Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.41na 1ON35335318460.0
Smik_6.472na 1ON35335317540.0
YPL264Cna 1ON35335317470.0
Skud_16.13na 1ON35335316530.0
YMR253C8.804ON41435111781e-161
Skud_13.4258.804ON42434711681e-159
Smik_13.4678.804ON41935111671e-159
Suva_13.4388.804ON41833611631e-158
Kpol_2002.22na 2ON40334510681e-144
NDAI0K006608.804ON48735210621e-142
TDEL0B009308.804ON37035110491e-142
CAGL0H02519g8.804ON38435110361e-140
KNAG0J005008.804ON39133610341e-139
NCAS0C006308.804ON46034010221e-136
KLTH0C04752g8.804ON37235610001e-134
ZYRO0G13288g8.804ON3733399981e-134
KNAG0J00490singletonON4393509991e-133
Kwal_27.104338.804ON3823539761e-131
Kpol_543.758.804ON3943369711e-130
SAKL0D02442g8.804ON3803519541e-127
TBLA0B026908.804ON4553329601e-127
TPHA0E03870na 2ON4323289581e-127
KAFR0B038308.804ON3893209121e-121
TPHA0G010508.804ON3143008051e-106
CAGL0M04499g8.348ON46993830.085
TPHA0D025005.551ON45097820.11
KNAG0B035605.551ON40565820.11
TDEL0A041405.551ON382155810.12
TBLA0D014805.551ON44066800.18
ZYRO0D13090g5.551ON37063780.31
NDAI0C009405.551ON447106780.32
KLLA0B01177g5.551ON41493780.35
NCAS0F012005.551ON36773770.39
Smik_13.1335.551ON393128770.46
TDEL0F047208.348ON47984750.75
AER331C5.551ON44493750.78
Suva_13.1415.551ON40053740.97
SAKL0G05456g5.551ON39453741.1
YML018C5.551ON39353731.2
Skud_13.1335.551ON393123722.0
CAGL0G07018g5.551ON39153702.9
KAFR0C055105.551ON40392693.7
NCAS0C031608.348ON56493703.8
Ecym_42248.348ON46676685.0
NDAI0C03800singletonON67582686.6
KLTH0G04312g5.551ON40853676.6
KAFR0I008605.551ON35467676.9
YLR142W (PUT1)8.348ON47677677.6
NCAS0H026805.551ON42365678.0
Kpol_1004.395.551ON39156678.0
KLLA0D16962g8.348ON46777678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.41
         (353 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.41 Chr16 complement(58881..59942) [1062 bp, 353 aa] {ON}...   715   0.0  
Smik_6.472 Chr6 (776811..777872) [1062 bp, 353 aa] {ON} YPL264C ...   680   0.0  
YPL264C Chr16 complement(43283..44344) [1062 bp, 353 aa] {ON} Pu...   677   0.0  
Skud_16.13 Chr16 complement(22375..23436) [1062 bp, 353 aa] {ON}...   641   0.0  
YMR253C Chr13 complement(775946..777190) [1245 bp, 414 aa] {ON} ...   458   e-161
Skud_13.425 Chr13 complement(749944..751218) [1275 bp, 424 aa] {...   454   e-159
Smik_13.467 Chr13 complement(759048..760307) [1260 bp, 419 aa] {...   454   e-159
Suva_13.438 Chr13 complement(755253..756509) [1257 bp, 418 aa] {...   452   e-158
Kpol_2002.22 s2002 complement(44306..45517) [1212 bp, 403 aa] {O...   416   e-144
NDAI0K00660 Chr11 (143969..145432) [1464 bp, 487 aa] {ON} Anc_8....   413   e-142
TDEL0B00930 Chr2 (174436..175548) [1113 bp, 370 aa] {ON} Anc_8.8...   408   e-142
CAGL0H02519g Chr8 (229511..230665) [1155 bp, 384 aa] {ON} simila...   403   e-140
KNAG0J00500 Chr10 (79669..80844) [1176 bp, 391 aa] {ON} Anc_8.80...   402   e-139
NCAS0C00630 Chr3 (100913..102295) [1383 bp, 460 aa] {ON} Anc_8.804    398   e-136
KLTH0C04752g Chr3 (410449..411567) [1119 bp, 372 aa] {ON} simila...   389   e-134
ZYRO0G13288g Chr7 complement(1062258..1063379) [1122 bp, 373 aa]...   389   e-134
KNAG0J00490 Chr10 (78039..79358) [1320 bp, 439 aa] {ON}               389   e-133
Kwal_27.10433 s27 (342780..343928) [1149 bp, 382 aa] {ON} YMR253...   380   e-131
Kpol_543.75 s543 complement(184341..185525) [1185 bp, 394 aa] {O...   378   e-130
SAKL0D02442g Chr4 (193585..194727) [1143 bp, 380 aa] {ON} simila...   372   e-127
TBLA0B02690 Chr2 (618919..620286) [1368 bp, 455 aa] {ON} Anc_8.8...   374   e-127
TPHA0E03870 Chr5 (815023..816321) [1299 bp, 432 aa] {ON}              373   e-127
KAFR0B03830 Chr2 (792859..794028) [1170 bp, 389 aa] {ON} Anc_8.8...   355   e-121
TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.80...   314   e-106
CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highl...    37   0.085
TPHA0D02500 Chr4 (515403..516755) [1353 bp, 450 aa] {ON} Anc_5.5...    36   0.11 
KNAG0B03560 Chr2 complement(687312..688529) [1218 bp, 405 aa] {O...    36   0.11 
TDEL0A04140 Chr1 (737337..738485) [1149 bp, 382 aa] {ON} Anc_5.5...    36   0.12 
TBLA0D01480 Chr4 complement(363558..364880) [1323 bp, 440 aa] {O...    35   0.18 
ZYRO0D13090g Chr4 (1102902..1104014) [1113 bp, 370 aa] {ON} simi...    35   0.31 
NDAI0C00940 Chr3 complement(180857..182200) [1344 bp, 447 aa] {O...    35   0.32 
KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar ...    35   0.35 
NCAS0F01200 Chr6 (234603..235706) [1104 bp, 367 aa] {ON} Anc_5.5...    34   0.39 
Smik_13.133 Chr13 complement(223651..224832) [1182 bp, 393 aa] {...    34   0.46 
TDEL0F04720 Chr6 (887597..889036) [1440 bp, 479 aa] {ON} Anc_8.3...    33   0.75 
AER331C Chr5 complement(1245399..1246733) [1335 bp, 444 aa] {ON}...    33   0.78 
Suva_13.141 Chr13 complement(225107..226309) [1203 bp, 400 aa] {...    33   0.97 
SAKL0G05456g Chr7 (448553..449737) [1185 bp, 394 aa] {ON} simila...    33   1.1  
YML018C Chr13 complement(234771..235952) [1182 bp, 393 aa] {ON} ...    33   1.2  
Skud_13.133 Chr13 complement(221096..222277) [1182 bp, 393 aa] {...    32   2.0  
CAGL0G07018g Chr7 (668453..669628) [1176 bp, 391 aa] {ON} simila...    32   2.9  
KAFR0C05510 Chr3 (1102100..1103311) [1212 bp, 403 aa] {ON} Anc_5...    31   3.7  
NCAS0C03160 Chr3 complement(620413..622107) [1695 bp, 564 aa] {O...    32   3.8  
Ecym_4224 Chr4 complement(468353..469753) [1401 bp, 466 aa] {ON}...    31   5.0  
NDAI0C03800 Chr3 (866392..868419) [2028 bp, 675 aa] {ON}               31   6.6  
KLTH0G04312g Chr7 (343552..344778) [1227 bp, 408 aa] {ON} simila...    30   6.6  
KAFR0I00860 Chr9 (167141..168205) [1065 bp, 354 aa] {ON} Anc_5.5...    30   6.9  
YLR142W Chr12 (425186..426616) [1431 bp, 476 aa] {ON}  PUT1Proli...    30   7.6  
NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551     30   8.0  
Kpol_1004.39 s1004 (83150..84325) [1176 bp, 391 aa] {ON} (83150....    30   8.0  
KLLA0D16962g Chr4 (1437692..1439095) [1404 bp, 467 aa] {ON} simi...    30   8.4  

