Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.426.10ON65459727210.0
Smik_6.4716.10ON65159725670.0
YPL263C (KEL3)6.10ON65159725480.0
Skud_16.146.10ON65259825350.0
Kpol_1045.776.10ON65061015220.0
NCAS0D021906.10ON64560315190.0
TPHA0M002006.10ON63460315020.0
ZYRO0F00484g6.10ON64360214820.0
ACR016W6.10ON64060714800.0
KLLA0D00836g6.10ON64060314710.0
SAKL0E00880g6.10ON63660314600.0
TBLA0G011106.10ON63860314580.0
CAGL0A01067g6.10ON64160514540.0
NDAI0I027506.10ON66358414430.0
TDEL0G046106.10ON63360714380.0
KAFR0B065006.10ON63660314180.0
KNAG0E027806.10ON65060214020.0
Kwal_56.223506.10ON65860313940.0
KLTH0C11528g6.10ON64260513541e-179
KLTH0C01474g5.88ON10562601566e-10
Kpol_1050.695.88ON10842611531e-09
NCAS0F005205.88ON10862531469e-09
Smik_16.685.88ON8942931451e-08
Kwal_14.10195.88ON9782601451e-08
YGR238C (KEL2)5.88ON8822491441e-08
Suva_7.5305.88ON8942521387e-08
Smik_8.2425.88ON11682561361e-07
SAKL0H02618g5.88ON10852061352e-07
Skud_8.2225.88ON11692511333e-07
KAFR0B043205.88ON9862591324e-07
Ecym_20615.88ON13622111324e-07
KNAG0K005605.88ON11042591314e-07
YHR158C (KEL1)5.88ON11642511316e-07
Suva_15.3575.88ON11722581307e-07
CAGL0F07997g5.88ON9362681272e-06
Skud_7.5725.88ON8831941262e-06
TPHA0H010805.88ON8282651225e-06
ZYRO0B08228g5.88ON12932621209e-06
KLLA0E15511g5.88ON9052591153e-05
Kpol_1010.625.88ON9732531154e-05
NDAI0D026005.88ON11671491154e-05
ADL149W5.88ON12112061137e-05
TDEL0G011205.88ON10091381101e-04
CAGL0I02090g5.88ON11362051092e-04
TBLA0C065305.88ON11722561083e-04
TPHA0A051705.88ON10161291000.002
SAKL0C13530g3.15ON697112930.014
YOL141W (PPM2)3.15ON695138830.20
KAFR0C049107.9ON87861830.25
KAFR0I029103.15ON691233820.29
Smik_15.133.15ON71977790.63
Suva_8.1755.440ON45394761.3
ADR414C7.9ON784120761.5
ZYRO0C00550g7.9ON84859761.6
Suva_15.193.15ON70880742.5
Smik_1.97.9ON87457742.5
KLLA0F00374g7.9ON79560743.0
Suva_1.107.9ON89258733.2
TBLA0A043207.9ON83863733.3
Skud_15.133.15ON69581733.3
TBLA0D021208.157ON1479227733.4
NDAI0A088607.9ON85689733.7
KAFR0I002007.9ON75358716.6
KLLA0F00462g7.5ON628119699.3
ZYRO0G05148g2.92ON109066699.6
KNAG0E041807.9ON81928699.8
SAKL0D14740g7.9ON84090699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.42
         (654 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...  1052   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   993   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   986   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   981   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   590   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   589   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   583   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   575   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   574   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   571   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   566   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   566   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   564   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   560   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   558   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   550   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   544   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   541   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   526   e-179
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    65   6e-10
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    64   1e-09
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    61   9e-09
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    60   1e-08
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    60   1e-08
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    60   1e-08
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    58   7e-08
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    57   1e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    57   2e-07
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    56   3e-07
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    55   4e-07
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    55   4e-07
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    55   4e-07
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    55   6e-07
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    55   7e-07
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    54   2e-06
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    53   2e-06
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    52   5e-06
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    51   9e-06
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    49   3e-05
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    49   4e-05
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    49   4e-05
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    48   7e-05
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    47   1e-04
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    47   2e-04
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    46   3e-04
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    43   0.002
SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]...    40   0.014
YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}  PPM2AdoMet-...    37   0.20 
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    37   0.25 
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    36   0.29 
Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W (...    35   0.63 
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...    34   1.3  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    34   1.5  
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    34   1.6  
Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W (...    33   2.5  
Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)     33   2.5  
KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON...    33   3.0  
Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)    33   3.2  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    33   3.3  
Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W (...    33   3.3  
TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8....    33   3.4  
NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa] ...    33   3.7  
KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9 Y...    32   6.6  
KLLA0F00462g Chr6 complement(33094..34980) [1887 bp, 628 aa] {ON...    31   9.3  
ZYRO0G05148g Chr7 complement(413934..417206) [3273 bp, 1090 aa] ...    31   9.6  
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    31   9.8  
SAKL0D14740g Chr4 complement(1212855..1215377) [2523 bp, 840 aa]...    31   9.9  

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/597 (87%), Positives = 520/597 (87%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
           HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY
Sbjct: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237

Query: 238 KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD 297
           KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD
Sbjct: 238 KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXXXXX 417
           LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAK            
Sbjct: 358 LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEEDDNDD 417

Query: 418 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 477
                                       ITISNQLPHPRFNAATCVVDDSLFIYSGVWEL
Sbjct: 418 STATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 477

Query: 478 GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 537
           GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLG                      
Sbjct: 478 GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDDDEDDDE 537

Query: 538 XXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 597
             PQDTRLL             GQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS
Sbjct: 538 EEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 597

Query: 598 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR 654
           ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR
Sbjct: 598 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR 654

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/597 (82%), Positives = 504/597 (84%), Gaps = 3/597 (0%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           FTKKQTELEHVDITAVERPSCR HPLMFANPQHNKHELFIFGGEFTD ETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVSQNAPLPRSS AVAVH SGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
            E+KF KLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLG+GQTSYLNDLWCFDISNY
Sbjct: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 238 KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD 297
           KW+K+ETN+KPDARSGHCF+PTDNSAILMGGYCKTIAKNNKNLMKGKILND+WKL LTPD
Sbjct: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESL+S+FYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXXXXX 417
           LELNKWSKLRIK QR T+NRN+PATSKRKSNKDQEKELQDLLNSILAK            
Sbjct: 358 LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAK--SNLNDDDDEN 415

Query: 418 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 477
                                       ITISNQLPHPRFNAATCVV DSLFIYSGVWEL
Sbjct: 416 DDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWEL 475

Query: 478 GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 537
           GEKDYPINSFYSIDLNKLDGVKVYWE+LS +EEAKRLG                      
Sbjct: 476 GEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDDEDQSE 535

Query: 538 XXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 597
              QD  LL             GQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS
Sbjct: 536 EE-QDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594

Query: 598 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR 654
           ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERD T KPSKRR
Sbjct: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/597 (81%), Positives = 502/597 (84%), Gaps = 3/597 (0%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F+KKQ ELEHVDIT+VE+PSCR HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY
Sbjct: 58  FSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVSQNAPLPRSS AVAVH SGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
            E+KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLG+GQTSYLNDLWCFDIS Y
Sbjct: 178 VERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTY 237

Query: 238 KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD 297
           KWTKLETN+KPDARSGHCF+PTDNSAILMGGYCK IAKNNKNLMKGKILND+WKL LTPD
Sbjct: 238 KWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESL+S+FYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXXXXX 417
           LELNKWSKLRIKPQR TN++N+PATSKRKSNKDQEKELQDLLNSILAK            
Sbjct: 358 LELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAK--SNLNDDDDDN 415

Query: 418 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 477
                                       ITISNQLPHPRFNAATCVV DSLFIYSGVWEL
Sbjct: 416 DDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWEL 475

Query: 478 GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 537
           GEKDYPINSFYSIDLNKLDGVKVYWEDLS +EEAKRLG                      
Sbjct: 476 GEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEEDEDDGE 535

Query: 538 XXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 597
              QD   L              QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS
Sbjct: 536 EE-QDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594

Query: 598 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR 654
           ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERD T KPSKRR
Sbjct: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDTTTKPSKRR 651

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/598 (81%), Positives = 502/598 (83%), Gaps = 4/598 (0%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           FTKKQTELEHVDITAVER SCR HPLMFANPQHNK ELFIFGGEFTDPETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVS+NAPLPRSS AVAVH SGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
            E+KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLG+GQTSYLNDLWCFDISNY
Sbjct: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 238 KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD 297
           KWTKLETNTKP+ARSGHCF+PTDNSAILMGGYCK IAKNNKNLMKGKILND+WKL LTPD
Sbjct: 238 KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESL+S+FYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXXXXX 417
           LELNKWSKLRIKPQR TNN+NAP TSKRKSNKDQEKELQDLLNSILAK            
Sbjct: 358 LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAK---SNLNDDDDD 414

Query: 418 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 477
                                       ITISNQLPHPRFNAATCVVDDSLFIYSGVWEL
Sbjct: 415 DNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474

Query: 478 GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLG-XXXXXXXXXXXXXXXXXXXXX 536
           GEKDYPINSFYSIDLNKLDGV VYWEDLST+EEAKRLG                      
Sbjct: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDDGEDN 534

Query: 537 XXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 596
               QD  LL             GQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW
Sbjct: 535 DEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594

Query: 597 SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR 654
           SISNN++LKGK LKTKSFE+CEDRWWERRDQVTLEEERLEDTGGIIERD T K SKRR
Sbjct: 595 SISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR 652

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/610 (50%), Positives = 387/610 (63%), Gaps = 27/610 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   E ++I +VERPS R++P M  NP H K EL +FGGE T+ +T  T F+NDLY
Sbjct: 55  FKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDLY 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SY+ +N+ W++Y S+N+P+PRSS A+A H SG+AL+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 115 SYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWLLDC 174

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K++TK+E   + + PSARSGHRI  WKNYF+L GGFRDLG+  T+YLND W FDI+NY
Sbjct: 175 STKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTYLNDCWLFDITNY 230

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +  PDARSGH F+PT   A+L GGYCK   K  K L KGKIL D W L +
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCK--VKAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESLDS+FYNDL+
Sbjct: 289 KADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMFYNDLF 347

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKX------XX 408
            + +E+N+W  L+++PQR    R        KS+KD+EKELQDLLN IL K         
Sbjct: 348 SYQIEINRWFALQLRPQRKKVVR-----LNNKSSKDKEKELQDLLNQILEKANLNDKDDK 402

Query: 409 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSL 468
                                                  +  QLPHPRFNA   VV+D+L
Sbjct: 403 DQEDEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTL 462

Query: 469 FIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXX 528
           FIY GVWELGEKDY I+SFYSIDLN+ DGV V WEDLS +E AK  G             
Sbjct: 463 FIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGD 522

Query: 529 XXXXXXXXXXXPQDTRLLXXXXXXXXXXXXXGQA-QMEIPDERSWLPHPKPFETLRAFYL 587
                        D +L+              Q  +MEIPD   WLPHPKPFE+LR FY+
Sbjct: 523 SDDEDDGEEEI-MDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYV 581

Query: 588 REGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI---IER 644
           R GA FL W+ISNNR+ +GK LK KSF+LC+DRWW+RRDQV +EE+++E+ GGI   IE+
Sbjct: 582 RTGATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEK 641

Query: 645 DATAKPSKRR 654
           D T+K +KRR
Sbjct: 642 D-TSKSTKRR 650

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/603 (50%), Positives = 386/603 (64%), Gaps = 19/603 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F  +Q + EHV++ ++ +P+ R++  M   P H+K EL IFGGEFT+PET +THFYN+L 
Sbjct: 56  FKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELI 115

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS  N  W+K  SQN+P+PRSS A+  H SGIALLHGGEFSSPKQ+ FYHYSDTWL D 
Sbjct: 116 TYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDT 175

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
           H K++TK++       P  RSGHRI  WKNYFIL GGF+DLG   TSY ND WCFDI+ Y
Sbjct: 176 HTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGHS-TSYFNDCWCFDITTY 231

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +  PDARSGH ++PT+   IL GGYCK   K  K L KGKILND W L +
Sbjct: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKV--KAGKGLQKGKILNDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESL+SIFYNDL+
Sbjct: 290 KSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIFYNDLF 348

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            +++E N+W  L ++  +    +    +S  KS+K++EKELQDLLN IL K         
Sbjct: 349 SYNVESNRWFSLSLR--KAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEK-NNLKDDDD 405

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                          +T+ +QLPHPRFNAAT VVDDSLFIY G+
Sbjct: 406 DDEISTGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGI 465

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WE+GEKDY I+S YSIDLNKLDGV  YWEDL  +E+AK +G                   
Sbjct: 466 WEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDE 525

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                 +D +L+                +MEIPD R WLPHPKPFE+LRAFY+REGA FL
Sbjct: 526 EEI---EDKKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFL 582

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDATAKPS 651
            W+ISNN++++GK LK KSF+LCEDRWWERRDQV +EE++LE+    G +IE+D +   S
Sbjct: 583 EWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTS 642

Query: 652 KRR 654
           KRR
Sbjct: 643 KRR 645

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/603 (50%), Positives = 385/603 (63%), Gaps = 30/603 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E +++ +V++P+ R++  M ANP H K EL +FGGE T  E  +THFYNDLY
Sbjct: 56  FKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDLY 115

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +++  N+ WKK  SQN+P+PRSS A+A H SGIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 116 TFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDC 175

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             +++TK+E   + + PSARSGHRI  WKNYFIL GGFRDLGS  TSYLND W FDI++Y
Sbjct: 176 TTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFDITSY 231

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +  PDARSGH  +PT   A+L GGYCK   K  K L KGKIL D W L +
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCK--VKAGKGLQKGKILGDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESLDSIFYNDL+
Sbjct: 290 KADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFYNDLF 348

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            + +E N+W  L+++ QR    R        KS+K++E ELQ++LN IL K         
Sbjct: 349 SYQIESNRWYALQLRSQRKKVVR-----LNNKSSKEKELELQNILNEILEK------ANL 397

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                            + NQLPH RFNA+T VVDD+LFIY GV
Sbjct: 398 KDDDEDANELSNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGV 457

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WELGEKDY I+S YSIDLNKLDGV VYWE+L  +E+AK LG                   
Sbjct: 458 WELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDE 517

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                  D +L+                 MEIPD R WLPHPK FE+LR FY+R GA+FL
Sbjct: 518 EETV---DQKLVAEEEEEEEEIEDAD--DMEIPDPRPWLPHPKAFESLRNFYVRTGASFL 572

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPS 651
            W+ISNN++ +GK LKTKSFELC+DRWWERRDQV +EE++LE+ GG   +IE+D T K +
Sbjct: 573 EWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKD-TTKST 631

Query: 652 KRR 654
           KRR
Sbjct: 632 KRR 634

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/602 (48%), Positives = 383/602 (63%), Gaps = 21/602 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E V + +V++PS R++P + +NP H K EL +FGGE+T+     THFYN+L+
Sbjct: 57  FKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELF 116

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +++  N+ W+K  SQNAP+PRSS A+A H SGIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 117 TFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDC 176

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K++TKL+   + + P++RSGHR+  WKN+FI++GGFRDLG+  T+YLND W FDI+ +
Sbjct: 177 TTKEWTKLD---QKNGPASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTH 232

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KWT++E    +  PDARSGH F+P    AIL GGYCK   K  K L KGKIL D W L +
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKM 290

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
              P   +WE+ K    QPSPRVG S  +  + + V FGGVYD +ETEESLDS FYNDL+
Sbjct: 291 NSTPSAIRWERRKKQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFYNDLF 349

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            F ++ N+W  L ++PQR    + +     + S KDQEKELQD LN IL +         
Sbjct: 350 TFQIKTNRWYSLSLRPQRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYDQDED 404

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                           TIS QLPHPRFN +  VV+D+LFIY G+
Sbjct: 405 KEDDKAIREQFEDENQSGDEDEEESTKKQH--TISTQLPHPRFNTSLAVVNDTLFIYGGL 462

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WELG+KDY I+SFY IDLNK+DGV VYWE+L+ +E+AK+L                    
Sbjct: 463 WELGDKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDED 522

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                 +D ++L              + +MEIPD R WLPHPK FE+LRAFY+R G  FL
Sbjct: 523 DDEEEVRD-QVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFL 581

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPS 651
            W+ISNNR+ +GK LK KSF+LC+DRWWERRDQV +EE+++E+ GG   I+ER+   K  
Sbjct: 582 EWAISNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTK 641

