAQGGT
Sbjct: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254

Query: 256 AVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315
           AVGTGLNT+ GF  +IA Q+S+ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314

Query: 316 IAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFG 375
           IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITF 
Sbjct: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374

Query: 376 GSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVT 435
           G+ GQFELNVFKPVMIANLL+S+RL+ADA+RSFR+HCV+GI+ NE RI +LL +SLMLVT
Sbjct: 375 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 434

Query: 436 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 435 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/461 (77%), Positives = 400/461 (86%)

Query: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87
           FR ETD FGEI VPA+KYWGAQT+RSF+NF+IGG RERMP P+V AFGVLKKSAAIVNE 
Sbjct: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
            G LDP++SK IQ+AADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG 
Sbjct: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 148 IGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207
           +GSKQVHP            +FPTVMHIAA  +I   LIPE+ NL++ALE+KSK+F HIV
Sbjct: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ H+L  L FLAQGGTAVGTGLNT+ GF
Sbjct: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
             KIAEQISKETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRYLGSGP
Sbjct: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I F G+QGQFELNVFK
Sbjct: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           PVMI+NLL+SIRL+ D S+SFRIHCVEGIKANE RI +L+ KSLMLVTALNPKIGYD A+
Sbjct: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           KVAKNAHKKGITLKESA++LG LTE EFDEWVVPE M+GPK
Sbjct: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/464 (76%), Positives = 402/464 (86%)

Query: 24  MNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83
           +N  FR ETDAFGEI VPA+KYWGAQTQRS +NFKIGG RERMP P++ AFG+LKKSAAI
Sbjct: 24  LNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAI 83

Query: 84  VNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143
           VNESLG LDPK+SK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 84  VNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 143

Query: 144 LGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEF 203
           +GG++G+KQ+HP            TFP+VMHIAA  +I   L+PELT L+++ + K++EF
Sbjct: 144 IGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEF 203

Query: 204 EHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNT 263
            HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV  +L  L FLAQGGTAVGTGLNT
Sbjct: 204 SHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNT 263

Query: 264 KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323
           K GF  KIAEQ+SKET ++F+TAPNKFEALAAHDA+VECSGALNT+ACSLFKIA DIRYL
Sbjct: 264 KVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYL 323

Query: 324 GSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFEL 383
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITF G+ GQFEL
Sbjct: 324 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFEL 383

Query: 384 NVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443
           NVFKPVMI+NLLNSIRL+ADAS SFR+HCV+GIKANE +I ++L +SLMLVTALNPKIGY
Sbjct: 384 NVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGY 443

Query: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           D+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPE M+GP
Sbjct: 444 DSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/487 (75%), Positives = 413/487 (84%), Gaps = 6/487 (1%)

Query: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLR S+ +  +++  S     R M+  +R ETD FGEI VPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRASSRAKTSLIGYS----ARMMH--YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIG 54

Query: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120
           GARERMP P+V AFGVLKKSAAIVNE LG LD +++  IQQAADEVA GKL+DHFPLVVF
Sbjct: 55  GARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVF 114

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIE++GG++GSK++HP            TFP+VMHIAA  +
Sbjct: 115 QTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTE 174

Query: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I   L+PE+T LK+AL  K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+
Sbjct: 175 ITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARI 234

Query: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300
            +TL  L +LAQGGTAVGTGLNTK GFD  IAEQISKETG+ F+TAPNKFEALAAHDAIV
Sbjct: 235 ENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIV 294

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 295 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQ 354

Query: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420
           VCVQVMGNNAA+TF G+ GQFELNVFKPVMI+NLL+SIRL+ADA  SFR+HCVEGI+AN 
Sbjct: 355 VCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANR 414

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
            +I+  L  SLMLVTALNPKIGYDAASK+AKNA KK ITLKESALEL  LT +EFDEWV+
Sbjct: 415 EKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVI 474

Query: 481 PENMLGP 487
           PENM+GP
Sbjct: 475 PENMVGP 481

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/461 (77%), Positives = 401/461 (86%)