>Suva_16.41 Chr16 complement(58881..59942) [1062 bp, 353 aa] {ON}
           YPL264C (REAL)
          Length = 353

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/353 (100%), Positives = 353/353 (100%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS 60
           MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI
Sbjct: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED 353
           LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED
Sbjct: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED 353

>Smik_6.472 Chr6 (776811..777872) [1062 bp, 353 aa] {ON} YPL264C
           (REAL)
          Length = 353

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/353 (94%), Positives = 343/353 (97%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS 60
           MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILEN+PL+ SQ RINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTLVYMHWNK+SVPDIPWGP   RKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TFMSPTLTIFLSFLLLGEPFSKLEALGS+ISFSGVVLIIRPTFLFGQ  + QE S+D+IV
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ETQNP LRL+AIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI
Sbjct: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED 353
           LFHHWPNIWTWCGMAVIV+STIWVINMRASKQNVVATS+LLSTSDFELDELED
Sbjct: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED 353

>YPL264C Chr16 complement(43283..44344) [1062 bp, 353 aa] {ON}
           Putative membrane protein of unknown function;
           physically interacts with Hsp82p; YPL264C is not an
           essential gene
          Length = 353

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/353 (93%), Positives = 345/353 (97%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS 60
           MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTK+LEN+PLE SQSRINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKVLENDPLETSQSRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTLVYMHWNK+SVPDIPWGP P RKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKQSVPDIPWGPAPCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFG+  + Q++ +D+IV
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGEQTQGQQSPQDDIV 180

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ETQNP LRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGV+LI
Sbjct: 181 ETQNPKLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVLLI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM+LQLPHSWKQWGLFLNLG+SGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMSLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED 353
           LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVAT++LLSTSDFELD+LED
Sbjct: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATAELLSTSDFELDDLED 353

>Skud_16.13 Chr16 complement(22375..23436) [1062 bp, 353 aa] {ON}
           YPL264C (REAL)
          Length = 353

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/353 (89%), Positives = 340/353 (96%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS 60
           M LQRISKDYLKPNYGL+LLIVSYFFNSSMVVSTK+LE++PLE SQSRINPLQILLVRMS
Sbjct: 1   MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTL YM WNK+++PDIPWG    RKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TFMSPTLTIFLSFLLLGEPFSK EALGSLISFSGVVLIIRPTFLFGQ ++ QE+S+++ V
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGQQSQDQESSQNDSV 180

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ET+NP LRLIAIGVSLLGVCGLSSVYIIIR+IGNKAHAIMSVSYFSLVTTVVAALGV+LI
Sbjct: 181 ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           P++TLQLPHSWKQWGLFLNLG+SGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED 353
           LFHHWPN+WTWCGMAVIVSSTIWVINMRASKQN+VAT++LLSTSDFELDELED
Sbjct: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED 353

>YMR253C Chr13 complement(775946..777190) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern; YMR253C is not an essential gene
          Length = 414

 Score =  458 bits (1178), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 230/351 (65%), Positives = 281/351 (80%), Gaps = 4/351 (1%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLE-ASQSRINPLQILLVRMS 60
           TLQRISKDYLKPN GL+LL VSYFFNS+MVVSTK+LEN+P + A+  +I PLQILLVRM 
Sbjct: 56  TLQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPDDIANDRQIKPLQILLVRMV 115

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ NK ++ D+P+G    RKWL+LRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 116 ITYIGTLIYMYINKSTISDVPFGKPEVRKWLVLRGCTGFFGVFGMYYSLMYLTISDAVLI 175

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TF++P+LTIFLS+++L E F+K+EALGSLIS  GVVLI+RP+FLFG    T  +S+  IV
Sbjct: 176 TFLAPSLTIFLSWVILRERFTKVEALGSLISLLGVVLIVRPSFLFGTPELTDSSSQ--IV 233

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +P  RLIA  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 234 ESSDPKSRLIATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTI 293

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLGVSGFI Q+LLTMGIQRERAGRGSLMTYTQ++YAVFWDV 
Sbjct: 294 PSMKFQIPHSKKQWILFGNLGVSGFIFQLLLTMGIQRERAGRGSLMTYTQLLYAVFWDVA 353

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDEL 351
           L+ HWPNIW+W GM +I+S+T+WVI +RA+     A  DL    D E + +
Sbjct: 354 LYKHWPNIWSWIGMIIIISATLWVIRIRAANNETTA-KDLTPIIDDEENSI 403

>Skud_13.425 Chr13 complement(749944..751218) [1275 bp, 424 aa] {ON}
           YMR253C (REAL)
          Length = 424

 Score =  454 bits (1168), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 225/347 (64%), Positives = 275/347 (79%), Gaps = 4/347 (1%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLE-ASQSRINPLQILLVRMS 60
           TLQRISKDYLKPN GL+LL VSYFFNS+MVVSTK+LEN+P + A+  +I PLQILLVRM 
Sbjct: 67  TLQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPEDIANDRQIKPLQILLVRMV 126

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ NK ++P++P+G    RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 127 ITYIGTLIYMYINKSTIPNVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLI 186

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TF+SP+LTIFLS+++L E F+K+EALGSLIS  GVVLI+RP+FLFG     + T    IV
Sbjct: 187 TFLSPSLTIFLSWVILRERFTKVEALGSLISLMGVVLIVRPSFLFGT---PEMTDSSRIV 243

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +P  RL+A  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 244 ESSDPKSRLVATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTI 303

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLGVSGFI Q+LLT+GIQRERAGRGSLM YTQ++YAVFWDV 
Sbjct: 304 PSMKFQIPHSRKQWILFGNLGVSGFIFQLLLTLGIQRERAGRGSLMAYTQLLYAVFWDVT 363

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFE 347
           L+ HWPN+W+W GM VI+S+T+WVI +RA+    +         D E
Sbjct: 364 LYKHWPNVWSWVGMIVIISATLWVIRIRAANSEAMNKDPAPVIDDEE 410

>Smik_13.467 Chr13 complement(759048..760307) [1260 bp, 419 aa] {ON}
           YMR253C (REAL)
          Length = 419

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 226/351 (64%), Positives = 282/351 (80%), Gaps = 4/351 (1%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLE-ASQSRINPLQILLVRMS 60
           TL RISKDYLKPN GL+LL VSYFFNS+MVVSTK+LEN+P + A++ +I PLQILLVRM 
Sbjct: 61  TLHRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPDDIANERQIKPLQILLVRMV 120

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ NK ++ D+P+G    RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 121 ITYVGTLIYMYINKNTISDVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLI 180

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TF++P+LTIFLS+++L E F+K+EALGSLIS  GVVLI+RP+F+FG    T  +S+  I+
Sbjct: 181 TFLAPSLTIFLSWIILRERFTKVEALGSLISLMGVVLIVRPSFIFGTPESTDSSSQ--II 238

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +P  RLIA  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 239 ESSDPKSRLIATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTI 298

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLGVSGFI Q+LLT+GIQRERAGRGSLMTYTQ++YAVFWDV 
Sbjct: 299 PSMKFQIPHSKKQWILFGNLGVSGFIFQLLLTLGIQRERAGRGSLMTYTQLLYAVFWDVS 358

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDEL 351
           L+ HWP+IW+W GM +I+S+T+WVI +RA+    +A  DL    D E + +
Sbjct: 359 LYKHWPSIWSWIGMIIIISATLWVIRIRAANSETIA-KDLTPIIDDEENSI 408