Query: 652 KR 653
           +R
Sbjct: 642 RR 643

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/607 (48%), Positives = 383/607 (63%), Gaps = 31/607 (5%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F ++Q E E V++  VERP  R    + ANP HNK EL +FGGE+T+  T +THFYNDL+
Sbjct: 55  FKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLF 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            YS+  + WKKY SQN+P+PRSS A+A H SG+ L+HGGEFSSPKQ+ FYHYSDTWLFDC
Sbjct: 115 IYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDC 174

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
              ++TK+E   + + PS+RSGHR+  WKNY IL GGFRDLG+  T+YLND W FDI+ Y
Sbjct: 175 ATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGT-STTYLNDCWLFDITTY 230

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW +L+    +  PDARSGH  +PT   AIL GGYCK   K  K L KGKIL D W L +
Sbjct: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE LDS+FYNDL+
Sbjct: 289 KSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            +H+E N+W  + ++ QRH+  ++AP     KSN+D++KEL+D+LN+IL K         
Sbjct: 348 TYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKK----ANLDD 398

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                            I  +LPHPRFNA+T +VDD+LFI+ GV
Sbjct: 399 DDGDEDGKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGV 458

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WE GEKDY I+SFYSID+NK+DGVKVYWED++ VE AK LG                   
Sbjct: 459 WEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDD 518

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                  D +L+              +   EIPD R WLPHPK FE+LRAFY+R GA+FL
Sbjct: 519 EEEH--SDRKLV--AEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFL 574

Query: 595 TWSISNNRN----LKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDAT 647
            W+I+N  N     KGK LK  SF+LC++RWWERR+QV +EE++LE+ GG   +IE+D T
Sbjct: 575 EWAITNKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFT 634

Query: 648 AKPSKRR 654
            KP+KRR
Sbjct: 635 -KPTKRR 640

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/603 (49%), Positives = 383/603 (63%), Gaps = 22/603 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F ++Q   E +++  V+RP  R++P MF NP H K EL +FGGE T  ET  THFYNDL+
Sbjct: 54  FKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDLF 113

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            YS+  ++WK+Y SQN+P+PRSS AVA H +G+AL+HGGEFSSPKQ+ FYHYSD+WLFDC
Sbjct: 114 VYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDC 173

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG+  T+YLNDLW FDI+NY
Sbjct: 174 SSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDITNY 229

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +  PDARSGH  + T   A+L GGY K   K  K L KGKIL+D W L +
Sbjct: 230 KWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTK--VKAGKGLQKGKILSDCWYLKM 287

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL SIFYN+LY
Sbjct: 288 KSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYNELY 346

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            + +E N+W  + ++PQR   N       + KSN++++KEL+D+LN IL K         
Sbjct: 347 TYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDAEDD 401

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                              + LPH RFNAAT VVDD+LFI+ G 
Sbjct: 402 DESKVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGT 461

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
            E+GEKDYPI+SFYSID+NKLDGVKVYWE+L  VE A++LG                   
Sbjct: 462 VEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDG 521

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                  D++L               + + EIPD R WLPHPK FETLRAFY+R G  FL
Sbjct: 522 EEEIV--DSKLEAEDEEEEEEEEEV-EEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFL 578

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPS 651
             +IS+NR+ KGK LKTKSFELC+DRWWERR+QV +EE++LE+ GG   +IE+D T+K  
Sbjct: 579 ELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-TSKTQ 637

Query: 652 KRR 654
           +RR
Sbjct: 638 RRR 640

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/603 (49%), Positives = 384/603 (63%), Gaps = 27/603 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F ++Q + E V ++ V+RP+ R++  M ANP H K EL +FGGE T+     T FYNDL+
Sbjct: 55  FKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYNDLF 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+  + W+K  SQN+P+PRSS A+A H SG+ L+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 115 TYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDC 174

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
           + K++TK+E   + + P+ARSGHR+  WKNYFIL GGFRDLG+  T+YL+D W FDI+ Y
Sbjct: 175 NTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDITTY 230

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW +++    +  PDARSGH  VPT + A+L GGYCK   K  K L KGKIL D W L +
Sbjct: 231 KWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCK--VKAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FYNDL+
Sbjct: 289 KSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYNDLF 347

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            F +E N+W    ++PQR    + A ATSK   NKD  KEL+D+LN IL K         
Sbjct: 348 TFQIETNRWYSASLRPQR----KAAKATSKNNRNKD--KELEDILNQILEK---ANLNDD 398

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                            I  QLPHPRFNA+T VVDD+LFI+ GV
Sbjct: 399 ENEKETIGDVLKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGV 458

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WE+GEKDY I+SFY+IDLN+LDG+K+YWEDL  +E AK LG                   
Sbjct: 459 WEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDD 518

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                  D +L+              + + EIPD R WLPHPKPFETLR FY+R GA+FL
Sbjct: 519 EEEIT--DQKLVAEDDDEEEEEED--EYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFL 574

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI---IERDATAKPS 651
            W+IS+NR+ +GK LK KSF+LC+DRWWERRDQV +EE++LE+ GGI   +E+D T+K  
Sbjct: 575 EWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKD-TSKSK 633

Query: 652 KRR 654
           KRR
Sbjct: 634 KRR 636

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/603 (49%), Positives = 381/603 (63%), Gaps = 26/603 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E ++I  V +P+ R++  M +NP H K+EL +FGGE T   +  T FYNDL+
Sbjct: 56  FKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDLF 112

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +Y+ +N+ WKKY SQN+P+PRSS A+  H +GIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 113 TYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDC 172

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K+++K+E     + PSARSGHR+  WKN+ IL GGFRDLG+  T+YL DLW FD++ Y
Sbjct: 173 ATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFDVTKY 228

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KWT++E    +  PDARSGH  +PT + A+L GGYCK   K  K L KGKIL+D W L +
Sbjct: 229 KWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCK--VKAGKGLQKGKILSDCWYLKM 286

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLDS+FYNDL+
Sbjct: 287 KSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDLF 345

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            + +E+N+W  L ++ QR    +  P T+     KD+EKELQD+LNSIL K         
Sbjct: 346 TYQIEINRWFSLSMRSQRKKTIKIGPKTT-----KDKEKELQDILNSILKK-NNLTDDDS 399

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                            + NQLPH RFNA T VV+D+L+I+ G 
Sbjct: 400 EDPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGS 459

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WELGEKDY I+SFYSIDLNKLDGV VYWED+  +E AK LG                   
Sbjct: 460 WELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDG 519

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                 Q    L              + +MEIPD R WLPHPKPFETLRAFY+R GA FL
Sbjct: 520 EEEIVDQK---LVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFL 576

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPS 651
            W+ISNNR+ KGK LK KSFEL EDRWWERRDQV +EE+++E+ GG   I+ERD T + +
Sbjct: 577 EWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD-TTQVN 635

Query: 652 KRR 654
           KRR
Sbjct: 636 KRR 638

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/605 (49%), Positives = 387/605 (63%), Gaps = 24/605 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQ--HNKHELFIFGGEFTDPETKLTHFYND 115
           F K+Q + E V + +V++ + R++P M  NP    +K EL +FGGEFT+P+T  T FYND
Sbjct: 53  FKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYND 112

Query: 116 LYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLF 175
           L++++ +NN WK+Y SQNAP+PRSS A+A H SGIALLHGGEFSSPKQ+ FYHYSDTW+ 
Sbjct: 113 LHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWIL 172

Query: 176 DCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDIS 235
           DC+ K++ K++       PSARSGHRI  WKN+FIL GGFRDLG+  T+YL+D W FDI+
Sbjct: 173 DCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGTS-TTYLSDCWLFDIT 228

Query: 236 NYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKL 292
            YKW ++E    +  PDARSGH F+PT   AIL GGYCK  A N K   KGKIL+D W L
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSDCWYL 287

Query: 293 TLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYND 352
            +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESL+S F+ND
Sbjct: 288 KMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESNFFND 346

Query: 353 LYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXX 412
           L+ +H+E N+W  L I+ ++  +N NA A    K++K+QEKEL+ LL+SIL K       
Sbjct: 347 LFSYHIESNRWYSLSIRSRK--SNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKS 404

Query: 413 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYS 472
                                             TI  QLPHPRFNA T V+DD+LFI+ 
Sbjct: 405 DDDEDDEEINTALAKVDLEDEEEEQLAVQH----TILTQLPHPRFNATTTVIDDTLFIFG 460

Query: 473 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXX 532
           G+WELG+K++ I+S YSIDLNKLDGV +YWEDL  +E AK LG                 
Sbjct: 461 GIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDED 520

Query: 533 XXXXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 592
                    + +                + ++E PD R WLPHPKPFETLRAFY+REGA 
Sbjct: 521 DDEED---DNEKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAA 577

Query: 593 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAK 649
           FL W+ISNN+N KGK LK  SF+LC++RWWERRDQ+ +EE++LE+ GG   IIERD +A 
Sbjct: 578 FLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSAS 637

Query: 650 PSKRR 654
            SKRR
Sbjct: 638 -SKRR 641

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/584 (49%), Positives = 365/584 (62%), Gaps = 20/584 (3%)

Query: 83  LMFANPQHNKH--ELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSS 140
           ++ A   HNK   EL +FGGE+T PET +THFYNDL SY+     W+K  SQN+P+PRSS
Sbjct: 88  MITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSS 147

Query: 141 GAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSARSGH 200
            A+  H SGIA+LHGGEFSSPKQ+ FYHYSDTW+ D   K++TK++      SP ARSGH
Sbjct: 148 AAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI---KKSPVARSGH 204

Query: 201 RIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE---TNTKPDARSGHCFV 257
           RI+ WKNYF+LFGGF+D+G+ QT+Y ND+WCFDI NYKWT++E    +  PD RSGH ++
Sbjct: 205 RIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWI 264

Query: 258 PTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQPSPRV 317
           P +   IL GGY K  +K      KGKILND W L +  D    +WE+ K    QPSPRV
Sbjct: 265 PVEEGCILWGGYTKVKSKLKSGQQKGKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRV 324

Query: 318 GYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLELNKWSKLRIKPQRHTNNR 377
           G S   + + + + FGGVYD  ETEESL+S+FYNDL+ +++E N+W  L ++  +  N  
Sbjct: 325 GCSM-AYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRKNQKGN-- 381

Query: 378 NAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXXXXXXXXXXXXXXXXXXXXX---- 433
            +   S  K++K++EKELQDLLN IL K                                
Sbjct: 382 KSLKRSNNKNSKEKEKELQDLLNQILEKNNLKDEDDEDDEEVNENEDGSTTASTAATSDD 441

Query: 434 XXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSIDLN 493
                       +TI NQLPHPR+N A  VVDD LFIY G WELGEKDY INSFYSIDLN
Sbjct: 442 EDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLN 501

Query: 494 KLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXXXXXXXPQDTRLLXXXXXXX 553
           ++DGV  YWEDL  +E+AK LG                         +D +L+       
Sbjct: 502 RIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDDEEDDDEDDDEEEIKDQKLVADDEDEE 561

Query: 554 XXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQLKTKS 613
                    +MEIPD R WLPHPKPFE+LRAFY+REG  FL W+ISNN++++GK LK KS
Sbjct: 562 EEEEDV--QEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKS 619

Query: 614 FELCEDRWWERRDQVTLEEERLED---TGGIIERDATAKPSKRR 654
           FELCEDRWWERRDQ+ +EE++LE+    G +IE+D +   SKRR
Sbjct: 620 FELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/607 (49%), Positives = 372/607 (61%), Gaps = 39/607 (6%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E V +  +ERPS R++P M ANP H K EL +FGGE T   T  THF+NDL 
Sbjct: 56  FKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLV 115

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            +S  N  WK+  SQN+P+PRSS A+  H SG+ALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 116 VFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDC 175

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG+  T+YLND W FDI+ Y
Sbjct: 176 ATKEWTKIE---QKNGPSARSGHRMAVWKNFIILHGGFRDLGTS-TTYLNDCWLFDITTY 231

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +  PDARSGH  +     AIL GGYCK   K  K L KGKIL D W L +
Sbjct: 232 KWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
           + +    +W++ K    QPSPRVG S  +  + + V FGGVYD +ETEESL+S FYND++
Sbjct: 290 SSNTSAIRWDRKKRQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348

Query: 355 MFHLELNKWSKLRIKPQRHT----NNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXX 410
            + + +N+W  L ++PQR      NNR         S KDQEKEL+DLLN IL       
Sbjct: 349 TYQINMNRWYSLSLRPQRKKQVKLNNR---------STKDQEKELEDLLNKILRNAQLDD 399

Query: 411 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFI 470
                                                I N+LPHPRFNAAT VVDD+LFI
Sbjct: 400 QGEEEEIDAAEESTAVEEDSDESESLDKEH------VIMNELPHPRFNAATAVVDDTLFI 453

Query: 471 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXX 530
           + GVWE GEKDY I+SFY IDLNK DGV VYWEDL+ +E AK                  
Sbjct: 454 FGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDDDEE 513

Query: 531 XXXXXXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREG 590
                      D +L+              + +MEIPD R WLPHPK FE+LR+FY+R G
Sbjct: 514 DSEEEQV----DQKLVAEDEDEEEEEFE--EEEMEIPDPRPWLPHPKAFESLRSFYVRTG 567

Query: 591 ANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDAT 647
           A FL W+ISNNR++KGK LKTKSFE+CE RWWERRDQV LEE++LE+ GG   IIERD T
Sbjct: 568 ATFLEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERD-T 626

Query: 648 AKPSKRR 654
            K  KRR
Sbjct: 627 TKTKKRR 633

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/603 (48%), Positives = 378/603 (62%), Gaps = 27/603 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   E ++I +VE+PS R +  + ++    K EL +FGGE T  E + T FYNDLY
Sbjct: 55  FKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKFYNDLY 112

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           ++S  NN WK+  SQN+P+PRSS A+A H SGIALL+GGEFSSPKQS FYHYSDTW+ D 
Sbjct: 113 TFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWILDL 172

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K++TK+E  G+   P  RSGHRI  WKNYFILFGGF+DLG   T+Y ND+W FDI+ Y
Sbjct: 173 TTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDLGH-STTYYNDVWLFDITTY 228

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +T PDARSGH  +PT    I+ GGYCK  AK  K L KGK+L+  W L +
Sbjct: 229 KWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAK--KGLQKGKLLSGCWNLKM 286

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D +  +WE+ +    QPSPRVG S   + + + + FGGVYD  ETEESL+SIFYNDL+
Sbjct: 287 KADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETEESLESIFYNDLF 345

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            +++E N+W  + +K  + +N     +++K KS+K++E+ELQDLLN IL K         
Sbjct: 346 TYNIESNRWFNVTLK--KRSNATKTISSTKNKSSKEKERELQDLLNQILEK--------N 395

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                          I    QLPHPRFNA T V+DD L+IY G 
Sbjct: 396 NLKPDDEEEEESSDIFGSDDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGA 455

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WE GE DY I+SFYSIDLNKLDGV VYWEDL+ +E AK LG                   
Sbjct: 456 WEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDG 515

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                 +DT+L+                +MEIPD R WLPHPK FE+LRAFYLREG  FL
Sbjct: 516 EEEV--EDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFL 573

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDATAKPS 651
            W+ISNNR+ +GK LK KSFELC+DRWWERRDQ+++EE++LE+    G ++ERD +   S
Sbjct: 574 EWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVS 633

Query: 652 KRR 654
           KRR
Sbjct: 634 KRR 636

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/602 (47%), Positives = 373/602 (61%), Gaps = 14/602 (2%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F  +Q + E V +  V  P+ R +  +  N   +K EL +FGGE T+ ET +T FYNDL+
Sbjct: 57  FKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDLH 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            Y+ +NN WKK+ SQN+P+PRSS A+  H SG+ +L GGEFSSPKQ+ FYHY+DTWL D 
Sbjct: 115 VYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDN 174

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             ++++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F++ ++
Sbjct: 175 TTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFNVVDF 230

Query: 238 KWTKLETNTK--PDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT 295
           KWTK ET  K  PD RSGH ++ ++   I+ GGYCK  AKNNK+L KGK L D W L ++
Sbjct: 231 KWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMS 290

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYM 355
            +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L SI+YNDLY 
Sbjct: 291 QNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYS 350

Query: 356 FHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXXX 415
           +++E N+W  L+++     +N N   +S    +K+QEKELQDLLN IL +          
Sbjct: 351 YNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNS 410