Query: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87
           +R ETD+FGEI VPADKYWGAQTQRSFQNFKIGG+RER+P P++ AFG+LKKSAAIVNES
Sbjct: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91

Query: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
           LG LDPKV+  I++AADEV  GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAIE++GGK
Sbjct: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151

Query: 148 IGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207
           +GSKQ+HP            TFP+VMHIAA L+I   LIPELT LK+AL+ K+KEF  IV
Sbjct: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+  +L  L FLAQGGTAVGTGLNTK GF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271

Query: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
           D  IAE++SKETG++F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQDIRYLGSGP
Sbjct: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331

Query: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+  GSQGQFELNV+K
Sbjct: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391

Query: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           P+MIANLLNSIRL+ DA +SFRIHC++ +KAN+ +I+E L KSLMLVTALNPKIGYDAAS
Sbjct: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPENM+GPK
Sbjct: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/465 (75%), Positives = 402/465 (86%)

Query: 24  MNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83
           + S+FR ETD+FGEINVP DKYWGAQTQRS QNFKIGG RE++P+P++ AFG+LKKSAAI
Sbjct: 30  IKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAI 89

Query: 84  VNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143
           VNE LG LD +++K I  AADEV+ GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 90  VNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 149

Query: 144 LGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEF 203
           +GGK+GSK VHP            TFPTVMHIAA L+I ++L+PEL +LKN+L+ KS EF
Sbjct: 150 MGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEF 209

Query: 204 EHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNT 263
             IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+   L  L FLAQGGTAVGTGLNT
Sbjct: 210 NDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNT 269

Query: 264 KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323
           K GFD  IAEQIS+ETG+ F+TAPNKFEALAAHDAIVE SGALNTLACSLFKIAQDIRYL
Sbjct: 270 KAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYL 329

Query: 324 GSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFEL 383
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVC+QVMGN++ ITF GSQGQFEL
Sbjct: 330 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFEL 389

Query: 384 NVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443
           NV+KP++I+NLL+SIRL+ DAS SFR+HC++G+KAN   I E L KSLMLVTALNP IGY
Sbjct: 390 NVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGY 449

Query: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           D ASK+AKNAH K ITLKESALELG+LTE++F EWV+PE M+GPK
Sbjct: 450 DNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/460 (76%), Positives = 398/460 (86%)

Query: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88
           R ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104

Query: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LDPK++ AI+QAADEVA+GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164

Query: 149 GSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208
           GSK VHP            TFPTVMHIAA L I K+L+P LT LK++L+ KS+EF  IVK
Sbjct: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  TL +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284

Query: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
             +A +++KETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344

Query: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388
           CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITF G+ GQFELNVFKP
Sbjct: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404

Query: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           VMI+NLL+SI L++DAS SFR+HCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 405 VMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/459 (71%), Positives = 392/459 (85%)

Query: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88
           R E D FGE+ VPA+KYWGAQTQR+  NF IGG RERMP PL+ A+G+LKKS AIVNESL
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LDPK+SKAIQ+AADEVA G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIEILGG++
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 149 GSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208
           GSK VHP            +FPT MHI+A  ++  +L+PEL  L++AL+ KS EF  IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGYVQQVENGI RV ++L  L F+AQGGTAVGTG+NTK  FD
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
           + +A+QIS ETG++F+TAPNKFEALA+HDAIVECSGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388
           CGY EL LPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITF G+ GQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           +MI+NLLNSIRL+ D+  SFRIHC+ GI+ANE +I++LL +SLMLVTALNPKIGYDAA+ 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE+M+ P
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/463 (73%), Positives = 400/463 (86%)

Query: 26  STFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVN 85
           S+FR ETD+FGEI VP++KYWGAQTQRSFQNFKIGG RE++PLP++ AFG+LKKSAAIVN
Sbjct: 12  SSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVN 71

Query: 86  ESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145
           +SLG LDP ++  I +A+DEV  GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G
Sbjct: 72  QSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIG 131