>Suva_13.438 Chr13 complement(755253..756509) [1257 bp, 418 aa] {ON}
           YMR253C (REAL)
          Length = 418

 Score =  452 bits (1163), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 222/336 (66%), Positives = 276/336 (82%), Gaps = 3/336 (0%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLE-ASQSRINPLQILLVRMS 60
           TLQRISKDYLKPN GL+LL VSYFFNS+MVVSTK+LEN+P + A+ ++I PLQILLVRM 
Sbjct: 60  TLQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPEDIANDTQIKPLQILLVRMV 119

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ N+ ++ D+P+G    RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 120 ITYIGTLIYMYINRSTISDVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLI 179

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TF+SP+LTIFLS+L+L E F+K+EALGSL+S  GVVLI+RP+FLFG    T  +S+  IV
Sbjct: 180 TFLSPSLTIFLSWLILRERFTKVEALGSLVSLMGVVLIVRPSFLFGVPEMTDSSSQ--IV 237

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +P  RLIA  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 238 ESSDPRSRLIATLVGLWGVFGMSCVYIIIRYIGKRAHAIMSVSYFSLITALVSFVGINTI 297

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLG+SGFI Q+LLT+GIQRERAGRGSLM YTQ+IYAVFWDV 
Sbjct: 298 PSMKFQIPHSKKQWILFGNLGISGFIFQLLLTLGIQRERAGRGSLMAYTQLIYAVFWDVA 357

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVA 336
           L+ HWPN+W+W GM +I+++T+WVI +R++    +A
Sbjct: 358 LYKHWPNMWSWFGMIIIITATLWVIRIRSANNEAIA 393

>Kpol_2002.22 s2002 complement(44306..45517) [1212 bp, 403 aa] {ON}
           complement(44306..45517) [1212 nt, 404 aa]
          Length = 403

 Score =  416 bits (1068), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 263/345 (76%), Gaps = 5/345 (1%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSIT 62
           L+R + ++L PN GL+LL  +Y FNS MVVSTK++E +P +  + RI PLQIL+VRM IT
Sbjct: 48  LKRFADEHLMPNLGLVLLSGAYLFNSIMVVSTKVMETDPDKLKEDRIKPLQILVVRMVIT 107

Query: 63  YCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL+YM+W +  +  +P+GP   RKWL+LRG +GFFGVFGMYFSLMYL+ISDAVLITF
Sbjct: 108 YIGTLIYMYWKRDVIEHVPFGPPELRKWLLLRGCVGFFGVFGMYFSLMYLTISDAVLITF 167

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVET 182
           +SP+LTI L++L+L E  ++ E +GS+IS  GVVLI+RP FLFG   +   +  ++ VET
Sbjct: 168 LSPSLTIILAWLILREKITRFEVMGSIISLFGVVLIVRPCFLFGA--RVNLSQINDHVET 225

Query: 183 QNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
            NP  RL+A  V+LLGV G S VYIIIR+IGN+AHAIMSVSYFSLVTTVV+ +G++ IPS
Sbjct: 226 SNPQERLVATLVALLGVIGASCVYIIIRFIGNRAHAIMSVSYFSLVTTVVSLVGILTIPS 285

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           +  Q+P S K+W LF NLG+ GFI Q+LLTMGIQRERAGRGSLM Y Q+IYA+FWDV ++
Sbjct: 286 IRFQIPSSLKEWLLFGNLGICGFIFQLLLTMGIQRERAGRGSLMQYVQLIYAIFWDVSIW 345

Query: 303 HHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFE 347
             WP+ W+WCGM +IV STIWV+N+   K ++ A  D L   D E
Sbjct: 346 KRWPSFWSWCGMVLIVGSTIWVVNI---KNSLAAQKDTLHMQDLE 387

>NDAI0K00660 Chr11 (143969..145432) [1464 bp, 487 aa] {ON} Anc_8.804
          Length = 487

 Score =  413 bits (1062), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 270/352 (76%), Gaps = 4/352 (1%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLE-ASQSRINPLQILLVRMS 60
           T+QRI+KDYLKPN GL+LL ++  FNS MV STK+LE +P + A   +I PLQILLVRM 
Sbjct: 92  TIQRINKDYLKPNVGLLLLTLAQLFNSLMVTSTKVLETDPYDIAHDQQIKPLQILLVRMV 151

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM  N+ ++  +P+G    RKWLILRG +GFFGVFGMYFSLMYLSISDAVLI
Sbjct: 152 ITYLGTLIYMFINRHTIQFVPFGDPKIRKWLILRGCVGFFGVFGMYFSLMYLSISDAVLI 211

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TF++P++TI +S+++L E F+K EA+G ++S  GVVLI+RPTF+FG  +      +  +V
Sbjct: 212 TFLAPSVTIIMSWVILRERFTKTEAIGCIVSLFGVVLIVRPTFIFGVPDDDDGKIDPEMV 271

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E++NP  RLIA  V LLGV G+S VY++IR+IG +AHAIMSVSYFSL+TT+++ LG++ +
Sbjct: 272 ESKNPEERLIATFVGLLGVVGMSMVYVVIRFIGKRAHAIMSVSYFSLITTIISFLGIVFL 331

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM   +PHS KQW LF NLG  GFI Q+LLT+GIQ+ERAGRGSL++YTQ+IYA+FWDV 
Sbjct: 332 PSMKFHVPHSLKQWLLFANLGFCGFIFQLLLTLGIQKERAGRGSLISYTQLIYAIFWDVT 391

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQ---NVVATSDLLSTSDFELD 349
           L+ HWPNIW+WCGM +I+ +T+ ++ ++  +    NV+ T  + S S  + D
Sbjct: 392 LYRHWPNIWSWCGMLIIIGTTLLIVKLKPKQDENGNVIETKSMTSLSSSKTD 443

>TDEL0B00930 Chr2 (174436..175548) [1113 bp, 370 aa] {ON} Anc_8.804
           YMR253C
          Length = 370

 Score =  408 bits (1049), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 206/351 (58%), Positives = 273/351 (77%), Gaps = 12/351 (3%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSR--INPLQILLVRMS 60
           ++RIS++YLKPN GL+LL+VSYFFNS MVV+TK+LE +  E  + R  I PLQILLVRMS
Sbjct: 30  VRRISREYLKPNIGLVLLVVSYFFNSGMVVATKVLETDH-EGVEDREPIKPLQILLVRMS 88

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM  N++++ ++P+GP   RKWLILRG+MGF GVFG+Y SL+YLSISDA+LI
Sbjct: 89  ITYVGTLLYMLKNRKTIENVPFGPPEVRKWLILRGLMGFLGVFGLYSSLVYLSISDAILI 148

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TF++PT+T+ L++++L E F+ +EA+GSL+SF GV+LI+RP+FLFG    T  TS D   
Sbjct: 149 TFLTPTVTVILAWIVLRERFTVIEAVGSLLSFGGVILIVRPSFLFG----TATTSTDA-A 203

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E++N   RLIA  +SL+GV G SSVYIIIR+IG +AHAI+SVSYFSL+ T+++  GV L+
Sbjct: 204 ESENTRDRLIATIMSLVGVFGASSVYIIIRHIGQRAHAILSVSYFSLIVTIISIAGVALV 263

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM +Q+P + KQW LF NLG+ GFI Q LLTMGIQRERAGRGS+M YTQ+IYAVFWDV 
Sbjct: 264 PSMHIQMPSNTKQWLLFANLGICGFIFQYLLTMGIQRERAGRGSVMAYTQLIYAVFWDVA 323

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDEL 351
           L+H+WP +W+W GM +IV ST+ VI  +  +    + S      ++ELDE+
Sbjct: 324 LWHNWPKLWSWLGMLIIVGSTLAVIKFKPKE----SASPPDEEENYELDEI 370