Query: 416 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVW 475
                                           + NQLPH RFNA T V++D+ +IY G+W
Sbjct: 411 YSGSNTPHEETTTDREQDDNEEEEKMRTNLPKL-NQLPHERFNACTTVLNDTFYIYGGMW 469

Query: 476 ELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXXX 535
           E  + DY I+SFYSIDLNKLDG+  Y+E+L  +EE KRLG                    
Sbjct: 470 EFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLG--DVQSEDDFEYEDDDDEDD 527

Query: 536 XXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLT 595
               P + RL              G  +MEIPD R WLPHPK FE+LR FY+REG  FL 
Sbjct: 528 GEAEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLE 587

Query: 596 WSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDT---GGIIERDATAKPSK 652
           W+ISNN++ KGK LK KSFELC+DRWWERRDQ+ +EE++L++    G IIERDA + P+ 
Sbjct: 588 WAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTA 647

Query: 653 RR 654
           RR
Sbjct: 648 RR 649

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/603 (48%), Positives = 380/603 (63%), Gaps = 31/603 (5%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   + V +T VERPS R++  M ANP H K EL IFGGE T+    LT FYN+L+
Sbjct: 81  FKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELF 140

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+ ++ W+K  S+N+P+PRSS A A HSSG+AL+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 141 TYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWLLDC 200

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K++TK+E   + + PSARSGHR+  WKN+FIL GGFRDLG+  T+YLNDLW FDI+ Y
Sbjct: 201 TTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIFDITTY 256

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +  PDARSGH  +PT + A+L GGYCK   K  K L KGK L D W L +
Sbjct: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCK--VKAGKGLQKGKTLTDCWYLKM 314

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F+NDL+
Sbjct: 315 KSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            + +E N+W  ++++PQ+    +   A S+   NKD+  EL+++LN IL +         
Sbjct: 374 SYQVEANRWYSVKMRPQK----KKTVAISRNNRNKDE--ELENILNDILQQ-------AN 420

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                            +  QLPHPRFNA T VVDD LFI+ GV
Sbjct: 421 LADDTDDDDNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGV 480

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WE GE+D+ I+SFYSIDLNKLDGVKVYWE+LS +E+AK LG                   
Sbjct: 481 WEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEE 540

Query: 535 XXXXXPQDTRLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 594
                  D +L+              + + EIPD R WLPHPKPFETLRAFY+R GA FL
Sbjct: 541 EETA---DQKLVAEDEEEEEEEEEE-EDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFL 596

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPS 651
            W+ISNNR+ KGK LK +SF+LC+DRWWERR+Q+ +EE++LE+ GG   ++ERD  A+  
Sbjct: 597 KWAISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDP-AQTM 655

Query: 652 KRR 654
           KRR
Sbjct: 656 KRR 658

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  526 bits (1354), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 278/605 (45%), Positives = 362/605 (59%), Gaps = 26/605 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   + V +T V+RPS R +  M  NP H K EL IFGGE+T+  +  T FYN+L+
Sbjct: 55  FRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELF 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+  + WKK  S+NAP+PRSS A A H SG+ L+HGGEFSSPKQ+ FYHYSD+WL DC
Sbjct: 115 TYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDC 174

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
             K++TK++   + + PSARSGHR+  WKN+F++ GGFRDLG+  T+YLND W FDI+ Y
Sbjct: 175 SSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWLFDITTY 230

Query: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
           KW ++E    +  PDARSGH  +PT   AI+ GGYCK  AK  K L KGKIL D W L +
Sbjct: 231 KWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAK--KGLQKGKILTDCWYLRM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
             D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL 
Sbjct: 289 KSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDLL 347

Query: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKXXXXXXXXX 414
            + +E N+W  ++++PQ+          +  KS K ++ EL  +LN IL K         
Sbjct: 348 SYQVEANRWYSIKMRPQKKK------IVAASKSAKSKDDELVGILNDILQK----ANLAD 397

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 474
                                            +  QLPH RFNAAT VVDD+LFI+ G 
Sbjct: 398 EENEENESDSEIEKELHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGS 457

Query: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGXXXXXXXXXXXXXXXXXXX 534
           WE GE+D+ I+SFYSIDLN+ DGV+V+WEDL  +E+AK  G                   
Sbjct: 458 WEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDE 517

Query: 535 XXXXXPQDTRLL---XXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGA 591
                 +    +                 +A  EIPD R WLPHPK FETLRAFY+R GA
Sbjct: 518 EETLDEELIAEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGA 577

Query: 592 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATA 648
            FL W+ISNNR+ KGK LK +SF+L +DRWWERR+QV +EE++LE+ GG   IIERD++ 
Sbjct: 578 EFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSH 637

Query: 649 KPSKR 653
              +R
Sbjct: 638 STKRR 642

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 105/260 (40%), Gaps = 52/260 (20%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHE--K 180
           W +    N+P PR    + A A   + + ++ G    S        Y DTW+   H+   
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDNGS 130

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           KF+       D++P  R GH      N F++FGG     +      +D++ F+I++YKWT
Sbjct: 131 KFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 190

Query: 241 -KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT---- 295
                  +P  R GH        +I+     +T     K  + G   +D++   LT    
Sbjct: 191 IPRPVGPRPLGRYGHKI------SIIATSQMRT-----KLYVFGGQFDDTYFNDLTVFDL 239

Query: 296 -----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDS 347
                PD   WQ+ K   F   P      + Y + LW       FGG     +T + L  
Sbjct: 240 SSFRRPD-SHWQFIKPNTFTPPPLTNHTMISYDYKLW------VFGG-----DTPQGL-- 285

Query: 348 IFYNDLYMFHLELNKWSKLR 367
              ND++MF  ++N W  ++
Sbjct: 286 --INDVFMFDPQINDWKVMQ 303

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 86/201 (42%), Gaps = 23/201 (11%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPE-TKLTHFYNDLYSYSIKNNSWKKYVSQ 132
           RP  R  H +        + +L++FGG+F D     LT F  DL S+   ++ W +++  
Sbjct: 198 RPLGRYGHKISIIATSQMRTKLYVFGGQFDDTYFNDLTVF--DLSSFRRPDSHW-QFIKP 254

Query: 133 N--APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGR 190
           N   P P ++  +  +   + +  G    +P+       +D ++FD     +  ++  G 
Sbjct: 255 NTFTPPPLTNHTMISYDYKLWVFGG---DTPQG----LINDVFMFDPQINDWKVMQTTG- 306

Query: 191 DSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLET--NTKP 248
              P     H  + + +   + GG  +    Q  Y N ++  ++ + KW KL +  +  P
Sbjct: 307 -DKPPPLQEHAAVLYGDLMCVVGGKDE----QDVYSNSVFFLNLISLKWFKLPSYRSGIP 361

Query: 249 DARSGHCFVPTDNSAIL-MGG 268
             RSGH      N  +L MGG
Sbjct: 362 QGRSGHSLTLLPNHKLLIMGG 382

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 103/261 (39%), Gaps = 54/261 (20%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCH--EK 180
           W +   QN+P PR    S A A  S+ I +L G    S        Y DTW+  C+    
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWIISCNPDAT 191

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           +F+       +++P  R GH      N FI+FGG     + +    +D++ F+I++YKWT
Sbjct: 192 QFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKWT 251

Query: 241 KLE-TNTKPDARSGH--CFVPTDNSAI---LMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
                  +P  R GH  C + T        L GG                  ND     L
Sbjct: 252 IPNPIGPRPLGRYGHKICILATSTVKTKLYLFGGQ-----------FDDTYFNDLAVFDL 300

Query: 295 TP---DPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEESLD 346
           +        W++ K K F   P P      V Y  +LW       +GG     +T++ L 
Sbjct: 301 SSFRRQDSHWEFIKSKGF--MPPPLTNHTMVTYGSDLW------IYGG-----DTQQGL- 346

Query: 347 SIFYNDLYMFHLELNKWSKLR 367
               ND++ F    N W+K+ 
Sbjct: 347 ---INDIFKFSPNTNTWTKVE 364

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 92/208 (44%), Gaps = 37/208 (17%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKY 129
           RP  R  H +        K +L++FGG+F D     T+F +    DL S+  +++ W+  
Sbjct: 259 RPLGRYGHKICILATSTVKTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRQDSHWEFI 313

Query: 130 VSQN-APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFG 188
            S+   P P ++  +  + S +  ++GG+      ++    +D + F  +   +TK+E  
Sbjct: 314 KSKGFMPPPLTNHTMVTYGSDL-WIYGGD------TQQGLINDIFKFSPNTNTWTKVETT 366

Query: 189 GRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKP 248
           G  + P     H  + +KN   + GG  +       YLN ++ F+  + KW      T P
Sbjct: 367 G--TKPPPMQEHAAVVYKNIMCVVGGKDE----NDMYLNSVYLFNFDSSKWY-----TFP 415

Query: 249 D-------ARSGHCFVPTDNSAIL-MGG 268
           D        RSGH     +N  +L MGG
Sbjct: 416 DFKSGIIQGRSGHSVTLLNNDKLLIMGG 443

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 119/295 (40%), Gaps = 57/295 (19%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNA---PLPRSSGAVAVHSSGIA 151
             +FGG+ T    K     +D+Y ++I  NS+K  +       PL R    + + ++   
Sbjct: 220 FIVFGGD-THKVNKEGLMDDDIYLFNI--NSYKWTIPNPIGPRPLGRYGHKICILATSTV 276

Query: 152 ----LLHGGEFSSPKQSKFYHYSDTWLFDCHE--KKFTKLEF-GGRDSSPSARSGHRIIA 204
                L GG+F         +++D  +FD     ++ +  EF   +   P   + H ++ 
Sbjct: 277 KTKLYLFGGQFDD------TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVT 330

Query: 205 WKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN-TKPDARSGHCFVPTDNSA 263
           + +   ++GG       Q   +ND++ F  +   WTK+ET  TKP     H  V   N  
Sbjct: 331 YGSDLWIYGG-----DTQQGLINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIM 385

Query: 264 ILMGGYCKTIAKNNKNLMKGKILN-DSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFN 322
            ++GG      +N+  L    + N DS K    PD K    +           R G+S  
Sbjct: 386 CVVGGK----DENDMYLNSVYLFNFDSSKWYTFPDFKSGIIQG----------RSGHSVT 431

Query: 323 LWKQNKSVAFG---------GVYDLQ--ETEESLDSIFYNDLYMFHLELNKWSKL 366
           L   +K +  G         G YDL   E +E + +I Y       L+L++ S L
Sbjct: 432 LLNNDKLLIMGGDKYDFARPGDYDLHTSEIDEGVGTILYT------LDLSRLSNL 480

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 102/253 (40%), Gaps = 44/253 (17%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKF 182
           W +   QN+P PR    + +V   ++ + ++ G    S        Y DTW+  C + + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 183 TKLEFGGR-----DSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
           + + F  R     +++P  R GH      N F++FGG     +      +D++ F+I++Y
Sbjct: 184 STM-FSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSY 242

Query: 238 KWT-KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTP 296
           KWT       +P  R GH        +I+     +T              ND     L+ 
Sbjct: 243 KWTIPHPIGPRPKGRYGHKI------SIIARKQMQTKLYLFGGQFDDNYFNDLVVFDLSS 296

Query: 297 ---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFY 350
              D   W++ K ++F   P      V Y F LW       FGG        ++L+ +  
Sbjct: 297 FRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLW------VFGG--------DTLEGLL- 341

Query: 351 NDLYMFHLELNKW 363
           N ++M+   +N W
Sbjct: 342 NQVFMYDPAVNDW 354

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 115/282 (40%), Gaps = 45/282 (15%)

Query: 68  VDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           VDIT    P    H           +   IFGG+ T  + ++    +D+Y ++I  NS+K
Sbjct: 192 VDITETTPPPRVGHASTLCG-----NAFVIFGGD-THKKNEMGEMDDDIYLFNI--NSYK 243

Query: 128 KYVSQNAPL-PRSSGAVAVHSSGIA--------LLHGGEFSSPKQSKFYHYSDTWLFDCH 178
             +    P+ PR  G      S IA         L GG+F         +++D  +FD  
Sbjct: 244 WTIPH--PIGPRPKGRYGHKISIIARKQMQTKLYLFGGQFDD------NYFNDLVVFDLS 295

Query: 179 E--KKFTKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDIS 235
              +  +  EF   R   P   + H ++++     +FGG  D   G    LN ++ +D +
Sbjct: 296 SFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--DTLEG---LLNQVFMYDPA 350

Query: 236 NYKWTKLETNTKPDARSGHCFVPTDNSAILM--GGYCKTIAKNNKNLMKGKILNDSWKLT 293
              W  +ET  + D    +   P    A L+  G  C    K+ ++      LND + L 
Sbjct: 351 VNDWCVVETTCQDDDLE-NMPPPMQEHATLIYKGLMCIVGGKDEQD----HYLNDVYFLN 405

Query: 294 LTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWKQNKSVAFGG 334
           L    K  +W +L  F +  P  R G+S  L K +K +  GG
Sbjct: 406 L----KSLKWFRLPRFMDGIPQGRSGHSVTLLKNDKLLIMGG 443

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 122/293 (41%), Gaps = 57/293 (19%)

Query: 91  NKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNN-----SWKKYVSQNAPLPRSSGAVAV 145
           N + +F+ GG +          Y D++  +   N     S +  +  N P PR  G  + 
Sbjct: 96  NDNRIFVTGGLYDQ------SVYGDVWEITANANGTSFTSKRIQIDHNTPPPRV-GHAST 148

Query: 146 HSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSARSGHRI--I 203
                 ++ GG+     +++     D +LF+ +  K+T     G  S P  R GH+I  I
Sbjct: 149 MCGNAYVVFGGDTHKLNKNRLLD-DDLYLFNINSYKWTIPHPIG--SRPLGRYGHKISII 205

Query: 204 AWKNY---FILFGGFRDLGSGQTSYLNDLWCFDISNYK-----WTKLE-TNTKPDARSGH 254
           A K       LFGG  D      +Y NDL  FD+S+++     W  LE  +  P   + H
Sbjct: 206 ASKQMHTELYLFGGQID-----ETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNH 260

Query: 255 CFVPTDNSAILMGGYC-KTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQP 313
             V  DN   + GG   KTI+            ND++      DP +  W K++    +P
Sbjct: 261 TMVTFDNKLWVFGGETPKTIS------------NDTY----CYDPIQNAWSKVETTGEKP 304

Query: 314 SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLELNKWSKL 366
            P   ++  ++K    V FGG        + + + + ND+Y  +L   KW KL
Sbjct: 305 PPVQEHASVVYKHLMCV-FGG--------KDIHNTYSNDVYFLNLLSLKWFKL 348

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 98/252 (38%), Gaps = 38/252 (15%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCHEK 180
           W +   +++P PR   SS  +  + + I  + GG +          Y D W    + +  
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRI-FVTGGLYDQSV------YGDVWEITANANGT 125

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
            FT        ++P  R GH      N +++FGG     +      +DL+ F+I++YKWT
Sbjct: 126 SFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 241 -KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKI----LNDSWKLTLT 295
                 ++P  R GH      +  +    Y          L  G+I     ND     L+
Sbjct: 186 IPHPIGSRPLGRYGHKISIIASKQMHTELY----------LFGGQIDETYFNDLAVFDLS 235

Query: 296 PDPK-KWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
              +    WE L+     P P   ++   +  NK   FGG     ET +++     ND Y
Sbjct: 236 SFRRPNSHWEFLEPISALPPPLTNHTMVTF-DNKLWVFGG-----ETPKTIS----NDTY 285

Query: 355 MFHLELNKWSKL 366
            +    N WSK+
Sbjct: 286 CYDPIQNAWSKV 297

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 65/151 (43%), Gaps = 17/151 (11%)

Query: 216 RDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDARSGHC--FVPTDNSAILMGGYCKTI 273
           R++    T+  + L   +   Y W +++    P  R  H   F+ T+++ I + G     
Sbjct: 50  RNISGASTNLPSPLERKNSRRYIWNRIKLKDSPFPRYRHSSSFITTNDNRIFVTG----- 104

Query: 274 AKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFG 333
                 L    +  D W++T   +   +  ++++   N P PRVG++  +   N  V FG
Sbjct: 105 -----GLYDQSVYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTMCG-NAYVVFG 158

Query: 334 GVYDLQETEESLDSIFYNDLYMFHLELNKWS 364
           G          LD    +DLY+F++   KW+
Sbjct: 159 GDTHKLNKNRLLD----DDLYLFNINSYKWT 185

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 98/245 (40%), Gaps = 28/245 (11%)