Query: 146 GKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEH 205
            ++GSK++HP            TFP+VMHIAA L++   LIP+LT LKN+L+ K+KE+ +
Sbjct: 132 AELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYAN 191

Query: 206 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKP 265
           IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  +L  L FLAQGGTAVGTGLNTK 
Sbjct: 192 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKV 251

Query: 266 GFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGS 325
           GFD  IA+++SKETG+ F+TAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLGS
Sbjct: 252 GFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGS 311

Query: 326 GPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNV 385
           GPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I   GSQGQFELNV
Sbjct: 312 GPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNV 371

Query: 386 FKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDA 445
           +KP+MIANLLNSIRL++DA  SF+IHCV+G+KAN  +I+E L KSLMLVTALNPKIGYDA
Sbjct: 372 YKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDA 431

Query: 446 ASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           ASK+AKNAH K ITLKESALELG+LTE+EFD+WV+PENM+GPK
Sbjct: 432 ASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/459 (70%), Positives = 374/459 (81%)

Query: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88
           RTETD+FGEI VPA+KYWGAQTQRSF NFKIGG RERMP P++ AFG  KK+AAIVN SL
Sbjct: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100

Query: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LD  +  AI QAA+EV+ G L++HFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG +
Sbjct: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160

Query: 149 GSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208
           GSKQVHP            TFPTVMHIAA  +I   L+P L  L+  L++K+KEFE I+K
Sbjct: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGY QQ+ N I+R+   L  L ++AQGGTAVGTGLNTK GF 
Sbjct: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280

Query: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
            + A Q+S +T L F T+PNKFE+LAAHDAIV    +LNTLACSLFKI+QDIRYL SGPR
Sbjct: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340

Query: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388
           CGY EL +PENEPGSSIMPGKVNPTQNEA+ Q CVQVMGNN+ I+F G+ GQFELN +KP
Sbjct: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400

Query: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           +MIANLL+S RL++DA  SF +HC  GI+AN+ +I  LL +SLMLVT+LNPKIGYDAASK
Sbjct: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           VAKNAH KGITLK+SALEL +L+ K+FDEWV PENMLGP
Sbjct: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 86/194 (44%), Gaps = 35/194 (18%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           LIP+L N+ N L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQ-----ISKETGLKFQTAPNKF 290
             + F    GT        A+  G + K    D ++AE      I   TG   QT   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTG---QTYSRKV 244

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLP--ENEPGSSIMPG 348
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 349 KVNPTQNEALTQVC 362
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 102/275 (37%), Gaps = 30/275 (10%)

Query: 94  KVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQV 153
           KV   ++Q   E AAG+   H            +    ANE    R  EI+G +I  K V
Sbjct: 63  KVHHGLEQIEKEWAAGEFARH---------PSDEDIHTANE---RRLGEIIGREISGK-V 109

Query: 154 HPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTH 213
           H                T M I     + + L+P L      L  ++KE   ++  G TH
Sbjct: 110 HTGRSRNDQV------ATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEIDVLMPGYTH 163

Query: 214 LQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAE 273
           LQ A P+      S Y         R+   ++ L+    G  A+        G D +   
Sbjct: 164 LQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA---GHPYGIDREFLA 220

Query: 274 QISKETGLKFQ-TAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYN 332
           +     GL FQ    N   A++  D +VE           + + ++D+  + S    G+ 
Sbjct: 221 R-----GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-IIYSTAEFGFI 274

Query: 333 ELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 367
           +L       GSS+MP K NP   E L     +V G
Sbjct: 275 KLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           LIP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGTAVGT---------GLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEA 292
             +      GT  GT         G + K    D ++AE +   T      QT   K + 
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKID- 245

Query: 293 LAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLP--ENEPGSSIMPGKV 350
                  ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K 
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKR 293