>CAGL0H02519g Chr8 (229511..230665) [1155 bp, 384 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253c and
           similar to uniprot|Q08980 Saccharomyces cerevisiae
           YPL264c
          Length = 384

 Score =  403 bits (1036), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/351 (57%), Positives = 268/351 (76%), Gaps = 6/351 (1%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILE--NEPLEASQSRINPLQILLVRMS 60
           + R++++YLKPN GLI LIVS  FNS MVVSTK+LE   E LE  +  I PLQILLVRM 
Sbjct: 34  VARLNQEYLKPNVGLIFLIVSQLFNSLMVVSTKVLELDREGLEPDEPSIQPLQILLVRMI 93

Query: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM  N  S+  +P+G    R WLI+RG MGFFGVFGMYFSLMYL+ISDAVLI
Sbjct: 94  ITYIGTLIYMKINSSSIEYVPFGNPAVRPWLIMRGAMGFFGVFGMYFSLMYLTISDAVLI 153

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180
           TF++P++TI L++++L E FSK E +GS +S +GVVLI+RPTFLFG  N T  TS+ +I 
Sbjct: 154 TFLAPSVTIILAWIILRESFSKAEGIGSFVSLAGVVLIVRPTFLFG--NPT--TSDGDID 209

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ET +P  RLIA  V+L GV G+SSV+IIIRYIG +AHAI++VSYFSL+T ++A  G++ +
Sbjct: 210 ETTDPHKRLIATLVALWGVVGISSVWIIIRYIGKRAHAIINVSYFSLITGLIALFGILFV 269

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PS+  Q P + KQW LF NLG+ GF HQ+LLT+GIQ+ERAGRG+LM+YT +IYAVFWDV+
Sbjct: 270 PSVHFQTPRTLKQWLLFANLGICGFCHQLLLTIGIQKERAGRGTLMSYTNLIYAVFWDVL 329

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDEL 351
           LF HWP+ W+ CGM +I  ST++++ M+A+     A ++    ++F+L++L
Sbjct: 330 LFGHWPSFWSICGMILITGSTLYIVKMKANDAKPQAVNNNSIQTEFDLEDL 380

>KNAG0J00500 Chr10 (79669..80844) [1176 bp, 391 aa] {ON} Anc_8.804
           YMR253C
          Length = 391

 Score =  402 bits (1034), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 256/336 (76%), Gaps = 4/336 (1%)

Query: 7   SKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYCCT 66
            + Y+ PN GLILL+VSYFF+SSMVVSTK+LE +P   S+++I PLQIL VRMSITY   
Sbjct: 53  KEKYIDPNVGLILLVVSYFFSSSMVVSTKVLETDP--GSETKIQPLQILAVRMSITYLGC 110

Query: 67  LVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPT 126
           L+YM+ N+ ++PD+P+G    RKWLILRG MGFF VFG YFSLMYLSISD+ LI F+ P+
Sbjct: 111 LLYMYINRNTIPDVPFGERSVRKWLILRGCMGFFSVFGTYFSLMYLSISDSTLIMFLEPS 170

Query: 127 LTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVETQNPT 186
           L I +++L L E   ++E +G ++S  GVVLI+RP FLFG    T +   D  VE++NP 
Sbjct: 171 LIIVMAWLFLNERIQRMEIVGCVVSLIGVVLIVRPPFLFGP--ATFDPDSDQSVESRNPR 228

Query: 187 LRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMTLQ 246
            RL+A  V++ G  G+ SVYIIIR+IG++AHAIM+VSYFSLVT VV+ +G+++IPSM  Q
Sbjct: 229 ERLLATLVAVWGTVGMGSVYIIIRHIGDRAHAIMNVSYFSLVTFVVSIVGILVIPSMRFQ 288

Query: 247 LPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHHWP 306
           +PH+WK+W LF NLGVSGF HQ LLT+GIQRERAGRGSL+TYT ++YA+FWD+ L+HH+P
Sbjct: 289 IPHTWKEWILFANLGVSGFYHQFLLTLGIQRERAGRGSLITYTLLVYALFWDIFLYHHFP 348

Query: 307 NIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLS 342
            +W+WCGM +IV ST++V+ M+        T + L 
Sbjct: 349 PLWSWCGMFLIVGSTVYVVKMKMDDAEQDGTGEALE 384

>NCAS0C00630 Chr3 (100913..102295) [1383 bp, 460 aa] {ON} Anc_8.804
          Length = 460

 Score =  398 bits (1022), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 200/340 (58%), Positives = 261/340 (76%), Gaps = 10/340 (2%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLE-ASQSRINPLQILLVRMSI 61
           LQRI+K+YLKPN GLILLI +  FNS MV STK+LE +P + A  + I P QILLVRM+I
Sbjct: 66  LQRINKEYLKPNIGLILLIFAQLFNSLMVTSTKVLETDPEDKALGTSIKPFQILLVRMAI 125

Query: 62  TYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL+YM+ N+ ++  +P+G    RKWLILRG +GF+GVFGMYFSLMYLSISDAVLIT
Sbjct: 126 TYLGTLIYMYLNRSTIDYVPFGDPKVRKWLILRGCVGFWGVFGMYFSLMYLSISDAVLIT 185

Query: 122 FMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNI-- 179
           F++PT+TI L++++L E F+K+EA G+L+S  GVVLI+RPTFLFG    T    E ++  
Sbjct: 186 FLAPTVTIILAWIILRERFTKVEAAGALVSLLGVVLIVRPTFLFGSDMTTPSDVELDVDL 245

Query: 180 ------VETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVA 233
                  E+ NP  RL+A  V L GV G+SSVYIIIR+IG +AHAIMSVSYFSL+T +++
Sbjct: 246 NPMRDQAESSNPADRLMASIVGLCGVLGMSSVYIIIRFIGKRAHAIMSVSYFSLITLIIS 305

Query: 234 ALGVILIPSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIY 293
            + +I++PSM LQ PHS KQW LF NLG  GF  Q+LLT+GIQ+ERAGRGSLM+YTQ++Y
Sbjct: 306 TVCIIVMPSMRLQFPHSLKQWLLFANLGFCGFFFQLLLTLGIQKERAGRGSLMSYTQLVY 365

Query: 294 AVFWDVVLFHHWPNIWTWCGMAVIVSSTIWVINMRASKQN 333
           A+FWDV L+ +WP+IW+W GM +I+ ST+ V+ ++  KQN
Sbjct: 366 AIFWDVTLYKNWPSIWSWLGMIIIIGSTLVVMRLKP-KQN 404

>KLTH0C04752g Chr3 (410449..411567) [1119 bp, 372 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 372

 Score =  389 bits (1000), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 190/356 (53%), Positives = 259/356 (72%), Gaps = 10/356 (2%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSIT 62
           LQR+S +YLKPN GL+ L++S  FNS MVVSTK+LE +P    +  I PLQIL+VRM IT
Sbjct: 19  LQRLSSEYLKPNIGLLYLLISNLFNSVMVVSTKLLETDP--ELEEPITPLQILVVRMFIT 76

Query: 63  YCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL+YM +N+  +  +PWGP   RKWLILRG  GFFGVFGMY+SLMYLS+ DA +ITF
Sbjct: 77  YIGTLIYMLYNRDRIDHVPWGPPDMRKWLILRGCTGFFGVFGMYYSLMYLSVPDATIITF 136

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVET 182
           + P+ T  L++ +L E +SK+EA G+L+S  GV+LI+RP+FLFG    +         E+
Sbjct: 137 LGPSFTGLLAWAILRERYSKVEATGALVSLMGVILIVRPSFLFG---SSATDDSGGTAES 193

Query: 183 QNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
           ++P  RL+A  V+L+GV G S+VYIIIRYIG +AHAIMSVSYF+L+   V+ +G+ +IPS
Sbjct: 194 RDPHARLVATIVALVGVIGASNVYIIIRYIGQRAHAIMSVSYFALIACCVSLVGICVIPS 253