Query: 96  FIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK-KYVSQNAPLPRSSGAVAVHSSGIALLH 154
            +FGG+ T    K     +DLY ++I +  W   +   + PL R    +++ +S    +H
Sbjct: 155 VVFGGD-THKLNKNRLLDDDLYLFNINSYKWTIPHPIGSRPLGRYGHKISIIAS--KQMH 211

Query: 155 GGEFSSPKQSKFYHYSDTWLFDCH--EKKFTKLEFGGRDSS-PSARSGHRIIAWKNYFIL 211
              +    Q    +++D  +FD     +  +  EF    S+ P   + H ++ + N   +
Sbjct: 212 TELYLFGGQIDETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWV 271

Query: 212 FGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN-TKPDARSGHCFVPTDNSAILMGGYC 270
           FGG         +  ND +C+D     W+K+ET   KP     H  V   +   + GG  
Sbjct: 272 FGG-----ETPKTISNDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG-- 324

Query: 271 KTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWKQNKS 329
               K+  N       ND + L L       +W KL   K   P  R G+S  L    K 
Sbjct: 325 ----KDIHNTYS----NDVYFLNLL----SLKWFKLPCVKEGIPQERSGHSLTLMNNEKL 372

Query: 330 VAFGG 334
           V  GG
Sbjct: 373 VIMGG 377

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 103/260 (39%), Gaps = 42/260 (16%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEK-- 180
           W++    N+P PR    + A A   + + ++ G    S        Y DTW+   HE   
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           +FT       D++P  R GH      N F++FGG     +      +D++ F+I++YKWT
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 188

Query: 241 -KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT---- 295
                  +P  R GH        +I+     KT              ND     L+    
Sbjct: 189 IPNPVGPRPLGRYGHKI------SIIAMSPMKTKLYVFGGQFDDTYFNDLAVFDLSSFRR 242

Query: 296 PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYND 352
           PD   WQ+    +F   P      + Y + LW       FGG     +T + L     +D
Sbjct: 243 PD-SSWQFITPNSFTPPPLTNHAMISYDYKLW------VFGG-----DTPQGL----IDD 286

Query: 353 LYMFHLELNKWSKLRIKPQR 372
           +++F  ++N W  ++   Q+
Sbjct: 287 VFVFDPQVNDWKFIQTTGQK 306

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 83/186 (44%), Gaps = 28/186 (15%)

Query: 92  KHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQNA--PLPRSSGAVAV 145
           K +L++FGG+F D     T+F +    DL S+   ++SW ++++ N+  P P ++ A+  
Sbjct: 214 KTKLYVFGGQFDD-----TYFNDLAVFDLSSFRRPDSSW-QFITPNSFTPPPLTNHAMIS 267

Query: 146 HSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAW 205
           +   + +  G    +P+        D ++FD     +  ++  G+   P     H  + +
Sbjct: 268 YDYKLWVFGG---DTPQG----LIDDVFVFDPQVNDWKFIQTTGQ--KPPPLQEHASVLY 318

Query: 206 KNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE--TNTKPDARSGHCFVPTDNSA 263
            +   + GG  +    Q  Y N ++  ++ + KW K        P  RSGH      N  
Sbjct: 319 GDLMCIVGGKDE----QDVYSNGVYFLNLISLKWFKFPFFRAGIPQGRSGHSLTLLPNHK 374

Query: 264 IL-MGG 268
           +L MGG
Sbjct: 375 LLIMGG 380

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 106/249 (42%), Gaps = 46/249 (18%)

Query: 130 VSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGG 189
           + QN P PR   A  +  +   +  GG+     ++      D +LF+ +  K+T  +  G
Sbjct: 134 IDQNTPPPRVGHASTICGNAYVVF-GGDTHKLNKNGLLD-DDLYLFNINSYKWTIPQPIG 191

Query: 190 RDSSPSARSGHRI--IA---WKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYK-----W 239
           R   P  R GH+I  IA    +    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 192 R--RPLGRYGHKISIIASNPMQTKLYLFGGQVD-----ETYFNDLVVFDLSSFRRPNSHW 244

Query: 240 TKLE-TNTKPDARSGHCFVPTDNSAILMGGYC-KTIAKNNKNLMKGKILNDSWKLTLTPD 297
             LE     P   + H  V  DN   + GG   KTI+            ND+++     D
Sbjct: 245 EFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETPKTIS------------NDTYRY----D 288

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357
           P + +W K+K    +P P   ++  ++K    V  GG        +   + + ND+Y  +
Sbjct: 289 PAQSEWSKVKTTGEKPPPIQEHASVVYKHLMCV-LGG--------KDTHNAYSNDVYFLN 339

Query: 358 LELNKWSKL 366
           L   KW KL
Sbjct: 340 LLSLKWYKL 348

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 98/253 (38%), Gaps = 38/253 (15%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHE--K 180
           W +   +N+P PR   SS  +  + + I +  G    S        Y D W    +    
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
            FT        ++P  R GH      N +++FGG     +      +DL+ F+I++YKWT
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 241 KLE-TNTKPDARSGHCFV-----PTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
             +    +P  R GH        P      L GG       N+  +         + L+ 
Sbjct: 186 IPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDLVV---------FDLSS 236

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
              P    WE L+   + P P   ++   +  NK   FGG     ET +++     ND Y
Sbjct: 237 FRRPNS-HWEFLEPVGDLPPPLTNHTMVAY-DNKLWVFGG-----ETPKTIS----NDTY 285

Query: 355 MFHLELNKWSKLR 367
            +    ++WSK++
Sbjct: 286 RYDPAQSEWSKVK 298

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 19/131 (14%)

Query: 237 YKWTKLETNTKPDARSGHC---FVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLT 293
           Y W +++    P  R  H     V  DN   + GG           L    +  D W++ 
Sbjct: 71  YIWNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGG-----------LHDQSVYGDVWQIA 119

Query: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDL 353
              D   +  +++   +N P PRVG++  +   N  V FGG  D  +  +  + +  +DL
Sbjct: 120 ANADGTSFTSKRIDIDQNTPPPRVGHASTICG-NAYVVFGG--DTHKLNK--NGLLDDDL 174

Query: 354 YMFHLELNKWS 364
           Y+F++   KW+
Sbjct: 175 YLFNINSYKWT 185

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 101/252 (40%), Gaps = 45/252 (17%)

Query: 130 VSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGG 189
           + QN P PR   A  +  +   +  GG+      ++     D +LF+ +  K+T  +  G
Sbjct: 134 IGQNTPPPRVGHASTICGNAYVVF-GGDTHKLNMNRLLD-DDLYLFNINSYKWTIPQPVG 191

Query: 190 RDSSPSARSGHRIIAWKN-----YFILFGGFRDLGSGQTSYLNDLWCFDISNYK-----W 239
             + P  R GH+I    N        LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 192 --TRPLGRYGHKISIIANNPMQTKLFLFGGQID-----ETYFNDLAMFDLSSFRRPNSHW 244

Query: 240 TKLE-TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDP 298
             L+  +  P   + H  V  DN   + GG       N                T   DP
Sbjct: 245 VFLKPVSIVPPPLTNHTMVTFDNKLWVFGGKTPNTLSNE---------------TFCYDP 289

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHL 358
            +  W K++    +P P V    ++  ++    FGG        + + + + ND+Y  +L
Sbjct: 290 VQNDWSKIQTTGERP-PAVQEHASVVYKHLMCIFGG--------KDIQNAYSNDVYFLNL 340

Query: 359 ELNKWSKL-RIK 369
              KW KL RIK
Sbjct: 341 ITFKWYKLPRIK 352

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 91/195 (46%), Gaps = 30/195 (15%)

Query: 83  LMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWK--KYVSQNAPL 136
           ++  NP   K  LF+FGG+  +     T+F +    DL S+   N+ W   K VS   P 
Sbjct: 204 IIANNPMQTK--LFLFGGQIDE-----TYFNDLAMFDLSSFRRPNSHWVFLKPVSI-VPP 255

Query: 137 PRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSA 196
           P ++  +    + + +  G    +P        ++T+ +D  +  ++K++  G    P A
Sbjct: 256 PLTNHTMVTFDNKLWVFGG---KTPNTLS----NETFCYDPVQNDWSKIQTTGE--RPPA 306

Query: 197 RSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTK--PDARSGH 254
              H  + +K+   +FGG +D+   Q +Y ND++  ++  +KW KL    +  P  RSGH
Sbjct: 307 VQEHASVVYKHLMCIFGG-KDI---QNAYSNDVYFLNLITFKWYKLPRIKEGLPKERSGH 362

Query: 255 CFVPTDNSA-ILMGG 268
                 N   ++MGG
Sbjct: 363 SLTLIKNDKLVIMGG 377

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 66/152 (43%), Gaps = 19/152 (12%)

Query: 216 RDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDARSGHC---FVPTDNSAILMGGYCKT 272
           R++    T+  + +   D   Y W +++    P  R  H     V  DN   + GG    
Sbjct: 50  RNISGASTALPSPMERQDAGKYVWNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGG---- 105

Query: 273 IAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAF 332
                  L    +  D+W++T   D   +  + ++  +N P PRVG++  +   N  V F
Sbjct: 106 -------LHDHLVYGDTWQITGNLDGTSFVSKTIQIGQNTPPPRVGHASTICG-NAYVVF 157

Query: 333 GGVYDLQETEESLDSIFYNDLYMFHLELNKWS 364
           GG       + +++ +  +DLY+F++   KW+
Sbjct: 158 GG----DTHKLNMNRLLDDDLYLFNINSYKWT 185

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 101/256 (39%), Gaps = 52/256 (20%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEK-- 180
           W +   Q++P PR    S A     + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           KF+       +++P  R GH  +   N F++FGG     + +    +D++  +I++YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT---- 295
                  +P  R GH        +I+     KT     K  + G   +D++   L     
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATNQMKT-----KLYVFGGQFDDTYFNDLAVYDL 274

Query: 296 -----PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLDS 347
                PD   W++ K K F   P      + Y   LW       FGG        ++L  
Sbjct: 275 SSFRRPD-SHWEFLKPKTFSPPPITNFTMISYDSKLW------VFGG--------DTLQG 319

Query: 348 IFYNDLYMFHLELNKW 363
           +  ND++M+   LN W
Sbjct: 320 LV-NDVFMYDPALNDW 334

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 83/204 (40%), Gaps = 29/204 (14%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +        K +L++FGG+F D       ++NDL  Y +      ++ W+ 
Sbjct: 233 RPLGRYGHKISIIATNQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEF 286

Query: 129 YVSQN-APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF 187
              +  +P P ++  +  + S + +  G              +D +++D     +  +E 
Sbjct: 287 LKPKTFSPPPITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIET 339

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTK 247
            G    P     H  + + +   + GG  +      +YLN ++  ++ + KW KL   T 
Sbjct: 340 TGEKPPPVQE--HATVVYNDLMCVVGGKDE----HDAYLNSVYFLNLKSNKWFKLPVFTA 393

Query: 248 --PDARSGHCFVPTDNSAIL-MGG 268
             P  RSGH      N  IL MGG
Sbjct: 394 GIPQGRSGHSLTLLKNDKILIMGG 417

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 126/312 (40%), Gaps = 57/312 (18%)

Query: 68  VDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I  NS+K
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNI--NSYK 223

Query: 128 KYVSQNAPL-PRSSGAVAVHSSGIAL--------LHGGEFSSPKQSKFYHYSDTWLFDCH 178
             V   AP+ PR  G      S IA         + GG+F         +++D  ++D  
Sbjct: 224 WTVP--APVGPRPLGRYGHKISIIATNQMKTKLYVFGGQFDD------TYFNDLAVYDLS 275

Query: 179 E--KKFTKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDIS 235
              +  +  EF   +  SP   +   +I++ +   +FGG  D   G    +ND++ +D +
Sbjct: 276 SFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--DTLQG---LVNDVFMYDPA 330

Query: 236 NYKWTKLETN-TKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
              W  +ET   KP     H  V  ++   ++GG  +  A           LN  + L L
Sbjct: 331 LNDWFIIETTGEKPPPVQEHATVVYNDLMCVVGGKDEHDA----------YLNSVYFLNL 380

Query: 295 TPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEESLDSIFYND 352
               K  +W KL  F    P  R G+S  L K +K +  GG  +D    EES       D
Sbjct: 381 ----KSNKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEES-------D 429

Query: 353 LYMFHLELNKWS 364
           L+   +++ K +
Sbjct: 430 LHTSDIDMQKGT 441

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 84/206 (40%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCHEK--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYL 226
           Y DTW+   H    +FT       D++P  R GH      N F++FGG     + +    
Sbjct: 112 YGDTWILTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMD 171

Query: 227 NDLWCFDISNYKWT-KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKI 285
           +D++ F+I++YKWT       +P  R GH        +++     KT             
Sbjct: 172 DDVYLFNINSYKWTIPHPVGPRPLGRYGHKI------SVIATSQMKTKLYVFGGQFDDTY 225

Query: 286 LNDSWKLTLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND     L+    PD   W++ K ++F   P      V Y + LW       FGG    
Sbjct: 226 FNDLCVYDLSSFRRPD-SHWEFLKPQSFVPPPLTNHTMVSYDYKLW------IFGG---- 274

Query: 339 QETEESLDSIFYNDLYMFHLELNKWS 364
            +T + L     N+++M+   +N W+
Sbjct: 275 -DTAQGL----INEVFMYDPTVNDWT 295

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 26/188 (13%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +        K +L++FGG+F D       ++NDL  Y +      ++ W+ 
Sbjct: 193 RPLGRYGHKISVIATSQMKTKLYVFGGQFDD------TYFNDLCVYDLSSFRRPDSHWEF 246

Query: 129 YVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFG 188
              Q+   P  +    V       + GG+ +          ++ +++D     +T +E  
Sbjct: 247 LKPQSFVPPPLTNHTMVSYDYKLWIFGGDTAQGL------INEVFMYDPTVNDWTVVETT 300

Query: 189 GRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE--TNT 246
           G  S P A   H  + +K+   + GG  +    Q SY ND++  ++ ++KW KL    N 
Sbjct: 301 G--SKPPAIQEHAAVVYKDLMCVTGGKDE----QDSYSNDVYFLNLKSFKWFKLPFFKNG 354

Query: 247 KPDARSGH 254
            P  RSGH
Sbjct: 355 VPQGRSGH 362

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 97/251 (38%), Gaps = 42/251 (16%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC--HEK 180
           W +   QN+P PR    + A     + I ++ G    S        Y DTW+     +  
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           KF+       +++P  R GH  +   N F++FGG     + +    +D++  +I++YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT---- 295
                  +P  R GH        +I+     KT              ND     L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYND 352
           PD   W++ K K F   P      + Y   LW       FGG        ++L  +  ND
Sbjct: 280 PD-SHWEFLKPKAFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLI-ND 323

Query: 353 LYMFHLELNKW 363
           ++M+   +N W
Sbjct: 324 VFMYDPAINDW 334

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 87/204 (42%), Gaps = 29/204 (14%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKN----NSWKKY 129
           RP  R  H +        K +L++FGG+F D       ++NDL  Y + +    +S  ++
Sbjct: 233 RPLGRYGHKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEF 286

Query: 130 VSQNA--PLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF 187
           +   A  P P ++  +  + S + +  G              +D +++D     +  +E 
Sbjct: 287 LKPKAFTPPPITNFTMISYDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIET 339

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTK 247
            G    P     H  + + +   + GG  +      +YLN ++  ++ ++KW KL   T 
Sbjct: 340 TGEKPPPVQE--HASVVYNDLMCVVGGKDE----HDAYLNSVYFLNLKSHKWFKLPVFTA 393

Query: 248 --PDARSGHCF-VPTDNSAILMGG 268
             P  RSGH   +  D+  ++MGG
Sbjct: 394 GIPQGRSGHSLTLLKDDKILIMGG 417

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 117/291 (40%), Gaps = 50/291 (17%)

Query: 68  VDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I  NS+K
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNI--NSYK 223

Query: 128 KYVSQNAPL-PRSSGAVAVHSSGIAL--------LHGGEFSSPKQSKFYHYSDTWLFDCH 178
             V   AP+ PR  G      S IA         + GG+F         +++D  ++D  
Sbjct: 224 WTVP--APVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFDD------TYFNDLAVYDLS 275

Query: 179 E--KKFTKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDIS 235
              +  +  EF   +  +P   +   +I++ +   +FGG  D   G    +ND++ +D +
Sbjct: 276 SFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--DTLQG---LINDVFMYDPA 330