Query: 351 NPTQNEALTQVC 362
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 84/191 (43%), Gaps = 29/191 (15%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           LIP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLP--ENEPGSSIMPGKVN 351
                 ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNEALTQVC 362
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 84/191 (43%), Gaps = 29/191 (15%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLP--ENEPGSSIMPGKVN 351
                 ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNEALTQVC 362
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQI--SKETGLKFQTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +   K   +  QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 81/191 (42%), Gaps = 29/191 (15%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           LIP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGTAVGTGL---------NTKPGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT    G          +     D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLP--ENEPGSSIMPGKVN 351
                 ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNEALTQVC 362
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   T+G+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 84/191 (43%), Gaps = 29/191 (15%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ N L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLP--ENEPGSSIMPGKVN 351
                 ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLSPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNEALTQVC 362
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQI--SKETGLKFQTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +   K   +  QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQI--SKETGLKFQTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +   K   +  QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 29/191 (15%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           LIP+L N+ N L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLP--ENEPGSSIMPGKVN 351
                 ++    L + A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLCSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNEALTQVC 362
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQI--SKETGLKFQTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +   K   +  QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 81/203 (39%), Gaps = 11/203 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T + I     + ++L P +T+L   L  +++E   I+  G THLQ A P+      S Y 
Sbjct: 120 TDLRIYCRDVLNEKLFPGMTSLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQ-TAPNK 289
                 ++R+   L+  +    G  A+        G    I  +   E GL F     N 
Sbjct: 180 TYFTEDLKRLKQILERFNKSPLGAGALA-------GHPYGIDREFLAE-GLGFDGVIGNS 231

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D +VE           + + A+D+  + S    G+ +L       GSS+MP K
Sbjct: 232 LVAVSDRDFVVELMFWGTLFMNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQK 289

Query: 350 VNPTQNEALTQVCVQVMGNNAAI 372
            N    E L     +V G+ A  
Sbjct: 290 KNADSLELLRGKSGRVFGDLAGF 312

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ + L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 11/203 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T M I     +   ++P L++L   +  +++E   ++  G THLQ A P+      S Y 
Sbjct: 119 TDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYA 178

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQ-TAPNK 289
                  +R+   ++ L+    G  A+        G D +         GL F     N 
Sbjct: 179 TYFTEDYKRLQQIVERLNVSPLGAGALA---GHPYGIDREFLA-----AGLNFNGVIGNS 230

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A+A  D +VE     +     + + A+D+  + S    G+ +L       GSS+MP K
Sbjct: 231 LTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQK 288

Query: 350 VNPTQNEALTQVCVQVMGNNAAI 372
            NP   E L     +V G  A  
Sbjct: 289 KNPDSLELLRGKSGRVFGQLAGF 311

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             L      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 79/202 (39%), Gaps = 9/202 (4%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T M +     ++ ++ P L  L   L  +++E   ++  G THLQ A P+      S Y 
Sbjct: 120 TDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKF 290
                  +R+   +  L+   Q     G       G D    E ++ E G       N  
Sbjct: 180 TYFVEDFKRLKEVIARLN---QSPLGAGALAGHPYGID---REYLACELGFD-GVIGNSM 232

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKV 350
            A++  D +VE     +     + ++A+D+  + S    G+ +L       GSS+MP K 
Sbjct: 233 TAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKR 290

Query: 351 NPTQNEALTQVCVQVMGNNAAI 372
           NP   E L     +V G  A  
Sbjct: 291 NPDSLELLRGKSGRVFGQLAGF 312

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 78/199 (39%), Gaps = 11/199 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T + I     + ++L P LT+L   L  + +E   I+  G THLQ A P+      S Y 
Sbjct: 120 TDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQ-TAPNK 289
                 + R+   L   +    G  A+        G    I  +   E GL+F     N 
Sbjct: 180 TYFTEDLNRLKQILVRFNKSPLGAGALA-------GHPYGIDREFLAE-GLEFNGVIGNS 231

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D +VE           + + A+D+  + S    G+ +L       GSS+MP K
Sbjct: 232 LVAVSDRDFVVELMFWSTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQK 289