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           M  Q+P + KQW LF  +G SGF  Q+LLTMGIQRERAGRG++M+Y+Q+IYA+FWDV ++
Sbjct: 254 MGFQIPQTSKQWFLFTLIGFSGFFMQLLLTMGIQRERAGRGAIMSYSQIIYAIFWDVFIW 313

Query: 303 HHWPNIWTWCGMAVIVSSTIWVINMRASKQNVV-ATSD----LLSTSDFELDELED 353
           HH P +W+WCG+ VI+ S IWV+  +   + +  AT+D    ++   DFE+ + ED
Sbjct: 314 HHLPGLWSWCGIIVILGSAIWVVKCKPKSEFIATATTDQESQVIQMEDFEIHDDED 369

>ZYRO0G13288g Chr7 complement(1062258..1063379) [1122 bp, 373 aa]
           {ON} similar to uniprot|Q04835 Saccharomyces cerevisiae
           YMR253C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 373

 Score =  389 bits (998), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 256/339 (75%), Gaps = 17/339 (5%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILE---------NEPLEASQSRINPL 52
           +LQR S+DYLKPN GL+ LI +  FNS MVVSTK+LE          +PL+     I PL
Sbjct: 27  SLQRFSQDYLKPNLGLVYLIAAQLFNSLMVVSTKVLETDKTIDPNTGDPLKP----IKPL 82

Query: 53  QILLVRMSITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYL 112
           QILL RMSITY   L+YM  N+RS+PD P+G    R WL LRG +GFFGVFG+YFSLMYL
Sbjct: 83  QILLSRMSITYAGALLYMLINRRSIPDAPFGAPGLRIWLFLRGAVGFFGVFGLYFSLMYL 142

Query: 113 SISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQ 172
           ++SDAVLITF++PT+T+ L+ L+L E F++ EA+G+L+S  GVVLI+RP+FLFGQ     
Sbjct: 143 TVSDAVLITFLTPTVTVVLAALILKERFTRAEAVGTLVSLLGVVLIVRPSFLFGQ----P 198

Query: 173 ETSEDNIVETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVV 232
           +  +++  E+ +P  RL+A  V LLGV G S+VYI++RYIG++AHAI+SV+YFSL  T+V
Sbjct: 199 DDPDNSPAESADPAKRLLATLVGLLGVLGASTVYIVLRYIGDRAHAIISVAYFSLTVTIV 258

Query: 233 AALGVILIPSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVI 292
           +++G+++IPSM    PH  +QW L +NLGV GFI Q+LLTMGIQRERAGRGS M+YTQ++
Sbjct: 259 SSIGILVIPSMQFSWPHGSRQWFLLINLGVCGFIFQLLLTMGIQRERAGRGSAMSYTQLV 318

Query: 293 YAVFWDVVLFHHWPNIWTWCGMAVIVSSTIWVINMRASK 331
           YAV WDV+L+HHWP++W+W GM VIV +T+ V   ++ +
Sbjct: 319 YAVIWDVMLWHHWPSMWSWLGMLVIVGATVAVARYKSKE 357

>KNAG0J00490 Chr10 (78039..79358) [1320 bp, 439 aa] {ON} 
          Length = 439

 Score =  389 bits (999), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 263/350 (75%), Gaps = 4/350 (1%)

Query: 4   QRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITY 63
           Q+  + Y+  N GLILL+V+ FFN+ M+VSTK+LE  P+     +I PLQIL+VRM+ITY
Sbjct: 78  QQFKEKYVDTNVGLILLVVAQFFNTLMIVSTKLLETNPVAGQ--KIKPLQILVVRMAITY 135

Query: 64  CCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFM 123
              LVYM+ N+ +V  +P+G    RKWLILRG  GFFGVFG YFSLMYLSISD+VLI+F+
Sbjct: 136 IGCLVYMYVNRATVKYVPFGDPKVRKWLILRGCTGFFGVFGSYFSLMYLSISDSVLISFL 195

Query: 124 SPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVETQ 183
           SP++TI L++ +L E   + E  G  +S  GVVLIIRP FLFG ++    +++ + VE+ 
Sbjct: 196 SPSITILLAWAVLRERIHRYEVAGCFVSLLGVVLIIRPPFLFG-VDALDSSADPSPVESH 254

Query: 184 NPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSM 243
           +P  RLIA  V+LLG  G+S VYIIIR+IG++AHAIMSVSYFSL+T +V+ +GV+ IPSM
Sbjct: 255 HPRDRLIATLVALLGCFGMSCVYIIIRFIGDRAHAIMSVSYFSLITLIVSIIGVLTIPSM 314

Query: 244 TLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFH 303
             Q+PHS K+W LF NLG+SGF  Q++LTMGIQRERAGRGSL+TYTQ++YA+FWDV L+H
Sbjct: 315 KFQMPHSSKEWLLFANLGISGFCFQLMLTMGIQRERAGRGSLITYTQLVYAIFWDVWLYH 374

Query: 304 HWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLST-SDFELDELE 352
           H P+IW+ CGM +I+ ST++V+ ++ S   V   +D  ST S+ + DELE
Sbjct: 375 HPPSIWSVCGMFIIIGSTLYVVRLKNSGPTVSDDADTPSTVSEQDGDELE 424

>Kwal_27.10433 s27 (342780..343928) [1149 bp, 382 aa] {ON} YMR253C -
           1:1 [contig 36] FULL
          Length = 382

 Score =  380 bits (976), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 183/353 (51%), Positives = 258/353 (73%), Gaps = 10/353 (2%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSIT 62
           LQR+S DYLKPN GL+ L++S  FNS M+VSTK+LE +P    ++ I PLQIL+VRM IT
Sbjct: 26  LQRLSDDYLKPNIGLMYLLISNLFNSLMIVSTKLLETDP--ELETPITPLQILVVRMFIT 83

Query: 63  YCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL+YM+W + S+ ++PWGP   RKWLILRG  GFFGVFG+Y+SLMYLS+ DA +ITF
Sbjct: 84  YLGTLIYMYWKRNSIGNVPWGPPEMRKWLILRGCTGFFGVFGLYYSLMYLSVPDATVITF 143

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVET 182
           ++P+ T  L++ +L E +SK+EA+G+L S  GV+LI+RP FLFGQ +    T     VE+
Sbjct: 144 LAPSFTGMLAWAVLRERYSKVEAMGALTSLFGVILIVRPAFLFGQSSMDTATGS---VES 200

Query: 183 QNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
            NP  R IA  ++LLGV G+ +VYIIIRYIG +AHA+MSVSYF+L+  +V+ +G+ +IPS
Sbjct: 201 SNPRDRFIATLIALLGVVGVCNVYIIIRYIGQRAHAVMSVSYFALIVCIVSLVGICVIPS 260

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           MT Q+P + +QW LF  +G SGF  Q+LLTMGIQ+ERAGRG+L++Y+Q+I+A+FWD++++
Sbjct: 261 MTFQVPQTTRQWFLFSVIGFSGFFMQLLLTMGIQKERAGRGALVSYSQIIFALFWDMLIW 320

Query: 303 HHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSD-----LLSTSDFELDE 350
           HH P  W+WCG+  I+ S   V+  +   +  V  +D     ++   DFE+ +
Sbjct: 321 HHLPGFWSWCGIITILGSAFCVLKYKPKPEPTVLITDDQESQIIQMQDFEIPD 373

>Kpol_543.75 s543 complement(184341..185525) [1185 bp, 394 aa] {ON}
           complement(184341..185525) [1185 nt, 395 aa]
          Length = 394

 Score =  378 bits (971), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 250/336 (74%), Gaps = 6/336 (1%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSIT 62
             R+   Y +PN G+ LLIVSYFFNS M VSTK+LE    +  + RI PLQILL+RM IT
Sbjct: 43  FNRLKDQYWEPNAGIFLLIVSYFFNSVMQVSTKVLETFGDKPDEDRIKPLQILLIRMVIT 102