Query: 236 NYKWTKLETN-TKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
              W  +ET   KP     H  V  ++   ++GG  +  A           LN  + L L
Sbjct: 331 INDWFIIETTGEKPPPVQEHASVVYNDLMCVVGGKDEHDA----------YLNSVYFLNL 380

Query: 295 TPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEE 343
               K  +W KL  F    P  R G+S  L K +K +  GG  +D    EE
Sbjct: 381 ----KSHKWFKLPVFTAGIPQGRSGHSLTLLKDDKILIMGGDKFDYARVEE 427

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 100/259 (38%), Gaps = 52/259 (20%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCHEK 180
           W +    N+P PR    + A A     I ++ G    S        Y DTW+   + +  
Sbjct: 134 WNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSENNAS 186

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           +F        D++P  R GH      N FI+FGG     +      +DL+ F+I+++KWT
Sbjct: 187 RFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINSHKWT 246

Query: 241 KLE-TNTKPDARSGH--CFVPTDNSAI---LMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
                  +P  R GH    + T NS     L GG                  ND     L
Sbjct: 247 IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQ-----------FDDAYFNDLVVFDL 295

Query: 295 T----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDS 347
           +    PD  +W++ K K+F   P      V Y   LW       FGG     +T + L  
Sbjct: 296 SSFRRPD-SRWEFVKPKSFVPPPLTNHTMVSYDNKLW------VFGG-----DTLQGL-- 341

Query: 348 IFYNDLYMFHLELNKWSKL 366
              N ++M+   +N W+ +
Sbjct: 342 --TNRVFMYDPMINDWTTI 358

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 94/232 (40%), Gaps = 37/232 (15%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +      ++K  L++FGG+F D       ++NDL  + +      ++ W+ 
Sbjct: 254 RPLGRYGHKISIIATANSKTRLYLFGGQFDDA------YFNDLVVFDLSSFRRPDSRWEF 307

Query: 129 YVSQN-APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF 187
              ++  P P ++  +  + + + +  G          F       ++D     +T +E 
Sbjct: 308 VKPKSFVPPPLTNHTMVSYDNKLWVFGGDTLQGLTNRVF-------MYDPMINDWTTIET 360

Query: 188 GGRDSSPSA--RSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN 245
              + +  A     H  I +K+   +FGG       Q +YLN ++  ++   KW KL   
Sbjct: 361 SSDNPNNIAPPMQEHAAIVYKDLMCIFGG----KDEQDTYLNGVYFLNLRTLKWYKLPIF 416

Query: 246 TK--PDARSGHCFVPTDNSAIL-MGG----YCKT----IAKNNKNLMKGKIL 286
               P  RSGH      N  +L MGG    Y +     +  +  N+ KG IL
Sbjct: 417 APGIPQGRSGHSITLLKNDKLLIMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 105/257 (40%), Gaps = 46/257 (17%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSG-------AVAVHS 147
             IFGG+ T    K     +DLY ++I ++ W      N   PR  G        +A  +
Sbjct: 215 FIIFGGD-THKVNKDGLMDDDLYLFNINSHKW---TIPNPVGPRPLGRYGHKISIIATAN 270

Query: 148 SGIAL-LHGGEFSSPKQSKFYHYSDTWLFDCH--EKKFTKLEFGGRDS-SPSARSGHRII 203
           S   L L GG+F         +++D  +FD     +  ++ EF    S  P   + H ++
Sbjct: 271 SKTRLYLFGGQFDD------AYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMV 324

Query: 204 AWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDARSGHCFVPTDNSA 263
           ++ N   +FGG  D   G T   N ++ +D     WT +ET++             +N A
Sbjct: 325 SYDNKLWVFGG--DTLQGLT---NRVFMYDPMINDWTTIETSSDN----------PNNIA 369

Query: 264 ILMGGYCKTIAKNNKNLMKGK-----ILNDSWKLTLTPDPKKWQWEKLKNFK-NQPSPRV 317
             M  +   + K+   +  GK      LN  + L L    +  +W KL  F    P  R 
Sbjct: 370 PPMQEHAAIVYKDLMCIFGGKDEQDTYLNGVYFLNL----RTLKWYKLPIFAPGIPQGRS 425

Query: 318 GYSFNLWKQNKSVAFGG 334
           G+S  L K +K +  GG
Sbjct: 426 GHSITLLKNDKLLIMGG 442

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 86/211 (40%), Gaps = 42/211 (19%)

Query: 169 YSDTWLFDCHEK--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYL 226
           Y DTW+   HE   KFT       +++P  R GH      N F++FGG     + +    
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMD 256

Query: 227 NDLWCFDISNYKWT-KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKI 285
           +D++  +I+++KWT       +P  R GH        +I+     KT     K  + G  
Sbjct: 257 DDVYLLNINSHKWTIPRPVGPRPLGRYGHKI------SIIATSQMKT-----KLYVFGGQ 305

Query: 286 LNDSWKLTLT---------PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFG 333
            +D++   L          PD   WQ+ K  +F   P      V Y + LW       FG
Sbjct: 306 FDDTYFNDLAVYDLSSFRRPD-SHWQFLKPVSFVPPPLTNHTMVSYDYKLW------VFG 358

Query: 334 GVYDLQETEESLDSIFYNDLYMFHLELNKWS 364
           G     +T + L     N+L+M+    N WS
Sbjct: 359 G-----DTPQGL----INELFMYDPTTNDWS 380

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 66/143 (46%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLET-NTKPDARS 252
           P   + H ++++     +FGG    G      +N+L+ +D +   W+ ++T   KP    
Sbjct: 339 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFMYDPTTNDWSVVDTTGVKPPPLQ 393

Query: 253 GHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKN- 311
            H  +   +   ++GG      K++++    ++    + L L    K ++W KL +F++ 
Sbjct: 394 EHAALLYKDLMCIVGG------KDDQDNYSQEV----YFLNL----KSFRWFKLPHFRSL 439

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 440 VPSPRSGHSVTLLSNKKLLIMGG 462

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 89/205 (43%), Gaps = 31/205 (15%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWK- 127
           RP  R  H +        K +L++FGG+F D       ++NDL  Y +      ++ W+ 
Sbjct: 278 RPLGRYGHKISIIATSQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWQF 331

Query: 128 -KYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLE 186
            K VS   P P ++  +  +   + +  G    +P+       ++ +++D     ++ ++
Sbjct: 332 LKPVS-FVPPPLTNHTMVSYDYKLWVFGG---DTPQG----LINELFMYDPTTNDWSVVD 383

Query: 187 FGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE--T 244
             G    P     H  + +K+   + GG  D    Q +Y  +++  ++ +++W KL    
Sbjct: 384 TTG--VKPPPLQEHAALLYKDLMCIVGGKDD----QDNYSQEVYFLNLKSFRWFKLPHFR 437

Query: 245 NTKPDARSGHCFVPTDNSAIL-MGG 268
           +  P  RSGH      N  +L MGG
Sbjct: 438 SLVPSPRSGHSVTLLSNKKLLIMGG 462

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 57/132 (43%), Gaps = 19/132 (14%)

Query: 239 WTKLETNTKPDARSGHC---FVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT 295
           W +++    P  R  H    +    N   ++GG           L    +  D+W +   
Sbjct: 158 WNRVKLLQSPFPRYRHVASSYASDSNEVFVIGG-----------LHDQSVYGDTWIIKSH 206

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYM 355
            +  K+  + ++  +  P PRVG++  L   N  V FGG  D  +T  + + +  +D+Y+
Sbjct: 207 ENGNKFTSKTVEITETTPPPRVGHASTLCG-NAFVIFGG--DTHKT--NAEGLMDDDVYL 261

Query: 356 FHLELNKWSKLR 367
            ++  +KW+  R
Sbjct: 262 LNINSHKWTIPR 273

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 102/259 (39%), Gaps = 38/259 (14%)

Query: 123 NNSWKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHE 179
           N  W +   +++P PR    + + A     + ++ G       QS F    D W+    E
Sbjct: 194 NVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLH----DQSVF---GDVWIIKSLE 246

Query: 180 K--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
              KFT       +++P  R GH      N F++FGG     +      +DL+ F+I++Y
Sbjct: 247 NGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSY 306

Query: 238 KWT-KLETNTKPDARSGH-----CFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWK 291
           KWT       +P  R GH        P      L GG       NN  +           
Sbjct: 307 KWTIPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQFDDTYFNNLAVF-------DLS 359

Query: 292 LTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYN 351
               PD   W++ K K+F   P P   ++   + QNK   FGG        ++L  +  N
Sbjct: 360 QFRRPD-SHWEFLKPKSF--MPPPLTNHTMVSY-QNKLWIFGG--------DTLQGLI-N 406

Query: 352 DLYMFHLELNKWSKLRIKP 370
            ++M+  E+N W+ +   P
Sbjct: 407 KIFMYDPEVNDWTVVETFP 425

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 119/297 (40%), Gaps = 55/297 (18%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLH 154
             +FGG+ T    K     +DLY ++I  NS+K +   N   PR  G      S IA   
Sbjct: 278 FVVFGGD-THKVNKDGLMDDDLYLFNI--NSYK-WTIPNPIGPRPLGRYGHKVSIIA--- 330

Query: 155 GGEFSSPKQSKFY----HYSDTW-----LFDCHE--KKFTKLEFGGRDS-SPSARSGHRI 202
               ++P ++K Y     + DT+     +FD  +  +  +  EF    S  P   + H +
Sbjct: 331 ----TTPMKTKLYLFGGQFDDTYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTM 386

Query: 203 IAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLET-------NTKPDARSGHC 255
           ++++N   +FGG    G      +N ++ +D     WT +ET          P     H 
Sbjct: 387 VSYQNKLWIFGGDTLQG-----LINKIFMYDPEVNDWTVVETFPANNDQENFPPPMQEHA 441

Query: 256 FVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFK-NQPS 314
            V   +  ++MGG  +          +   LN  + L +       +W KL       P 
Sbjct: 442 SVMYGDLMVVMGGKDE----------QDNYLNTVYFLKI----NTLEWYKLPFLSVGIPQ 487

Query: 315 PRVGYSFNLWKQNKSVAFGG-VYDLQETEE----SLDSIFYNDLYMFHLELNKWSKL 366
            R G+S  L K NK +  GG  +D    EE    + D+   +   ++ L+L+   +L
Sbjct: 488 GRSGHSITLLKGNKLLIMGGDKFDYARPEEHGLHTTDTDMGSGTILYTLDLSNLEQL 544

 Score = 38.1 bits (87), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 80/188 (42%), Gaps = 26/188 (13%)

Query: 92  KHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHS 147
           K +L++FGG+F D     T+F N    DL  +   ++ W+    ++   P  +    V  
Sbjct: 335 KTKLYLFGGQFDD-----TYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSY 389

Query: 148 SGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF----GGRDSSPSARSGHRII 203
                + GG+      +K +      ++D     +T +E       +++ P     H  +
Sbjct: 390 QNKLWIFGGDTLQGLINKIF------MYDPEVNDWTVVETFPANNDQENFPPPMQEHASV 443

Query: 204 AWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE--TNTKPDARSGHCF-VPTD 260
            + +  ++ GG  +    Q +YLN ++   I+  +W KL   +   P  RSGH   +   
Sbjct: 444 MYGDLMVVMGGKDE----QDNYLNTVYFLKINTLEWYKLPFLSVGIPQGRSGHSITLLKG 499

Query: 261 NSAILMGG 268
           N  ++MGG
Sbjct: 500 NKLLIMGG 507

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 97/251 (38%), Gaps = 42/251 (16%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEK-- 180
           W +   QN+P PR    + A     + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           +F+       +++P  R GH  +   N F++FGG     + +    +D++  +I++YKWT
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT---- 295
                  +P  R GH        +I+     KT              ND     L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYND 352
           PD   W++ K + F   P      + Y   LW       FGG        ++L  +  ND
Sbjct: 280 PD-SHWEFLKPRTFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLV-ND 323

Query: 353 LYMFHLELNKW 363
           ++M+   +N W
Sbjct: 324 VFMYDPAINDW 334

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 82/204 (40%), Gaps = 29/204 (14%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +        K +L++FGG+F D       ++NDL  Y +      ++ W+ 
Sbjct: 233 RPLGRYGHKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEF 286

Query: 129 YVSQN-APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF 187
              +   P P ++  +  + S + +  G              +D +++D     +  ++ 
Sbjct: 287 LKPRTFTPPPITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDT 339

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTK 247
            G    P     H  + + +   + GG  +      +YLN ++  ++ + KW KL   T 
Sbjct: 340 TGEKPPPVQE--HATVVYNDLMCVVGGKDE----HDAYLNSVYFLNLKSRKWFKLPVFTA 393

Query: 248 --PDARSGHCFVPTDNSAIL-MGG 268
             P  RSGH      N  IL MGG
Sbjct: 394 GIPQGRSGHSLTLLKNDKILIMGG 417

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 117/291 (40%), Gaps = 50/291 (17%)

Query: 68  VDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I  NS+K
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNI--NSYK 223

Query: 128 KYVSQNAPL-PRSSGAVAVHSSGIAL--------LHGGEFSSPKQSKFYHYSDTWLFDCH 178
             V   AP+ PR  G      S IA         + GG+F         +++D  ++D  
Sbjct: 224 WTVP--APVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFDD------TYFNDLAVYDLS 275

Query: 179 E--KKFTKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDIS 235
              +  +  EF   R  +P   +   +I++ +   +FGG  D   G    +ND++ +D +
Sbjct: 276 SFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--DTLQG---LVNDVFMYDPA 330

Query: 236 NYKWTKLETN-TKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294
              W  ++T   KP     H  V  ++   ++GG  +  A           LN  + L L
Sbjct: 331 INDWFIIDTTGEKPPPVQEHATVVYNDLMCVVGGKDEHDA----------YLNSVYFLNL 380

Query: 295 TPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEE 343
               K  +W KL  F    P  R G+S  L K +K +  GG  +D    EE
Sbjct: 381 ----KSRKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEE 427

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 100/258 (38%), Gaps = 56/258 (21%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHE--K 180
           W +   QN+P PR    + A A   + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWT 240
           KF+       +++P  R GH  +   N F++FGG     + +    +D++  ++++YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 241 -KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT---- 295
                  +P  R GH        +I+     KT     K  + G   +D++   L     
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKT-----KLYVFGGQFDDTYFNDLAVYDL 274

Query: 296 -----PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEESL 345
                PD     W+ LK     P P      + Y   LW       FGG        ++L
Sbjct: 275 SSFRRPD---SHWDFLKPMTFTPPPMTNFTMISYDSKLW------VFGG--------DTL 317

Query: 346 DSIFYNDLYMFHLELNKW 363
             +  ND++M+    N W
Sbjct: 318 QGLI-NDVFMYDPAKNDW 334

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 83/206 (40%), Gaps = 33/206 (16%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQ- 132
           RP  R  H +        K +L++FGG+F D       ++NDL  Y +  +S+++  S  
Sbjct: 233 RPLGRYGHKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDL--SSFRRPDSHW 284

Query: 133 -------NAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKL 185
                    P P ++  +  + S + +  G              +D +++D  +  +  +
Sbjct: 285 DFLKPMTFTPPPMTNFTMISYDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTI 337

Query: 186 EFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN 245
           E  G    P     H  + + +   + GG  +      +YLN ++  ++  +KW KL   
Sbjct: 338 ETSGEKPPPVQE--HATVVYNDLMCVVGGKDE----HDAYLNTVYFLNLKTHKWFKLPIF 391

Query: 246 TK--PDARSGHCFVPTDNSAIL-MGG 268
               P  RSGH      N  +L MGG
Sbjct: 392 AAGIPQGRSGHSLTLLKNDKVLIMGG 417

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 67/155 (43%), Gaps = 22/155 (14%)

Query: 193 SPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN-TKPDAR 251
           +P   +   +I++ +   +FGG  D   G    +ND++ +D +   W  +ET+  KP   
Sbjct: 293 TPPPMTNFTMISYDSKLWVFGG--DTLQG---LINDVFMYDPAKNDWFTIETSGEKPPPV 347

Query: 252 SGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFK- 310
             H  V  ++   ++GG  +  A           LN  + L L    K  +W KL  F  
Sbjct: 348 QEHATVVYNDLMCVVGGKDEHDA----------YLNTVYFLNL----KTHKWFKLPIFAA 393

Query: 311 NQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEES 344
             P  R G+S  L K +K +  GG  +D    EES
Sbjct: 394 GIPQGRSGHSLTLLKNDKVLIMGGDKFDYARAEES 428