Query: 350 VNPTQNEALTQVCVQVMGN 368
            N    E L     +V G+
Sbjct: 290 KNADSLELLRGKSGRVFGD 308

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 41/197 (20%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQV----------- 233
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++           
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 234 -ENGIQRVAHTLKT-LSFLA--QGGTAVGTGLNTKP----GFDVKIAEQISKETGLKFQT 285
            + G++ V  T  T  SFLA   G       L+ +     GFD+     +   TG   QT
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDI-----VYPVTG---QT 239

Query: 286 APNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSI 345
              K +        ++  G+ ++   +  K+A DIR L +       E    + + GSS 
Sbjct: 240 YSRKID--------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSA 288

Query: 346 MPGKVNPTQNEALTQVC 362
           M  K NP + E   +VC
Sbjct: 289 MAYKRNPMRCE---RVC 302

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 105/275 (38%), Gaps = 32/275 (11%)

Query: 95  VSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVH 154
           + K + +   E ++GK ++H            +    ANE    R  E++G  +  K VH
Sbjct: 63  IHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGELIGTAVAGK-VH 109

Query: 155 PXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHL 214
                           T M I     + ++++P +++    L  +++E   ++  G THL
Sbjct: 110 TGRSRNDQV------ATDMRIYCREILNEKILPAVSSFIRVLINRAREEVDVLMPGYTHL 163

Query: 215 QDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVK-IAE 273
           Q A P+      S Y         R+   ++ L+   Q     G       G D K +AE
Sbjct: 164 QRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAGHPYGIDRKYLAE 220

Query: 274 QISKETGLKFQ-TAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYN 332
           Q      L F     N   A++  D ++E     +     + + A+D+  + S    G+ 
Sbjct: 221 Q------LGFNGIIGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFI 273

Query: 333 ELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 367
            L       GSS+MP K NP   E L     +V G
Sbjct: 274 NLA-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 76/203 (37%), Gaps = 11/203 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T + I     +  +L P+L  L + +  + KE   ++  G THLQ A P+      S Y 
Sbjct: 120 TDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQ-TAPNK 289
                  +R+   +  ++   Q     G       G D +         GL F     N 
Sbjct: 180 TYFTEDFKRLRQIMDRIN---QSPLGAGALAGHPYGIDREFL-----AAGLGFDGVIGNS 231

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D IVE           + + A+D+  + S    G+ +L       GSS+MP K
Sbjct: 232 LVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQK 289

Query: 350 VNPTQNEALTQVCVQVMGNNAAI 372
            N    E L     +V G+ A  
Sbjct: 290 KNADSLELLRGKSGRVFGDLAGF 312

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 79/203 (38%), Gaps = 11/203 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T M I     + ++L+P + +L   L  +++     +  G THLQ A P+      S Y 
Sbjct: 120 TDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKF-QTAPNK 289
                  +R+   L+ L+    G  A+        G    I  +   E GL F     N 
Sbjct: 180 TYFTEDYKRLKQILERLNVSPLGAGALA-------GHPYGIDREFLAE-GLNFGGVIGNS 231

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D +VE           + + A+D+  + S    G+ +L       GSS+MP K
Sbjct: 232 LVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQK 289

Query: 350 VNPTQNEALTQVCVQVMGNNAAI 372
            N    E L     +V G+ A  
Sbjct: 290 KNADSLELLRGKSGRVFGDLAGF 312

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 79/198 (39%), Gaps = 11/198 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T M I     + +++ P + +L N L  ++++   I+  G THLQ A P+      S Y 
Sbjct: 121 TDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYA 180

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQ-TAPNK 289
                 ++R+    + L+    G  A+        G    I  Q   E GL F     N 
Sbjct: 181 TYFTEDLKRLEQIAERLNKSPLGSGALA-------GHPYGIDRQFLAE-GLGFNGVIGNS 232

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D +VE           + + ++D+  + S    G+ +L       GSS+MP K
Sbjct: 233 LVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQK 290