Query: 63  YCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
               +VY++ N+R++P +P+G    R+WLILRGI GF GVFGMYFSLMYL+ISDAVLI+F
Sbjct: 103 SIGIIVYVYMNRRTIPYVPFGNPQVRQWLILRGIFGFIGVFGMYFSLMYLTISDAVLISF 162

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVET 182
           M+P+ T+FL++ +LGEPFSKLE +GS++S +GV+ I+RP+F+FG   + +++ + +I   
Sbjct: 163 MAPSFTLFLAWFVLGEPFSKLEGVGSILSLTGVLFIVRPSFIFGGSIENEKSHDLSIATG 222

Query: 183 QNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
           +    R IA  ++L G   LS VYI+IR+IG KAHAIM+VSYFS+VT +V+ LGV+ IPS
Sbjct: 223 RT---RFIATTIALFGAASLSGVYIVIRFIGAKAHAIMNVSYFSVVTGIVSLLGVLFIPS 279

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           M  Q+P    +W LF  +GV GFIHQ+LLTMGIQ+ RAG+GSLM+YTQVIYA+FWDV L+
Sbjct: 280 MKFQVPEGSTEWILFCTIGVCGFIHQLLLTMGIQKVRAGKGSLMSYTQVIYAIFWDVTLW 339

Query: 303 HHWPNIWTWCGMAVIVSSTIWVINMR---ASKQNVV 335
             WPN W+  GM +I+ STIWVI ++    S+Q+ V
Sbjct: 340 GRWPNAWSIFGMFLIIGSTIWVIRLKEQEVSRQSTV 375

>SAKL0D02442g Chr4 (193585..194727) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 380

 Score =  372 bits (954), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/351 (55%), Positives = 264/351 (75%), Gaps = 10/351 (2%)

Query: 5   RISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYC 64
           RIS++YLKPN GL+ L+ S+FFNS MVVSTK+LE +PL   +  I PLQIL+VRM IT+ 
Sbjct: 25  RISEEYLKPNIGLLFLMTSHFFNSIMVVSTKLLETDPL--LEEPIKPLQILVVRMFITFI 82

Query: 65  CTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMS 124
            TL+YM  NK  +P +P+GP   RKWLILRG  GFFGVFG+YFSLMYLS+SDAV+ITF++
Sbjct: 83  GTLIYMQLNKDKIPHVPFGPPEVRKWLILRGFTGFFGVFGLYFSLMYLSVSDAVMITFLA 142

Query: 125 PTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVETQN 184
           P+ T  L++++L E +SK+EALG L+S  GV+LIIRPTF+FG  ++T         E+ +
Sbjct: 143 PSFTGLLAWMILHERYSKIEALGGLVSLFGVILIIRPTFMFGAQSRTSSDE---SFESSD 199

Query: 185 PTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMT 244
           P  RL+A  VSLLGV G+SSVYIIIRYIG++AHAIMSV+YF+ +T +++  G++LIPSM 
Sbjct: 200 PRDRLVATLVSLLGVLGVSSVYIIIRYIGHRAHAIMSVTYFAFITCMISLFGILLIPSMI 259

Query: 245 LQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHH 304
            Q+P + KQW LF  +GVSGF  Q+LLT+GIQRERAGRG+LM Y Q+IYA+FWD++++HH
Sbjct: 260 FQIPKTPKQWFLFFLIGVSGFFMQLLLTLGIQRERAGRGALMAYGQMIYAIFWDILIWHH 319

Query: 305 WPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLST-----SDFELDE 350
            P +W+ CGM +I++ST+ VI  +  ++  V   +   T      DFE+D+
Sbjct: 320 PPGLWSLCGMTIIIASTVTVIKFKPKQEEAVINDEENGTQVYHMEDFEIDD 370

>TBLA0B02690 Chr2 (618919..620286) [1368 bp, 455 aa] {ON} Anc_8.804
           YMR253C
          Length = 455

 Score =  374 bits (960), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/332 (56%), Positives = 246/332 (74%), Gaps = 8/332 (2%)

Query: 6   ISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYCC 65
           ++KDYLK N GLILLI++  FNS M+VSTK+LE  P  + +  I PLQ+LLVRMSITY  
Sbjct: 103 VNKDYLKANTGLILLIIAELFNSIMIVSTKLLETNPSRSEEDTIKPLQVLLVRMSITYLF 162

Query: 66  TLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSP 125
           TL+YM+ NK  VP  P+G    R  LI RG  GF GVFG+YFSLMYL+ISDA+LI F+ P
Sbjct: 163 TLIYMYINK--VPHAPFGEKSIRHLLIFRGCTGFIGVFGLYFSLMYLTISDAILIRFIVP 220

Query: 126 TLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQ-----ETSEDNIV 180
           T+T+FL+F++L E FS  E +GS+ISF GV+LIIRP  +FG+ + T+     +   DN V
Sbjct: 221 TITVFLAFIVLRERFSFKEMVGSIISFCGVILIIRPKSIFGKYSDTESALGSDGENDNPV 280

Query: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
            T +   RL+AI V+L GV G S+VYIIIRYIG +AHA++SV+YFSL+TT+V+ LG++ I
Sbjct: 281 -TSDYNQRLVAIMVALFGVVGASNVYIIIRYIGKRAHAVLSVAYFSLLTTIVSFLGILTI 339

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q P   K+W L  NLG+ GFI+Q+LLTMGIQRERA RGSL++Y Q+++A+ WDV 
Sbjct: 340 PSMRFQAPRDLKEWLLMGNLGLCGFIYQLLLTMGIQRERAARGSLISYLQLLFAIMWDVS 399

Query: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQ 332
           L+  WPN ++W GM VI+SSTIWVI  +  +Q
Sbjct: 400 LWDKWPNFFSWMGMVVIISSTIWVIRAKQERQ 431

>TPHA0E03870 Chr5 (815023..816321) [1299 bp, 432 aa] {ON} 
          Length = 432

 Score =  373 bits (958), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 255/328 (77%), Gaps = 1/328 (0%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSIT 62
           L++ + + LKPN GL++L +++F NS M+VSTK+L   P  +S+ RI PLQILLVRM +T
Sbjct: 68  LRKFTSESLKPNIGLVILALAFFCNSLMIVSTKVLVTNPERSSEERIKPLQILLVRMVLT 127

Query: 63  YCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL+YM+ N+ ++P++P+GP   RKWL+LRG  GFFGVFGMYFSLMYL +SDA++ITF
Sbjct: 128 YIGTLIYMYLNRATIPNVPFGPPEVRKWLLLRGACGFFGVFGMYFSLMYLCLSDALIITF 187

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVET 182
           +SP++TI L++++L E  +K E   SLIS  GVVLIIRP F+FG    + + ++ ++V +
Sbjct: 188 LSPSVTIILAWVVLRENLTKYEVTSSLISLLGVVLIIRPEFIFGSRGMSSDGNDLSVV-S 246

Query: 183 QNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
            +P  RLIA  V L GV G S VYI+IR+IGNKAHAIMSVSYFS+VT V++ +G+I+IPS
Sbjct: 247 SDPHERLIASLVGLAGVFGASIVYIVIRFIGNKAHAIMSVSYFSMVTAVISLIGIIIIPS 306

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           MT Q+P S K+W LF NLGV GF  Q+LLT+GIQ+E+AGRG+LM YTQ+IYA+FWDV+L+
Sbjct: 307 MTFQIPSSLKEWLLFANLGVCGFFFQLLLTLGIQKEKAGRGTLMQYTQIIYAIFWDVLLW 366

Query: 303 HHWPNIWTWCGMAVIVSSTIWVINMRAS 330
             WPNIW+W GM +I+ ST+++  ++ S
Sbjct: 367 DVWPNIWSWGGMVLIIGSTLFMFILKKS 394