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 102/268 (38%), Gaps = 57/268 (21%)

Query: 126 WKKYVSQNAPLPR---SSGAVAVHSSGIALLHG--GEFSSPKQSKFYHYSDTWLFDCHEK 180
           W +    ++PLPR    +   A   + I ++ G  GE           Y DTW+   +  
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGELV---------YGDTWMLTANSD 212

Query: 181 K--FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYK 238
              FT        ++P  R GH      N  ++FGG     + +    +DL+ F++ +++
Sbjct: 213 STNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHR 272

Query: 239 WT-KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDS-------W 290
           WT      T+P  R GH                 T  K  K  + G  L+D+       +
Sbjct: 273 WTIPTPIGTRPLGRYGHQV-----------SVIATTPKKAKLYLFGGQLDDNYFNDLAMY 321

Query: 291 KLTLTPDP-KKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLD 346
            L+   +P  +WQ+ K K F   P      V Y + LW       FGG         S  
Sbjct: 322 DLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLW------VFGG---------SSR 366

Query: 347 SIFYNDLYMFHLELNKWSKLRI---KPQ 371
               N LY++  +LN+W  L     KPQ
Sbjct: 367 GELQNQLYVYIPDLNEWRCLETEGDKPQ 394

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 108/262 (41%), Gaps = 60/262 (22%)

Query: 95  LFIFGGEFTDPETKLTHFYN-------DLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHS 147
           L IFGG+        TH  N       DLY +++ ++ W        P P  +  +  + 
Sbjct: 243 LVIFGGD--------THKLNSEGLLDDDLYLFNVDSHRW------TIPTPIGTRPLGRYG 288

Query: 148 SGIALLHGGEFSSPKQSKFY---------HYSDTWLFDCHE--KKFTKLEF-GGRDSSPS 195
             ++++     ++PK++K Y         +++D  ++D  +     ++ +F   +  +P 
Sbjct: 289 HQVSVIA----TTPKKAKLYLFGGQLDDNYFNDLAMYDLSDFRNPHSRWQFLKSKAFTPP 344

Query: 196 ARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLET-NTKPDARSGH 254
             + H ++A+     +FGG     S +    N L+ +     +W  LET   KP     H
Sbjct: 345 PLTNHTMVAYDYKLWVFGG-----SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEH 399

Query: 255 CFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT-PDPKKWQWEKLKNFK-NQ 312
                            TI KN   +  GK  +D ++ T+   + +  +W +L     N+
Sbjct: 400 S---------------ATIYKNLMCVFGGKNKDDEYQNTMYFLNLQTLKWYRLDTSHCNE 444

Query: 313 PSPRVGYSFNLWKQNKSVAFGG 334
           P PR G S +L + +K +  GG
Sbjct: 445 PLPRSGQSMSLMQNDKILIMGG 466

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 90/194 (46%), Gaps = 28/194 (14%)

Query: 83  LMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKY-VSQNAPLP 137
           ++  NP   K  L++FGG+        T+F +    DL S+  +N+ W+    +   P P
Sbjct: 202 IIAYNPMQTK--LYLFGGQLDK-----TYFNDLAMFDLSSFRRRNSHWEFLEPATTVPPP 254

Query: 138 RSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSAR 197
            ++  +  + + + +  GGE  +PK       ++T+ +D  +  ++K+E  G    P   
Sbjct: 255 LANHTMVTYGNKLWVF-GGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQE 307

Query: 198 SGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTK--PDARSGHC 255
             H  + +K+   +FGG         +Y ND++  D+ ++KW KL    +  P  RSGH 
Sbjct: 308 --HASVVYKHIMCVFGG----KYTHNAYSNDVYFLDLLSFKWYKLPHIKEGIPRERSGHS 361

Query: 256 FVPTDNSAIL-MGG 268
                N  IL MGG
Sbjct: 362 LTLMKNEKILIMGG 375

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 99/255 (38%), Gaps = 61/255 (23%)

Query: 130 VSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGG 189
           + +N P PR  G  +       ++ GG+     + K     D +LF+ +  K+T  +  G
Sbjct: 132 IDRNTPPPRV-GHASTLCGNAYVVFGGDTHKLNEDKLLD-DDIYLFNVNSYKWTIPQPIG 189

Query: 190 RDSSPSARSGHRI--IAW---KNYFILFGGFRDLGSGQTSYLNDLWCFDISNYK-----W 239
             S P  R GH+I  IA+   +    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 190 --SRPLGRYGHKISIIAYNPMQTKLYLFGGQLD-----KTYFNDLAMFDLSSFRRRNSHW 242

Query: 240 TKLE-TNTKPDARSGHCFVPTDNSAILMGGYC-KTIAKNNKNLMKGKILNDSWKLTLT-- 295
             LE   T P   + H  V   N   + GG   KT++  N+      I ND  K+  T  
Sbjct: 243 EFLEPATTVPPPLANHTMVTYGNKLWVFGGETPKTVS--NETYCYDPIQNDWSKIETTGE 300

Query: 296 -PDPKK----------------------------------WQWEKLKNFKNQ-PSPRVGY 319
            P P +                                  ++W KL + K   P  R G+
Sbjct: 301 IPPPVQEHASVVYKHIMCVFGGKYTHNAYSNDVYFLDLLSFKWYKLPHIKEGIPRERSGH 360

Query: 320 SFNLWKQNKSVAFGG 334
           S  L K  K +  GG
Sbjct: 361 SLTLMKNEKILIMGG 375

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 97/252 (38%), Gaps = 38/252 (15%)

Query: 126 WKKYVSQNAPLPR--SSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHE--KK 181
           W +   +++P PR   S +  V S     + GG ++         Y D W    +     
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVTGGLYNQSV------YGDVWQITANADGTS 124

Query: 182 FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTK 241
           FT        ++P  R GH      N +++FGG     +      +D++ F++++YKWT 
Sbjct: 125 FTPKAIQIDRNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWTI 184

Query: 242 LE-TNTKPDARSGH-----CFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT 295
            +   ++P  R GH      + P      L GG            +     ND     L+
Sbjct: 185 PQPIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQ-----------LDKTYFNDLAMFDLS 233

Query: 296 PDPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354
              ++   WE L+     P P   ++   +  NK   FGG     ET +++     N+ Y
Sbjct: 234 SFRRRNSHWEFLEPATTVPPPLANHTMVTYG-NKLWVFGG-----ETPKTVS----NETY 283

Query: 355 MFHLELNKWSKL 366
            +    N WSK+
Sbjct: 284 CYDPIQNDWSKI 295

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 19/152 (12%)

Query: 216 RDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDARSGHC---FVPTDNSAILMGGYCKT 272
           R +    T+  + +   +   Y W +++    P  R  H     V ++N   + GG    
Sbjct: 48  RSISGASTTLPSPIERENAKKYVWNRIKLKDSPFPRYRHSSSPIVSSENRIFVTGG---- 103

Query: 273 IAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAF 332
                  L    +  D W++T   D   +  + ++  +N P PRVG++  L   N  V F
Sbjct: 104 -------LYNQSVYGDVWQITANADGTSFTPKAIQIDRNTPPPRVGHASTLCG-NAYVVF 155

Query: 333 GGVYDLQETEESLDSIFYNDLYMFHLELNKWS 364
           GG  D  +  E  D +  +D+Y+F++   KW+
Sbjct: 156 GG--DTHKLNE--DKLLDDDIYLFNVNSYKWT 183

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 100/265 (37%), Gaps = 43/265 (16%)

Query: 126 WKKYVSQNAPLPRSSGAVA--VHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEK--- 180
           W K   +  P PR     +  ++ S    ++GG F S        Y DTW  +  E    
Sbjct: 22  WSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKENYNE 75

Query: 181 --------KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGG-FRDLGSGQTSYLNDLWC 231
                       ++  G  ++P  R GH      N  I+FGG    +        +DL+ 
Sbjct: 76  NDLERWHYSCNIIDIMG--TTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYF 133

Query: 232 FDISNYKWT-KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSW 290
            ++   KWT       +P  R GH     +++  L GG       N+  L+K  +LN   
Sbjct: 134 LNLDTTKWTIPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFND--LVKFDLLN--- 188

Query: 291 KLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFY 350
                    +W++ K K F   P P   +S   + +NK   FGG             +  
Sbjct: 189 ---FKDANSQWEFIKPKGFI--PPPLSNFSMCTF-ENKLYVFGG---------DTYQVLT 233

Query: 351 NDLYMFHLELNKWSKLRIKPQRHTN 375
           N+ +++  ELN+WS L    Q  TN
Sbjct: 234 NETFVYDPELNEWSILETFGQEDTN 258

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 98/262 (37%), Gaps = 62/262 (23%)

Query: 126 WKKYVSQNAPLPRSSGAVAVHSSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCHE 179
           W +   QN+P PR     + + S       I  LH              Y DTW+   ++
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQSV----------YGDTWIISTND 190

Query: 180 K--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
              +F        +++P  R GH      N F+LFGG     + +    +DL+ F++++Y
Sbjct: 191 NGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSY 250

Query: 238 KWT-KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT- 295
           KWT       +P  R GH        +I+     KT     K  + G   +D++   L  
Sbjct: 251 KWTIPHPIGPRPLGRYGHKI------SIMAANQMKT-----KLYLFGGQFDDTYFNDLAV 299

Query: 296 --------PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETE 342
                   PD     WE LK     P P      + Y  +LW       FGG        
Sbjct: 300 FDLSSFRRPD---SHWEFLKPTTFSPPPLTNHTMISYDNHLW------VFGG-------- 342

Query: 343 ESLDSIFYNDLYMFHLELNKWS 364
           ++L  +  N ++ + +  N WS
Sbjct: 343 DTLQGLI-NQVFKYDVANNDWS 363

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 224 SYLNDLWCFDISNYKWTKLET--NTKPDARSGHCFVPTDNSAIL-MGG 268
           +YLN ++  ++  ++W KL T     P  RSGH     +N  +L MGG
Sbjct: 398 TYLNSVYFLNLKTHEWFKLPTFKAGIPQGRSGHSLTLLNNDKLLIMGG 445

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 97/259 (37%), Gaps = 58/259 (22%)

Query: 126 WKKYVSQNAPLPRSSGAVAVHS--SGIALLHGGEFSSPKQSKFYHYSDTWLFDC--HEKK 181
           W +   + +P PR     + ++  SG   + GG      QS    Y DTW+     +   
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHD---QSV---YGDTWIIKSLDNATS 146

Query: 182 FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTK 241
           F  +     D++P  R GH      N F++FGG     +      +D++ F+I+++KWT 
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNINSHKWT- 205

Query: 242 LETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKI-----------LNDSW 290
                          +PT      +G Y   I+    N MK K+            ND  
Sbjct: 206 ---------------IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFDDTYFNDLA 250

Query: 291 KLTLTPDPKK-WQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEES 344
           +  L+   +    WE +K     P P      + +   LW       FGG     +T + 
Sbjct: 251 EFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLW------VFGG-----DTPQG 299

Query: 345 LDSIFYNDLYMFHLELNKW 363
           L     N+++MF    N W
Sbjct: 300 L----TNEVFMFDPAANDW 314

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 95/207 (45%), Gaps = 35/207 (16%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSI----KNNSWKKY 129
           RP  R  H +        K +L++FGG+F D       ++NDL  + +    +++S  ++
Sbjct: 213 RPLGRYGHKISIIAANQMKTKLYVFGGQFDD------TYFNDLAEFDLSSFRRSDSHWEF 266

Query: 130 VSQNAPLPRSSGAVAVHSSGIALLH-----GGEFSSPKQSKFYHYSDTWLFDCHEKKFTK 184
           +     +P     +A H+  I+  H     GG+  +P+       ++ ++FD     +  
Sbjct: 267 IKPATFMP---PPLANHTM-ISFDHKLWVFGGD--TPQGLT----NEVFMFDPAANDWCV 316

Query: 185 LEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLET 244
           ++  G  + P     H  I +++   +FGG       Q +Y N ++  +  + KW KL T
Sbjct: 317 VQTTG--NIPPPLQEHAAIIYRDLMCVFGG----KDAQDNYSNAVYFLNFRSLKWFKLPT 370

Query: 245 --NTKPDARSGHCF-VPTDNSAILMGG 268
             N  P ARSGH   + ++N  ++MGG
Sbjct: 371 FNNMIPRARSGHSLTLLSNNKLLIMGG 397

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 100/257 (38%), Gaps = 50/257 (19%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLH 154
             IFGG+ T          +D+Y ++I ++ W        P P+    +  +   I+++ 
Sbjct: 174 FVIFGGD-THKVNDAGLMDDDIYLFNINSHKW------TIPTPQGPRPLGRYGHKISIIA 226

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCHEKKFTKLEFGGRDSS----------PSARSGH 200
             +     ++K Y     + DT+  D  E  F    F   DS           P   + H
Sbjct: 227 ANQM----KTKLYVFGGQFDDTYFNDLAE--FDLSSFRRSDSHWEFIKPATFMPPPLANH 280

Query: 201 RIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLET--NTKPDARSGHCFVP 258
            +I++ +   +FGG  D   G T   N+++ FD +   W  ++T  N  P  +     + 
Sbjct: 281 TMISFDHKLWVFGG--DTPQGLT---NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIY 335

Query: 259 TDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQ-PSPRV 317
            D    LM  +    A++N +       N  + L      +  +W KL  F N  P  R 
Sbjct: 336 RD----LMCVFGGKDAQDNYS-------NAVYFLNF----RSLKWFKLPTFNNMIPRARS 380

Query: 318 GYSFNLWKQNKSVAFGG 334
           G+S  L   NK +  GG
Sbjct: 381 GHSLTLLSNNKLLIMGG 397

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 99/253 (39%), Gaps = 41/253 (16%)

Query: 126 WKKYVSQNAPLPRSSGAVAVHSS--GIALLHGGEFSSPKQSKFYHYSDTWLFDCHE-KKF 182
           W ++    +P PR     + H+S      + GG     +QS    Y D W  +  + K F
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGLR---EQSV---YGDVWSINHKDDKSF 90

Query: 183 TKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKL 242
           +        ++P  R GH      N  ILFGG     +      +DL+ F++++YKWT  
Sbjct: 91  SASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIP 150

Query: 243 E-TNTKPDARSGH-----CFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTP 296
           E    +P  R GH        PT     L GG       N+ ++               P
Sbjct: 151 EPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQFDDTYFNDLSMFDLSTFR-------KP 203

Query: 297 DPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDL 353
           D  +W++ K K+F   P      + Y   LW       FGG        E+L  +  N++
Sbjct: 204 D-AQWEFIKPKSFFPPPVSNHTMISYDNKLW------VFGG--------ETLQGLI-NEV 247

Query: 354 YMFHLELNKWSKL 366
           +++   +N WS +
Sbjct: 248 FVYDPIVNDWSVI 260

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 95/216 (43%), Gaps = 31/216 (14%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSI----KNNSWKKY 129
           RP  R  H +     Q  K +LF+FGG+F D       ++NDL  + +    K ++  ++
Sbjct: 156 RPLGRYGHKISIIATQPTKTKLFLFGGQFDD------TYFNDLSMFDLSTFRKPDAQWEF 209

Query: 130 VSQNA--PLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF 187
           +   +  P P S+  +  + + + +  G              ++ +++D     ++ +E 
Sbjct: 210 IKPKSFFPPPVSNHTMISYDNKLWVFGGETLQG-------LINEVFVYDPIVNDWSVIET 262

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTK 247
            G  SSP     H  + +KN   + GG       + +Y+N ++  +++  KW KL  +  
Sbjct: 263 TG--SSPPPIQEHAAVVYKNLMCVVGG----KDSKDNYMNSVYFLNLNTLKWFKL-PHIN 315

Query: 248 P---DARSGH-CFVPTDNSAILMGGYCKTIAKNNKN 279
           P     RSGH   +  D+S +++ G     A+  +N
Sbjct: 316 PGIMQGRSGHTATLLNDDSILILSGDKNDFARPGEN 351

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 63/149 (42%), Gaps = 17/149 (11%)

Query: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVA--VHSSGIALLHGGEFSSPKQSKFYHYS 170
           Y+ L+  +I    W +   QN+P PR     +  V   G   + GG      QS    Y 
Sbjct: 151 YHKLHPTTI----WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHD---QSV---YG 200

Query: 171 DTWLFDCHEK----KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYL 226
           DTW+            T       +++P  R GH      N F++FGG     +   S  
Sbjct: 201 DTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD 260