Query: 350 VNPTQNEALTQVCVQVMG 367
            N    E L     +V G
Sbjct: 291 KNADSLELLRGKSGRVFG 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 76/199 (38%), Gaps = 11/199 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T + I     +   L P L  L + L  ++K   +I+  G THLQ A P+      S Y 
Sbjct: 120 TDLRIYCRDVVNDNLFPALKGLVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTA-PNK 289
                  +R+   L  L+    G  A+        G    I  +   E GL F +   N 
Sbjct: 180 TYFTEDYKRLDQILHRLNQSPLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNS 231

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D IVE           + + A+D+  +      G+ +L       GSS+MP K
Sbjct: 232 MVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQK 289

Query: 350 VNPTQNEALTQVCVQVMGN 368
            N    E L     +V G+
Sbjct: 290 KNADSLELLRGKSGRVFGD 308

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           +IP+L N+ + L   +  ++ +  +G TH Q A   TLG+  + ++Q +   ++      
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  ET      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    + + GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 81/202 (40%), Gaps = 9/202 (4%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T M I     + ++L+P L  L + +  ++++    +  G THLQ A P+      S Y 
Sbjct: 120 TDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKF 290
                 ++R+   L+  +   Q     G       G D    E +++E G +     N  
Sbjct: 180 TYFTEDLKRLRQLLERFN---QSPLGAGALAGHPYGID---REFLAEELGFQ-GVIGNSL 232

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKV 350
            A++  D +VE           + + A+D+  + S    G+ +L       GSS+MP K 
Sbjct: 233 VAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKK 290

Query: 351 NPTQNEALTQVCVQVMGNNAAI 372
           N    E L     +V G+ A  
Sbjct: 291 NADSLELLRGKSGRVFGDLAGF 312

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 77/203 (37%), Gaps = 11/203 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T + I     I+ +L+P L +L   L  + +    I+  G THLQ A P+      S Y 
Sbjct: 118 TDLRIYCRDIIQDKLLPSLKSLIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYA 177

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQ-TAPNK 289
                  +R+   L  L+    G  A+        G D +         GL F     N 
Sbjct: 178 TYFTEDYKRLKQLLDRLNVSPLGAGALA---GHPYGIDREFLAN-----GLGFNGVIGNS 229

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D +VE           + + A+D+  + S    G+  L       GSS+MP K
Sbjct: 230 LVAVSDRDFVVELLFWGTLFMNHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQK 287

Query: 350 VNPTQNEALTQVCVQVMGNNAAI 372
            N    E L     +V GN + +
Sbjct: 288 KNSDSLELLRGKSGRVFGNLSGL 310

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 88/245 (35%), Gaps = 35/245 (14%)

Query: 132 ANEVISNRAIEILGGKIGSKQVHPXXXXXXXXXXXXTFPTVMHIAASLQIEKELIPELTN 191
           ANE    R  EI+G KI  K VH                T + I     +  +L+  L  
Sbjct: 91  ANE---RRLGEIIGTKISGK-VHTGRSRNDQCV------TDLRIYCREYLSDKLLKNLET 140

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLA 251
           L N L  +++E    +  G THLQ A P+      S Y        +R+    + L+   
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 252 QGGTAVG--------TGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECS 303
            G  A+           L  K GFD  I                N   A++  D +VE  
Sbjct: 201 LGAGALAGHPYGIDREYLAEKLGFDSVIG---------------NSLVAVSDRDFVVEIL 245

Query: 304 GALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCV 363
                    + + A+D+  + S    G+ +L       GSS+MP K N    E L     
Sbjct: 246 FWSTLFMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSG 303

Query: 364 QVMGN 368
           +V GN
Sbjct: 304 RVFGN 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 75/199 (37%), Gaps = 11/199 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T + I     +   L P +  L + L  +++    I+  G THLQ A P+      S Y 
Sbjct: 120 TDLRIYCRDVVNDSLFPAMKGLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTA-PNK 289
                  +R+   L  L+    G  A+        G    I  +   E GL F +   N 
Sbjct: 180 TYFTEDYKRLVQILHRLNQSPLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNS 231

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D IVE           + + A+D+  +      G+ +L       GSS+MP K
Sbjct: 232 LVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQK 289