>KAFR0B03830 Chr2 (792859..794028) [1170 bp, 389 aa] {ON} Anc_8.804
           YMR253C
          Length = 389

 Score =  355 bits (912), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/320 (53%), Positives = 238/320 (74%), Gaps = 9/320 (2%)

Query: 11  LKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYCCTLVYM 70
           +K N G++ L ++ FFNS+M+VSTK+LE       +S+I PLQ+L+VRM ITY   L+YM
Sbjct: 53  IKSNIGIVFLAIAQFFNSTMIVSTKVLE-----TGESKIKPLQVLVVRMVITYLGCLIYM 107

Query: 71  HWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIF 130
           + ++ ++ +IP+G  P RKWL+LRG+ GFFGVFGMY+SL +LSIS+A+LITF++P+LTI 
Sbjct: 108 YLHRDTIKNIPFGDPPVRKWLLLRGMTGFFGVFGMYYSLQHLSISNAILITFLAPSLTIV 167

Query: 131 LSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIVETQNPTLRLI 190
           L+ + L E  +  E  GSL S  GV+LIIRP FLFGQ     E   +   E+ NP  RL+
Sbjct: 168 LAAMFLHERINLWEIAGSLTSLFGVILIIRPPFLFGQ----TEGGANEKAESSNPEERLV 223

Query: 191 AIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMTLQLPHS 250
              + LLG  G+S VYIIIR IG +AHAIM+V+YFSLVT V++  G+I IPSM+ Q+P +
Sbjct: 224 GSMIGLLGTLGISCVYIIIRRIGKRAHAIMNVAYFSLVTAVISLFGIIFIPSMSFQIPQT 283

Query: 251 WKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHHWPNIWT 310
             +W LF NLG  GF +Q++LT+GIQ+ERAGRGSL+TYTQ+IYA+FWD+VL+H WP+IW+
Sbjct: 284 LTEWLLFSNLGFCGFFYQLILTIGIQKERAGRGSLLTYTQLIYALFWDLVLYHFWPSIWS 343

Query: 311 WCGMAVIVSSTIWVINMRAS 330
           W GM +I+ ST+ V+  ++S
Sbjct: 344 WSGMFLIIGSTLVVLKFKSS 363

>TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.804
           YMR253C
          Length = 314

 Score =  314 bits (805), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 218/300 (72%), Gaps = 4/300 (1%)

Query: 30  MVVSTKILENEPLEASQSRINPLQILLVRMSITYCCTLVYMHWNKRSVPDIPWGPLPYRK 89
           M VSTK+LE    +  + RI PLQILL+RM +T    +VYM++N+R++P +P+G    R 
Sbjct: 1   MQVSTKVLETMGDKTEEDRIKPLQILLLRMVVTSIALVVYMYYNRRTIPYVPFGNPAVRG 60

Query: 90  WLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSL 149
           WLILRGI GF GVFGMY+SLMYL+ISDAVLI+FM+P+ TI  ++L+L E  S +E +GS 
Sbjct: 61  WLILRGIFGFIGVFGMYYSLMYLTISDAVLISFMAPSFTIISAWLVLHESISPIECMGSA 120

Query: 150 ISFSGVVLIIRPTFLFGQLNKTQETSEDNIVETQNPTLRLIAIGVSLLGVCGLSSVYIII 209
           +S SGV+LI+RPTF+FG  N   ++   +     +P  R IAI  +L G   LS VYI+I
Sbjct: 121 LSLSGVILIVRPTFIFGAAN---DSGNSDSTFNHDPAGRCIAIVFALFGAMSLSGVYIVI 177

Query: 210 RYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMTLQLPHSWKQWGLFLNLGVSGFIHQI 269
           R+IG++AHAIM+V+YFS VT VV+  G+++IP    Q   ++K   LFL +G+ GFIHQ+
Sbjct: 178 RFIGDRAHAIMNVNYFSFVTGVVSFFGILVIPGFKFQKIDNFKGLNLFLLIGICGFIHQL 237

Query: 270 LLTMGIQR-ERAGRGSLMTYTQVIYAVFWDVVLFHHWPNIWTWCGMAVIVSSTIWVINMR 328
           LL+MGIQR  +A +GSLM+YTQ+IYA+FWDV+++  WPN+++  GM +I+ STI VI M+
Sbjct: 238 LLSMGIQRVTKASKGSLMSYTQLIYAIFWDVIIWGKWPNVFSIIGMILIIGSTITVIKMK 297

>CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highly
           similar to uniprot|P09368 Saccharomyces cerevisiae
           YLR142w PUT1 Proline oxidase
          Length = 469

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 5/93 (5%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSIT 62
           +Q + K+  K  YG  L++ S+ + S M+ +TKIL++ P    ++ I   Q+L +  ++T
Sbjct: 353 IQDLLKNGTKSYYGH-LVVASHNYGSQML-ATKILKDAPENVGKANIVLGQLLGMSDNVT 410

Query: 63  YCCTLVYMHWNKRSVPDIPWG-PLPYRKWLILR 94
           +   L+  H  K  +  +PWG PL  + +L+ R
Sbjct: 411 H--DLITKHGAKNIIKYVPWGPPLETKDYLLRR 441

>TPHA0D02500 Chr4 (515403..516755) [1353 bp, 450 aa] {ON} Anc_5.551
           YML018C
          Length = 450

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQ 167
           SL Y S++   +++  S   T+F+ ++   E  +K + LGSL+SF G++L+    +    
Sbjct: 180 SLAYTSVASQTILSSTSSFFTLFIGYIWNIEKITKSKTLGSLVSFIGIILVTHSDYYH-- 237

Query: 168 LNKTQETSEDNIVETQNPTLRLIAIGVSLLGVCGLSS 204
                   +DN     NP   LI     ++ +   S 
Sbjct: 238 -------YDDNYPPRTNPHSSLITFAKEIINILTTSD 267

>KNAG0B03560 Chr2 complement(687312..688529) [1218 bp, 405 aa] {ON}
           Anc_5.551 YML018C
          Length = 405

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGV 155
           I+ F   F    +L Y S+S   +++  S   T+F+  L   E  ++L+ +G++ISF G+
Sbjct: 150 ILWFLANFATNAALAYTSVSSQTILSSTSSFFTLFIGALCNVESINRLKLIGAVISFVGI 209

Query: 156 VLIIR 160
            L+ R
Sbjct: 210 TLVTR 214

>TDEL0A04140 Chr1 (737337..738485) [1149 bp, 382 aa] {ON} Anc_5.551
           YML018C
          Length = 382

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 16/155 (10%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIR----PTF 163
           SL Y S++   +++  S   T+F+  L   E  SK++ +GS++SF G++L+ R    PT 
Sbjct: 135 SLSYTSVASQTILSSTSSFFTLFVGALCRVEKISKVKVIGSMVSFFGILLVTRSDSKPTH 194

Query: 164 LFGQLNKTQETSEDNIVETQNPTLRLIAIGVSLLGVCGLSSVY--IIIRYIGNKAHAIMS 221
           +     K    S D I++  N   + +   +  L    L  VY  ++ R + +++   M 
Sbjct: 195 I-----KPLPGSRD-ILDQNNDAFKTLIGNILALLGALLYGVYSTLLKRKVKDESRVNMK 248

Query: 222 VSYFSLVTTVVAALGVILIPSMTLQLPHSWKQWGL 256
           V +F  V        + L PSM L     W+ + L
Sbjct: 249 V-FFGFVGLFTL---IFLWPSMILLHYMGWETFEL 279

>TBLA0D01480 Chr4 complement(363558..364880) [1323 bp, 440 aa] {ON}
           Anc_5.551 YML018C
          Length = 440

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (54%)