Query: 227 NDLWCFDISNYKWTKLE-TNTKPDARSGH 254
           +D++ F+I++YKWT  +    +P  R GH
Sbjct: 261 DDIYLFNINSYKWTIPKPVGQRPLGRYGH 289

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 98/263 (37%), Gaps = 71/263 (26%)

Query: 130 VSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGG 189
           +S+N P PR   A  +  +   +  G      K        D +LF+ +  K+T  +  G
Sbjct: 223 ISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD--DDIYLFNINSYKWTIPKPVG 280

Query: 190 RDSSPSARSGHRI--IA---WKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYK-----W 239
           +   P  R GH+I  IA    K    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 281 Q--RPLGRYGHKISIIATSQMKTKLYLFGGQFD-----DTYFNDLVVFDLSSFRRPDSHW 333

Query: 240 TKLETNT-KPDARSGHCFVPTDNSAILMGG---------------------YCKTIAKNN 277
             +   +  P   + H     D+   + GG                       +T A NN
Sbjct: 334 EFIRPKSFIPPPLTNHTMCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDWCVVETFANNN 393

Query: 278 -----------------KNLM---KGK-----ILNDSWKLTLTPDPKKWQWEKLKNFK-N 311
                            K+LM    GK      LND + L L    K  +W KL  +K  
Sbjct: 394 DVSNIPPPIQEHAAVLYKDLMCVIGGKDESDNYLNDVYFLNL----KTLKWFKLPFYKEG 449

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            P  R G+S  L K +K +  GG
Sbjct: 450 VPQGRSGHSVTLLKNDKILIMGG 472

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 83/208 (39%), Gaps = 29/208 (13%)

Query: 74  ERPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKK 128
           +RP  R  H +        K +L++FGG+F D     T+F +    DL S+   ++ W+ 
Sbjct: 281 QRPLGRYGHKISIIATSQMKTKLYLFGGQFDD-----TYFNDLVVFDLSSFRRPDSHWEF 335

Query: 129 YVSQN-APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYH--YSDTWLFDCHEKKFTKL 185
              ++  P P ++  +  +   + +  G          F +    + W   C  + F   
Sbjct: 336 IRPKSFIPPPLTNHTMCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDW---CVVETFA-- 390

Query: 186 EFGGRDSS--PSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE 243
                D S  P     H  + +K+   + GG  +      +YLND++  ++   KW KL 
Sbjct: 391 --NNNDVSNIPPPIQEHAAVLYKDLMCVIGGKDE----SDNYLNDVYFLNLKTLKWFKLP 444

Query: 244 --TNTKPDARSGHCFVPTDNSAIL-MGG 268
                 P  RSGH      N  IL MGG
Sbjct: 445 FYKEGVPQGRSGHSVTLLKNDKILIMGG 472

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 82/206 (39%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCHE--KKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYL 226
           Y DTW+    +  K+F+       +++P  R GH      N F++FGG     + +    
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD 150

Query: 227 NDLWCFDISNYKWT-KLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKI 285
           +D++  +++++KWT       +P  R GH        +I+     KT             
Sbjct: 151 DDVYLLNVNSHKWTIPHPVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDTY 204

Query: 286 LNDSWKLTLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND     L+    PD   W + K  +F   P      V Y + LW       FGG    
Sbjct: 205 FNDLAVYDLSSFRRPD-SHWVFVKPASFVPPPLTNHTMVSYDYKLW------VFGG---- 253

Query: 339 QETEESLDSIFYNDLYMFHLELNKWS 364
            +T + L     N+L+++   +N WS
Sbjct: 254 -DTPQGL----INELFVYDPVVNDWS 274

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 64/143 (44%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN-TKPDARS 252
           P   + H ++++     +FGG    G      +N+L+ +D     W+ +ET   KP    
Sbjct: 233 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFVYDPVVNDWSVVETTGAKPPPLQ 287

Query: 253 GHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQ 312
            H  V   +   ++GG      K++++        D + + +    K ++W KL +F++ 
Sbjct: 288 EHAAVLYRDLMCVVGG------KDDQD----NYSQDVYFMNM----KTFRWFKLPHFQDM 333

Query: 313 -PSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 334 VPSPRSGHSVTLLANRKLLIMGG 356

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 19/129 (14%)

Query: 239 WTKLETNTKPDARSGH---CFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT 295
           W +++    P  R  H    +    N  I++GG           L    +  D+W L   
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGG-----------LHDQSVYGDTWILRAQ 100

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYM 355
            + K++    ++  +  P PRVG++  L   N  V FGG  D  +T    + +  +D+Y+
Sbjct: 101 DNGKQFSARTIEITETTPPPRVGHAATLCG-NAFVIFGG--DTHKTNN--EGLMDDDVYL 155

Query: 356 FHLELNKWS 364
            ++  +KW+
Sbjct: 156 LNVNSHKWT 164

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 57/138 (41%), Gaps = 19/138 (13%)

Query: 126 WKKYVSQNAPLPRSSGAVAVHSSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCHE 179
           W +   Q++P PR     + + S       I  LH              Y DTW+ +  +
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV----------YGDTWIINVDD 143

Query: 180 K--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
              +F+       + +P  R GH      N F++FGG     + +    +DL+ F+I+++
Sbjct: 144 SGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSF 203

Query: 238 KWT-KLETNTKPDARSGH 254
           KWT       +P  R GH
Sbjct: 204 KWTIPHPVGPRPLGRYGH 221

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 82/204 (40%), Gaps = 29/204 (14%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSI-----KNNSWKK 128
           RP  R  H +        K +L++FGG+F D       F+NDL  Y +      ++ W+ 
Sbjct: 214 RPLGRYGHKISIIATNQMKTKLYLFGGQFDD------TFFNDLAVYDLSSFRRSDSHWEF 267

Query: 129 YVSQN-APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF 187
              +   P P ++  +  +   + +  G              +  +++D     ++ +E 
Sbjct: 268 LKPKTFVPPPLANHTMVSYDHKLWIFGGDTMQG-------LINKVFVYDIMSNDWSLVET 320

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTK 247
            G  + P     H  + +K+   + GG  +    Q  YLN ++  ++ + +W K      
Sbjct: 321 TG--ARPPPLQEHAALIYKDLMCVVGGKDE----QDIYLNSIYFLNLKSCRWFKFPVFKA 374

Query: 248 --PDARSGHCFVPTDNSAIL-MGG 268
             P  RSGH      N+ IL MGG
Sbjct: 375 GIPQGRSGHSITLLKNNKILIMGG 398

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 64/143 (44%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN-TKPDARS 252
           P   + H ++++ +   +FGG  D   G    +N ++ +DI +  W+ +ET   +P    
Sbjct: 275 PPPLANHTMVSYDHKLWIFGG--DTMQG---LINKVFVYDIMSNDWSLVETTGARPPPLQ 329

Query: 253 GHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFK-N 311
            H  +   +   ++GG      K+ +++     LN  + L L    K  +W K   FK  
Sbjct: 330 EHAALIYKDLMCVVGG------KDEQDIY----LNSIYFLNL----KSCRWFKFPVFKAG 375

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            P  R G+S  L K NK +  GG
Sbjct: 376 IPQGRSGHSITLLKNNKILIMGG 398

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 86/205 (41%), Gaps = 30/205 (14%)

Query: 74  ERPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWK- 127
           +RP  R  H ++  + +  K  L++FGG+F D     T+F +    DL S+   ++ W  
Sbjct: 271 QRPLGRYGHKIVTISAEQTK--LYLFGGQFDD-----TYFGDLAVFDLSSFRRPDSHWVF 323

Query: 128 -KYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLE 186
            K    N P P ++  +  +   I +  G        ++ Y YS T         +  +E
Sbjct: 324 LKPSGFNPP-PLTNHTMVTYQDKIWVFGGDTLEEGLINRVYLYSPT------NNSWEIVE 376

Query: 187 FGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE--T 244
             G    P     H  I +K+   + GG       + +YLN L+  ++ + KW KL    
Sbjct: 377 TTG--DIPPPMQEHAAIVYKDLMCVVGG----KDAEDNYLNTLYFLNLQSLKWFKLPFYK 430

Query: 245 NTKPDARSGHCFVPTDNSAIL-MGG 268
           N  P  RSGH      N  IL MGG
Sbjct: 431 NNIPQGRSGHSVTLLKNDQILIMGG 455

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 59/144 (40%), Gaps = 20/144 (13%)

Query: 126 WKKYVSQNAPLPRSSGAVAVH--SSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEK--- 180
           W +    N+P PR     + H    G   + GG      QS    Y DTW+    +    
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHD---QSV---YGDTWILTASDIDKT 200

Query: 181 ------KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDI 234
                 K T +E    +S+P  R GH      N F++FGG     +      +DL+  +I
Sbjct: 201 GAINSFKSTTIEI--TESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNI 258

Query: 235 SNYKWTKLE-TNTKPDARSGHCFV 257
           ++YKWT  +    +P  R GH  V
Sbjct: 259 NSYKWTIPKPVGQRPLGRYGHKIV 282

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 106/255 (41%), Gaps = 44/255 (17%)

Query: 124 NSWKKY---VSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEK 180
           NS+K     ++++ P PR   A  +   G A +  G  +    S      D +L + +  
Sbjct: 204 NSFKSTTIEITESTPPPRVGHASTL--CGNAFVVFGGDTHKVNSDGLMDDDLYLLNINSY 261

Query: 181 KFTKLEFGGRDSSPSARSGHRII---AWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
           K+T  +  G+   P  R GH+I+   A +    LFGG  D      +Y  DL  FD+S++
Sbjct: 262 KWTIPKPVGQ--RPLGRYGHKIVTISAEQTKLYLFGGQFD-----DTYFGDLAVFDLSSF 314

Query: 238 K-----WTKLE-TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWK 291
           +     W  L+ +   P   + H  V   +   + GG          + ++  ++N  + 
Sbjct: 315 RRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG----------DTLEEGLINRVYL 364

Query: 292 LTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYN 351
            +    P    WE ++   + P P   ++  ++K    V  G     ++ E++    + N
Sbjct: 365 YS----PTNNSWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG-----KDAEDN----YLN 411

Query: 352 DLYMFHLELNKWSKL 366
            LY  +L+  KW KL
Sbjct: 412 TLYFLNLQSLKWFKL 426

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 106/256 (41%), Gaps = 48/256 (18%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPL-PRSSGAVAVHSSGIAL- 152
             IFGG+ T    K     +D+Y ++I  NS+K  + Q  P+ PR  G      S IA  
Sbjct: 155 FVIFGGD-THKTNKDGLMDDDIYLFNI--NSYKWTIPQ--PVGPRPLGRYGHKISIIATS 209

Query: 153 -------LHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLE-----FGGRDSSPSARSGH 200
                  + GG+F         +++D  ++D     F K E        +   P   + H
Sbjct: 210 QMKTKLYVFGGQFDD------SYFNDLCVYDL--SSFRKPESHWEFLKPKSFIPPPLTNH 261

Query: 201 RIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETN-TKPDARSGHCFVPT 259
            ++++     +FGG       Q   +N L+ FD     W  +ET   KP     H  V  
Sbjct: 262 TMVSYDYKLWVFGG-----DTQQGLINQLFMFDPVINDWRVVETTGEKPPPVQEHAAVMF 316

Query: 260 DNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFK-NQPSPRVG 318
           ++   +MGG      K+ +++     LN  + L L    K  +W K  ++K N P  R G
Sbjct: 317 NDLMCIMGG------KDEQDVY----LNSVYFLNL----KSLKWFKFNDYKLNIPQGRSG 362

Query: 319 YSFNLWKQNKSVAFGG 334
           +S  L K N+ +  GG
Sbjct: 363 HSITLLKNNRLLIMGG 378

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 77/183 (42%), Gaps = 38/183 (20%)

Query: 193 SPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE-TNTKPDAR 251
           +P  R GH      N F++FGG     +      +D++ F+I++YKWT  +    +P  R
Sbjct: 139 TPPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQPVGPRPLGR 198

Query: 252 SGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDS-------WKLTLTPDPKK-WQW 303
            GH        +I+     KT     K  + G   +DS       + L+    P+  W++
Sbjct: 199 YGHKI------SIIATSQMKT-----KLYVFGGQFDDSYFNDLCVYDLSSFRKPESHWEF 247

Query: 304 EKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLEL 360
            K K+F   P      V Y + LW       FGG     +T++ L     N L+MF   +
Sbjct: 248 LKPKSFIPPPLTNHTMVSYDYKLW------VFGG-----DTQQGL----INQLFMFDPVI 292

Query: 361 NKW 363
           N W
Sbjct: 293 NDW 295

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 100/250 (40%), Gaps = 48/250 (19%)

Query: 130 VSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLE-FG 188
           +++  P PR   A  +  +   +  G    + K        D +LF+ +  K+T  +  G
Sbjct: 135 ITEYTPPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMD--DDIYLFNINSYKWTIPQPVG 192

Query: 189 GRDSSPSARSGHRI--IA---WKNYFILFGG-FRDLGSGQTSYLNDLWCFDISNYK---- 238
            R   P  R GH+I  IA    K    +FGG F D      SY NDL  +D+S+++    
Sbjct: 193 PR---PLGRYGHKISIIATSQMKTKLYVFGGQFDD------SYFNDLCVYDLSSFRKPES 243

Query: 239 -WTKLETNT-KPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTP 296
            W  L+  +  P   + H  V  D    + GG  +     N+  M   ++ND        
Sbjct: 244 HWEFLKPKSFIPPPLTNHTMVSYDYKLWVFGGDTQQ-GLINQLFMFDPVIND-------- 294

Query: 297 DPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMF 356
                 W  ++    +P P         +++ +V F  +  +   ++  D ++ N +Y  
Sbjct: 295 ------WRVVETTGEKPPP--------VQEHAAVMFNDLMCIMGGKDEQD-VYLNSVYFL 339

Query: 357 HLELNKWSKL 366
           +L+  KW K 
Sbjct: 340 NLKSLKWFKF 349

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 16/137 (11%)

Query: 239 WTKLETNTKPDARSGHC---FVPTDNSAILMGG------YCKT--IAKNNKNLMKGKILN 287
           W + + +  P  R  H     V +DN   ++GG      Y  T  I++N  N+     ++
Sbjct: 55  WCRYKLHNSPFPRYRHVASSVVSSDNKVFVIGGLHDQSVYGDTWIISENTININSPATMH 114

Query: 288 DSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDS 347
                T T     +  + ++  +  P PRVG++  L   N  V FGG  D  +T +  D 
Sbjct: 115 TPTSTTSTTSNISFSSKTVEITEYTPPPRVGHASTLCG-NAFVIFGG--DTHKTNK--DG 169

Query: 348 IFYNDLYMFHLELNKWS 364
           +  +D+Y+F++   KW+
Sbjct: 170 LMDDDIYLFNINSYKWT 186

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 19/129 (14%)

Query: 239 WTKLETNTKPDARSGHC---FVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLT 295
           W +++    P  R  H    +   DN   ++GG           L    +  D+W +T T
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGG-----------LHDQSVYGDTWSITST 190

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYM 355
            +  ++  + L+     P PRVG++  L   N  V FGG  D  +  +  D +  +D+Y+
Sbjct: 191 NNGTQFISKALEILDLSPPPRVGHASTLCG-NAFVVFGG--DTHKVNK--DGLMDDDIYL 245

Query: 356 FHLELNKWS 364
           F++  +KW+
Sbjct: 246 FNINSHKWT 254

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 95/260 (36%), Gaps = 48/260 (18%)

Query: 126 WKKYVSQNAPLPRSSGAVAVHSSG------IALLHGGEFSSPKQSKFYHYSDTWLFDC-- 177
           W +    N+P PR     + + S       I  LH              Y DTW      
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV----------YGDTWSITSTN 191

Query: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237
           +  +F        D SP  R GH      N F++FGG     +      +D++ F+I+++
Sbjct: 192 NGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSH 251

Query: 238 KWT-KLETNTKPDARSGH--CFVPTDNSAI---LMGGYCKTIAKNNKNLMKGKILNDSWK 291
           KWT       +P  R GH    + T +S     L GG                  ND   
Sbjct: 252 KWTIPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ-----------FDDTYFNDIAV 300

Query: 292 LTLTPDPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFY 350
             L+   +    WE +K     P P   ++   +  NK   FGG     +T++ L     
Sbjct: 301 FDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTY-DNKLWVFGG-----DTKDGL----I 350