Query: 350 VNPTQNEALTQVCVQVMGN 368
            N    E L     +V G+
Sbjct: 290 KNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 74/186 (39%), Gaps = 11/186 (5%)

Query: 183 KELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAH 242
           ++L+P + +L   +  +++    I+  G THLQ A P+      S Y        +R+  
Sbjct: 132 EKLLPFMIDLVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQ 191

Query: 243 TLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQ-ISKETGLKFQTAPNKFEALAAHDAIVE 301
            L+ L+    G  A+        G    I  Q +S E G       N   A++  D IV+
Sbjct: 192 VLERLNKCPLGAGAIA-------GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVD 243

Query: 302 CSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQV 361
                      + + ++D+  + S    G+ +L       GSS+MP K N    E L   
Sbjct: 244 IMFWSTLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGK 301

Query: 362 CVQVMG 367
             +V G
Sbjct: 302 SGRVFG 307

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           LIP+L N+ N L   +   + +  +G TH Q A   TLG+  + ++Q++   ++      
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDVKIAEQISKETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 71/185 (38%), Gaps = 11/185 (5%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTL 244
           L P L  L + L  +++    I+  G THLQ A P+      S Y        +R+   L
Sbjct: 134 LFPALKGLVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQIL 193

Query: 245 KTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTA-PNKFEALAAHDAIVECS 303
             L+    G  A+        G    I  +   E GL F +   N   A++  D IVE  
Sbjct: 194 HRLNQSPLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELM 245

Query: 304 GALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCV 363
                    + + A+D+  +      G+ +L       GSS+MP K N    E L     
Sbjct: 246 FWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSG 303

Query: 364 QVMGN 368
           +V G+
Sbjct: 304 RVFGD 308

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 74/199 (37%), Gaps = 11/199 (5%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T + I     +   L P L  L   L  +++    ++  G THLQ A P+      S Y 
Sbjct: 120 TDLRIYCRDIVNDTLFPALKGLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYA 179

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTA-PNK 289
                  +R+   L  L+    G  A+        G    I  +   E GL F +   N 
Sbjct: 180 TYFTEDYKRLGQILHRLNQSPLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNS 231

Query: 290 FEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGK 349
             A++  D IVE           + + A+D+  +      G+ +L       GSS+MP K
Sbjct: 232 LVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQK 289

Query: 350 VNPTQNEALTQVCVQVMGN 368
            N    E L     +V G+
Sbjct: 290 KNADSLELLRGKSGRVFGD 308

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 68/167 (40%), Gaps = 25/167 (14%)

Query: 210 GRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTG-LNTKP-GF 267
           G THLQ A P+      + Y        +R+    + L+      + +G G L   P G 
Sbjct: 160 GYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNV-----SPLGCGALAGHPYGI 214

Query: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLF-----KIAQDIRY 322
           D    E I++  G       N  +A++  D +VE         CSLF     + ++D+  
Sbjct: 215 D---REHIAERLGFD-GVIGNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDLII 265

Query: 323 LGSGPRCGYNELMLPE-NEPGSSIMPGKVNPTQNEALTQVCVQVMGN 368
             +     +N + L +    GSS+MP K NP   E L     +V G+
Sbjct: 266 YSTAE---FNFVKLSDAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 79/192 (41%), Gaps = 25/192 (13%)

Query: 189 LTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLS 248
           L +L  A+  +S++    +  G THLQ A P+      + Y        +R+    + L+
Sbjct: 139 LEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLN 198

Query: 249 FLAQGGTAVGTG-LNTKP-GFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGAL 306
                 + +G G L   P G D    E +++  G       N  +A++  D +VE     
Sbjct: 199 V-----SPLGCGALAGHPYGID---REFLAERLGFS-DVIGNSLQAVSDRDFVVEI---- 245

Query: 307 NTLACSLF-----KIAQDIRYLGSGPRCGYNELMLPE-NEPGSSIMPGKVNPTQNEALTQ 360
               CSLF     + ++D+    +     +N + L +    GSS+MP K NP   E L  
Sbjct: 246 -MFWCSLFMNHISRFSEDLIIYSTAE---FNFVKLSDAYSTGSSLMPQKKNPDSLELLRG 301

Query: 361 VCVQVMGNNAAI 372
              +V G+ A  
Sbjct: 302 KSGRVFGSLAGF 313

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 77/202 (38%), Gaps = 9/202 (4%)

Query: 171 TVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 230
           T M I     +   L+  L  L + +  ++ E   I+  G THLQ A P+      S Y 
Sbjct: 121 TDMRIYCRDILTNNLLTYLKELISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSFYA 180

Query: 231 QQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKF 290
                  +R+   L  L+    G  A+        G D +   Q    +G+      N  
Sbjct: 181 TYFTEDYKRLQEILARLNVSPLGAGALA---GHPYGIDREFLAQDLGFSGV----IGNSL 233

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKV 350
            A++  D +VE     +     + + ++D+  + S    G+ +L       GSS+MP K 
Sbjct: 234 VAVSDRDFVVEIMFWGSLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKK 291

Query: 351 NPTQNEALTQVCVQVMGNNAAI 372
           N    E L     +V G+ A  
Sbjct: 292 NADSLELLRGKSGRVFGDLAGF 313

>YNL239W Chr14 (200569..201933) [1365 bp, 454 aa] {ON}  LAP3Cysteine
           aminopeptidase with homocysteine-thiolactonase activity;
           protects cells against homocysteine toxicity; has
           bleomycin hydrolase activity in vitro; transcription is
           regulated by galactose via Gal4p; orthologous to human
           BLMH
          Length = 454

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 355 NEALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVE 414
           NE L+++ V+ + NN A+ FG    +F ++    VM   L N   +  +  +        
Sbjct: 304 NETLSKLVVKRLQNNKAVFFGSHTPKF-MDKKTGVMDIELWNYPAIGYNLPQQ------- 355

Query: 415 GIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALE-LGVLTEK 473
             KA+  R HE L    ML+T  +     D  SK+      +    K+S  + L V+T+K
Sbjct: 356 --KASRIRYHESLMTHAMLITGCH----VDETSKLPLRYRVENSWGKDSGKDGLYVMTQK 409

Query: 474 EFDEW 478
            F+E+
Sbjct: 410 YFEEY 414

>Skud_14.100 Chr14 (189127..190578) [1452 bp, 483 aa] {ON} YNL239W
           (REAL)
          Length = 483

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 15/125 (12%)

Query: 355 NEALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVE 414
           NE L+++ V+ + NN A+ FG    +F ++    VM   L N   +  +  +        
Sbjct: 333 NETLSKLVVKRLQNNKAVFFGSHTPKF-MDKKTGVMDVQLWNYPAIGYNLPQQ------- 384

Query: 415 GIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALE-LGVLTEK 473
             KA+  + HE L    ML+T  +     D ASK+      +    KES  + L ++T++
Sbjct: 385 --KASRIKYHESLMTHAMLITGCH----VDEASKLPIRYRVENSWGKESGKDGLYIMTQQ 438

Query: 474 EFDEW 478
            F+E+
Sbjct: 439 YFEEY 443

>ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} similar
           to uniprot|P48361 Saccharomyces cerevisiae YGR097W ASK10
           Component of the RNA polymerase II
          Length = 1130

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 172 VMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQ 231
           V  +  S +I   L+P + +L+  L++K KE + +    RT++ +   +T GQ  + Y+ 
Sbjct: 278 VQQLKISKEINMNLLPRIEDLRRDLQSKIKEIKELSGDFRTNINEHVAIT-GQLLNRYIS 336

Query: 232 QVENGIQRVAHT 243
            V+     VA +
Sbjct: 337 SVKYMTTNVADS 348

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,656,416
Number of extensions: 1790153
Number of successful extensions: 4880
Number of sequences better than 10.0: 66
Number of HSP's gapped: 4992
Number of HSP's successfully gapped: 66
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)