Query: 351 NDLYMFHL--ELNKWSKLRI 368
           ND+Y F     +N W+K+ +
Sbjct: 351 NDIYAFDPADSINTWTKIDV 370

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 113/295 (38%), Gaps = 59/295 (20%)

Query: 93  HELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQN------APLPRSSGAVAVH 146
           +E+F+ GG            Y D +S +  NN   +++S+       +P PR   A  + 
Sbjct: 167 NEIFVIGGLHDQ------SVYGDTWSITSTNNG-TQFISKALEILDLSPPPRVGHASTLC 219

Query: 147 SSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFT-KLEFGGRDSSPSARSGHRI--I 203
            +   +  G      K        D +LF+ +  K+T     G R   P  R GH+I  I
Sbjct: 220 GNAFVVFGGDTHKVNKDGLMD--DDIYLFNINSHKWTIPSPVGPR---PLGRYGHKISII 274

Query: 204 AW---KNYFILFGG-FRDLGSGQTSYLNDLWCFDISNYK-----WTKLE-TNTKPDARSG 253
           A    K    LFGG F D      +Y ND+  FD+S+++     W  ++     P   + 
Sbjct: 275 ATSSSKTKLYLFGGQFDD------TYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTN 328

Query: 254 HCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQP 313
           H  V  DN   + GG  K             ++ND +     P      W K+    + P
Sbjct: 329 HTMVTYDNKLWVFGGDTK-----------DGLINDIY--AFDPADSINTWTKIDVTGDIP 375

Query: 314 SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLELNKWSKLRI 368
            P   +S  ++  N     GG        +  + ++ N ++ F+ +  KW K  I
Sbjct: 376 CPVQEHSALIY-DNLMCVIGG--------KDENDMYLNSVHFFNFDKLKWFKFPI 421

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 82/204 (40%), Gaps = 27/204 (13%)

Query: 75  RPSCRV-HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKY 129
           RP  R  H +       +K +L++FGG+F D     T+F +    DL S+   ++ W+  
Sbjct: 262 RPLGRYGHKISIIATSSSKTKLYLFGGQFDD-----TYFNDIAVFDLSSFRRADSHWEFI 316

Query: 130 VSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEK--KFTKLEF 187
             +    P  +    V       + GG+      +K    +D + FD  +    +TK++ 
Sbjct: 317 KPKGLIPPPMTNHTMVTYDNKLWVFGGD------TKDGLINDIYAFDPADSINTWTKIDV 370

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLET--N 245
            G    P     H  + + N   + GG  +       YLN +  F+    KW K     +
Sbjct: 371 TG--DIPCPVQEHSALIYDNLMCVIGGKDE----NDMYLNSVHFFNFDKLKWFKFPIFKS 424

Query: 246 TKPDARSGHCFVPTDNSAIL-MGG 268
                RSGH     +N+ IL MGG
Sbjct: 425 GIMQGRSGHSISLLNNNKILIMGG 448

>SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]
           {ON} similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 697

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 22/112 (19%)

Query: 240 TKLETNTKPDARSGHCFVPTD-NSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDP 298
           + ++++  P  R  H F   D N+ IL GG     A N       K L D W LT     
Sbjct: 423 SAIDSSRIPQERMCHTFTYVDDNTCILAGG---RTAPN-------KTLEDVWILTRKQSE 472

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGG--------VYDLQETE 342
             W+W++  N    P PR  +S  L  +++ + +GG        VYD+++ E
Sbjct: 473 GAWEWQQGLNL---PDPRFRHSACLLNEHQLLIYGGKTRGSTFLVYDMRKNE 521

>YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}
           PPM2AdoMet-dependent tRNA methyltransferase also
           involved in methoxycarbonylation; required for the
           synthesis of wybutosine (yW), a modified guanosine found
           at the 3'-position adjacent to the anticodon of
           phe-tRNA; similarity to Ppm1p
          Length = 695

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 57/138 (41%), Gaps = 16/138 (11%)

Query: 134 APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSS 193
            P+ R  G V V  + +  + G   S+P     Y  ++      H  K          S 
Sbjct: 384 CPINRKFGDVDVAGNDVFYMGG---SNP-----YRVNEILQLSIHYDKIDMKNIEVSSSE 435

Query: 194 -PSARSGHRI--IAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDA 250
            P AR  H    I+  N  +L GG +    G    L+D W FD+   +W+ +++ +    
Sbjct: 436 VPVARMCHTFTTISRNNQLLLIGGRKAPHQG----LSDNWIFDMKTREWSMIKSLSHTRF 491

Query: 251 RSGHCFVPTDNSAILMGG 268
           R   C +P D + +++GG
Sbjct: 492 RHSACSLP-DGNVLILGG 508

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 11/61 (18%)

Query: 219 GSGQTSYLNDLWCFDISNYKWTKLETNTKPDARS-----------GHCFVPTDNSAILMG 267
           GS  T+   D+W FD+  ++WTK+ T  KP  +            GH  + +   A+ +G
Sbjct: 701 GSDDTNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMMTSGCMAVCVG 760

Query: 268 G 268
           G
Sbjct: 761 G 761

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 89/233 (38%), Gaps = 52/233 (22%)

Query: 128 KYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEF 187
           ++ S    L R+ G+   H  G  +  GG   +P +      SDT   D  +  F +L+ 
Sbjct: 382 EFTSLEYDLKRNFGSSIKHDEGNIMYTGG--CNPNR-----ISDTLKIDTQKNTFIQLQ- 433

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYL-----------NDLWCFDISN 236
                 P AR+ H              F  LG G+T+ +           ND W ++++ 
Sbjct: 434 -NHSVLPPARACHT-------------FTRLGDGETAMVIGGRNAPHRAVNDCWFYNLNT 479

Query: 237 YKWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTP 296
            +W K      P+ R  H  V TD + +L+ G         K   +  +L D+   T  P
Sbjct: 480 NEWQK--GPELPEPRFRHSCVATDKNTLLVCG--------GKTDGQAFLLYDNISETFKP 529

Query: 297 DPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIF 349
            P      K+      P      +F+  K N+ +  GG Y+  ET    DS+F
Sbjct: 530 CPVDHPSLKI------PLISAAVAFD-EKNNRGIIMGG-YN-SETGMISDSLF 573

>Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W
           (REAL)
          Length = 719

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 194 PSARSGHRI--IAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDAR 251
           P AR  H    +   +  +L GG +    G    L D W FDI   +W+ +++ +    R
Sbjct: 437 PDARMCHTFTTLCSNDQLLLVGGRKAPHQG----LCDNWIFDIKKREWSMIQSLSHTRFR 492

Query: 252 SGHCFVPTDNSAILMGG 268
              C +P D + ++MGG
Sbjct: 493 HSACNLP-DGNVLIMGG 508

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 255 CFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEK--------- 305
            F+PT  S+ +     K + + N+   +G     ++ + + P+ +K + EK         
Sbjct: 281 MFIPTSTSSKIHQKLSKAVVRKNQRQNQGP---GTYIINMDPEVEKRELEKKQSQILRDR 337

Query: 306 ----LKNFKNQPSPRVGYSFNLWKQNKSVAFGGV 335
               LK  + Q SP VG+     KQ+   A+G  
Sbjct: 338 RKRQLKEKEKQESPDVGFETAFRKQSSPTAYGAT 371

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 47/120 (39%), Gaps = 19/120 (15%)

Query: 103 TDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPK 162
           T PE      + +L + +       +   Q  PL  +  A  V      ++HGG   S  
Sbjct: 569 TTPEETSQAIFANLPASAKVGRPANRDARQRTPLSGNKDAKTV------IIHGGSDGS-- 620

Query: 163 QSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSARS-------GHRIIAWKNYFILFGGF 215
                 Y D W FD  +++++++    RD     R        GH I   ++ F+L+GG 
Sbjct: 621 ----RVYGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIFHSRDEFLLYGGL 676

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 219 GSGQTSYLNDLWCFDISNYKWTKLETNTKPDARS---------GHCFVPTDNSAILMGG 268
           GS +T    D+W +DI    W+++ T+ K +A           GH  V     A+ +GG
Sbjct: 676 GSNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVGGMAVFVGG 734

>Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W
           (REAL)
          Length = 708

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 194 PSARSGHRIIAW--KNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDAR 251
           P AR  H + ++   +  +L GG +    G    L+D W FD    +W+ ++  +    R
Sbjct: 450 PLARMCHTLTSFCGSSQLLLVGGRKAPHQG----LSDNWIFDTKTNEWSMVQKLSHTRFR 505

Query: 252 SGHCFVPTDNSAILMGGYCK 271
              C + +DNS ++ GG  K
Sbjct: 506 HSACNL-SDNSVLIFGGVTK 524

>Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)
          Length = 874

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 10/57 (17%)

Query: 210 ILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDARSGHCFVPTDNSAILM 266
           I+FGG+R  G  +   +NDLW          K+E       + G+C      +AILM
Sbjct: 500 IIFGGYRQTGDDRYEAMNDLW----------KIEIPVTRRGKKGYCKFSETANAILM 546

>KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON}
           weakly similar to uniprot|Q08886 Saccharomyces
           cerevisiae YOR371C GPB1 Proposed beta subunit of the
           heterotrimeric G protein that interacts with the
           receptor Grp1p has signaling role in response to
           nutrients involved in regulation of pseudohyphal growth
           through cAMP levels homolog of Gpb2p
          Length = 795

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 10/60 (16%)

Query: 219 GSGQTSYLNDLWCFDISNYKWTKLETNTKPDAR----------SGHCFVPTDNSAILMGG 268
           GS       D+WC+D+    WTKL    K              +GH FV      +++GG
Sbjct: 621 GSANKFIHGDMWCYDLDEGTWTKLSLKAKDKETGELKIVEFPLTGHTFVHNKQITVVIGG 680

>Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)
          Length = 892

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 10/58 (17%)

Query: 209 FILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKPDARSGHCFVPTDNSAILM 266
            I+FGG+R  G  +   +NDLW          K+E       + G+C      +AILM
Sbjct: 510 IIIFGGYRQTGDDRYEAMNDLW----------KIEIPVIRRGKKGYCKFSETANAILM 557

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query: 219 GSGQTSYLNDLWCFDISNYKWTKLETNTKPD---------ARSGHCFVPTDNSAILMGGY 269
           GS  T   +D+W FD     W ++ET  + +         A +GH      +++I +GG 
Sbjct: 664 GSNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGGM 723

Query: 270 CKT 272
            ++
Sbjct: 724 MQS 726

>Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W
           (REAL)
          Length = 695

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 189 GRDSSPSARSGHRIIAW--KNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNT 246
           G    P AR  H + A       +L GG +    G    L+D W FD    +W+ +++  
Sbjct: 432 GSSELPVARMCHTLTALYGNEQLLLIGGRKAPHQG----LSDNWIFDTKKREWSMIQSLP 487

Query: 247 KPDARSGHCFVPTDNSAILMG 267
               R   C +  DN  IL G
Sbjct: 488 HTRFRHSACNLSDDNVLILGG 508

>TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8.157
           YGL197W
          Length = 1479

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 89/227 (39%), Gaps = 32/227 (14%)

Query: 61  KQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYS 120
           K T+LE   +T   R    V+  +F      +   F+ GG  T P     +    +Y   
Sbjct: 30  KLTDLEKAKLTLNLRTGAAVN--LF------RSNFFVNGG-LTIPLNLKEYTLKQIYQEL 80

Query: 121 IKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHY---SDTWLFDC 177
           I+  S KK   +N+   R++     +SS I L    ++ +       H    S+T+  D 
Sbjct: 81  IRYFSIKKTAEKNS---RANSNKRKNSSTIQLYQDDDYYNIDIIPDLHSYISSETFNLDL 137

Query: 178 HEKKFTKLEFGGRDSSPSA------RSGHRIIAWKNYFILFGGFRDLGSGQTSYL---ND 228
            E+ + ++     ++S +       R  H I     Y  LFGG   +  G    L   N+
Sbjct: 138 VERTWVRVSTTVVNNSENTGPFFKPRILHTICYTNAYLYLFGGLT-ISDGDPKILVPSNE 196

Query: 229 LWCFDISNYKWTKLETNTKPDARSGHCFVPT-------DNSAILMGG 268
           LW  ++   KW+ +  ++   AR  H  V         D   +++GG
Sbjct: 197 LWKLNLQTKKWSLVAKDSNIPARFSHTMVVKYEDDDSHDTKLVIIGG 243

>NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa]
           {ON} Anc_7.9 YAL056W
          Length = 856

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 17/89 (19%)

Query: 189 GRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLETNTKP 248
           G    P  ++G+     K+  +L GG     S       D+W F+I    W+K++T+ K 
Sbjct: 657 GHQQHPQKKNGY---GDKSVLVLHGG-----SNNNKVFGDMWWFNIETKIWSKIDTHAKT 708

Query: 249 DARS---------GHCFVPTDNSAILMGG 268
           +            GH  V T+  +I +GG
Sbjct: 709 EKDELIPIEMKLVGHTMVDTNFMSINIGG 737

>KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9
           YAL056W
          Length = 753

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 8/58 (13%)

Query: 219 GSGQTSYLNDLWCFDISNYKWTKLETNTKPDAR--------SGHCFVPTDNSAILMGG 268
           GS       DLW FD+ +  W KL+ + K +           GH  V   + AI  GG
Sbjct: 652 GSNNFDVFGDLWWFDLESLTWNKLDISAKINGTLQPVELKLVGHTMVNIGHVAIFSGG 709

>KLLA0F00462g Chr6 complement(33094..34980) [1887 bp, 628 aa] {ON}
           some similarities with uniprot|P27825 Saccharomyces
           cerevisiae YAL058W CNE1
          Length = 628

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 50/119 (42%), Gaps = 12/119 (10%)

Query: 289 SWKLTLTPDPK---KWQWEKLKN--FKNQPSPR-----VGYSFNLWKQNKSVAFGGVYDL 338
           +WK  + P+P    +W+   + N  +    +P         SF++W     ++F  +Y  
Sbjct: 368 TWKAEMIPNPNYQGEWKAPLIANPNYYEDKTPANIDAITAISFDIWSSASDISFDNIYVG 427

Query: 339 QETEESLDSIFYNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQD 397
           +  EE+   +  N  ++  L L K     +  + H+ + N   TS+  S K   K + D
Sbjct: 428 KSIEEA--ELVGNSTFLPKLSLEKKELEVVMEKAHSEDVNEVDTSEESSKKTPYKNVVD 484

>ZYRO0G05148g Chr7 complement(413934..417206) [3273 bp, 1090 aa]
           {ON} similar to uniprot|P53893 Saccharomyces cerevisiae
           YNL163C
          Length = 1090

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 7/66 (10%)

Query: 595 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEE-----ERLEDTGGI--IERDAT 647
           T  I+NN+ LKG+ LK     L  D  W+  + VT+ +     E++  T GI  + RD +
Sbjct: 276 TKKITNNKGLKGRSLKPLFVSLILDNIWKIYENVTVSKNLEVIEKITKTLGINVLPRDLS 335

Query: 648 AKPSKR 653
           +K  K+
Sbjct: 336 SKDDKQ 341

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 207 NYFILFGGFRDLGSGQTSYLNDLWCFDI 234
           N  ++FGG++ +G  +   +NDLW  DI
Sbjct: 496 NRILIFGGYKQVGDDEYEAMNDLWQVDI 523

>SAKL0D14740g Chr4 complement(1212855..1215377) [2523 bp, 840 aa]
           {ON} similar to gnl|GLV|KLLA0F00374g Kluyveromyces
           lactis KLLA0F00374g and weakly similar to YOR371C
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 840

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 35/90 (38%), Gaps = 16/90 (17%)

Query: 219 GSGQTSYLNDLWCFDISNYKWTKLETNTKPDARS----------GHCFVPTDNSAILMGG 268
           GS +     D+W FD+    WT ++T  + +             GH  +    +A+ +GG
Sbjct: 668 GSDKDHVYGDMWWFDLDTETWTHVDTYCQEEKDGGFIPIEFTLVGHTLIQLGKNAVCIGG 727

Query: 269 YCKTI------AKNNKNLMKGKILNDSWKL 292
             +         KN KN  KG   N   KL
Sbjct: 728 LSQEDVNDFLGVKNKKNESKGAFNNSGSKL 757

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,054,888
Number of extensions: 2973812
Number of successful extensions: 8532
Number of sequences better than 10.0: 82
Number of HSP's gapped: 8313
Number of HSP's successfully gapped: 180
Length of query: 654
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 538
Effective length of database: 40,180,143
Effective search space: 21616916934
Effective search space used: 21616916934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)