Query: 99  FFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLI 158
           F   F    SL Y S++   +++  S   T+F+  L   E  +K++  GS++SF G++L+
Sbjct: 173 FVANFATNASLAYTSVASQTILSSTSSFFTLFVGGLFHVECVTKIKVFGSVVSFVGILLV 232

Query: 159 IRPTFL 164
            +  ++
Sbjct: 233 TKTDYV 238

>ZYRO0D13090g Chr4 (1102902..1104014) [1113 bp, 370 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 370

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGV 155
           I+ F   F    SLMY S++   +++  S   T+F+  L   E  +K + +GSL+SF G+
Sbjct: 125 IIWFLANFVTNASLMYTSVASQTILSSTSSFFTLFVGSLCNVESVNKAKVVGSLVSFMGI 184

Query: 156 VLI 158
           +L+
Sbjct: 185 MLV 187

>NDAI0C00940 Chr3 complement(180857..182200) [1344 bp, 447 aa] {ON}
           Anc_5.551
          Length = 447

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 3/106 (2%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGV 155
           I+ F   F    SL Y S++   +++  S   T+F+  L   E  + L+ +GS +SF G+
Sbjct: 185 ILWFLANFATNASLAYTSVASQTILSSTSSFFTLFIGALFHVEMINPLKVIGSTVSFIGI 244

Query: 156 VLIIRPTFLFGQLNKTQETSEDNIVETQNPTLRLIAIGVSLLGVCG 201
           + +I       +  +   TS  +I E  N T R++ IG +LL + G
Sbjct: 245 MSVIESDSHSLRKGRHLPTSS-SIDENGNDTTRIL-IG-NLLAIAG 287

>KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar to
           uniprot|Q03730 YML018C Saccharomyces cerevisiae
          Length = 414

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 81  PWGPLPYRKWLILRG---IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLG 137
           P   LP R  + L     I+ F        SL Y S++   +++  S   T+ +S L   
Sbjct: 131 PTIKLPLRSTIKLSAQFCILWFLANLVTNASLSYTSVASQTILSSTSSFFTLLVSALCHV 190

Query: 138 EPFSKLEALGSLISFSGVVLIIRPTFLFGQLNK 170
           E  +K++ LGS++SF G++++ +  + +   +K
Sbjct: 191 ESVNKIKVLGSIVSFIGIIMVTKSDYSYVTASK 223

>NCAS0F01200 Chr6 (234603..235706) [1104 bp, 367 aa] {ON} Anc_5.551
           YDR438W
          Length = 367

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGV 155
           I+ F   F    SL + SIS   +++  S   T+F+S LL  E  + L+ +G L+SF G+
Sbjct: 120 ILWFMANFMTNSSLQFTSISSQTILSSTSSFFTLFISALLKIEKINNLKIVGLLLSFFGI 179

Query: 156 VLIIR-----PTF 163
           +++ +     PTF
Sbjct: 180 IILTKSDNNSPTF 192

>Smik_13.133 Chr13 complement(223651..224832) [1182 bp, 393 aa] {ON}
           YML018C (REAL)
          Length = 393

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 65/128 (50%), Gaps = 18/128 (14%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQ 167
           SL + S++   +++  S   T+F+  +   E  +K + LGS ISF G++++ +       
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLNKSKILGSFISFVGIIMVTK------- 199

Query: 168 LNKTQETSEDNIVE---TQNPTLRLIAIGVSLLGVCG--LSSVY--IIIRYIGNKAHAIM 220
            + + +  + +IV+     N T+R  A+  +LL + G  L  VY  ++ R +G++    M
Sbjct: 200 -SDSDQHYQRHIVDVSGDDNDTMR--ALMGNLLALAGAVLYGVYSTLLKREVGDETRVNM 256

Query: 221 SVSYFSLV 228
            + +F  V
Sbjct: 257 KI-FFGFV 263

>TDEL0F04720 Chr6 (887597..889036) [1440 bp, 479 aa] {ON} Anc_8.348
           YLR142W
          Length = 479

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 5/84 (5%)

Query: 12  KPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYCCTLVYMH 71
           K  YG  L++ S+ ++S M+ +TK+LE +   A +  +   Q+L +  ++TY   L+  H
Sbjct: 371 KSTYGH-LVVASHNYHSQML-ATKLLEEKGSAAGKHNVVLGQLLGMADNVTY--DLITNH 426

Query: 72  WNKRSVPDIPWG-PLPYRKWLILR 94
             K  +  +PWG PL  + +L+ R
Sbjct: 427 GVKNIIKYVPWGPPLETKDYLLRR 450

>AER331C Chr5 complement(1245399..1246733) [1335 bp, 444 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML018C and
           YDR438W
          Length = 444

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 5/93 (5%)

Query: 73  NKRSVPDIPWGPLPYRKWLILR-----GIMGFFGVFGMYFSLMYLSISDAVLITFMSPTL 127
            +R   D+   P+    W   +      ++ F   F    SL + S+  A +++  S   
Sbjct: 166 RQRGCSDLSGKPVQISLWATAKLSAVFCVLWFVANFVTNASLGFTSVGSATILSSTSSFF 225

Query: 128 TIFLSFLLLGEPFSKLEALGSLISFSGVVLIIR 160
           T+ L  L+  E  S L+ LGS++S  G+VL+ +
Sbjct: 226 TLLLGVLMKTESASVLKVLGSVVSSLGIVLVTK 258

>Suva_13.141 Chr13 complement(225107..226309) [1203 bp, 400 aa] {ON}
           YML018C (REAL)
          Length = 400

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIR 160
           SL + S++   +++  S   T+F+  L   E  S+ + LGS ISF G++++ R
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGALCHVESLSRSKILGSFISFIGIIMVTR 199

>SAKL0G05456g Chr7 (448553..449737) [1185 bp, 394 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 394

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIR 160
           SL Y S++   +++  S   T+ +  L   E  ++++ +GS++SF G+VL+ R
Sbjct: 142 SLSYTSVASQTILSSTSSFFTLLVGALCHAEVINRIKVIGSIVSFIGIVLVTR 194

>YML018C Chr13 complement(234771..235952) [1182 bp, 393 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the membrane
           of the vacuole; physical interaction with Atg27p
           suggests a possible role in autophagy; YML018C is not an
           essential gene
          Length = 393

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIR 160
           SL + S++   +++  S   T+F+  +   E  SK + LGS ISF G++++ +
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLSKSKVLGSFISFVGIIMVTK 199

>Skud_13.133 Chr13 complement(221096..222277) [1182 bp, 393 aa] {ON}
           YML018C (REAL)
          Length = 393

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 59/123 (47%), Gaps = 8/123 (6%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQ 167
           SL + S++   +++  S   T+F+  +   E  +K + LGS ISF G++++ +       
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLNKSKILGSFISFIGIIMVTK-----SD 201

Query: 168 LNKTQETSEDNIVETQNPTLRLIAIGVSLLGVCGLSSVY--IIIRYIGNKAHAIMSVSYF 225
            ++  +    +I    N T++++   +  L    L  VY  ++ R +G++    M + +F
Sbjct: 202 SHQRYQRHIADISSDDNDTMQVLMGNLLALAGAVLYGVYSTLLKREVGDETRVNMKI-FF 260

Query: 226 SLV 228
             V
Sbjct: 261 GFV 263

>CAGL0G07018g Chr7 (668453..669628) [1176 bp, 391 aa] {ON} similar
           to uniprot|Q03730 Saccharomyces cerevisiae YML018c
          Length = 391

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIR 160
           SL Y S++   +++  S   T+F+      E   +++ +GSLISF G++L+ +
Sbjct: 154 SLGYTSVASQTILSSTSSFFTLFIGAAFRVETIDRVKVIGSLISFIGILLVTK 206

>KAFR0C05510 Chr3 (1102100..1103311) [1212 bp, 403 aa] {ON}
           Anc_5.551 YML018C
          Length = 403

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 70  MHWNKRSVPDIPWGPLPYRKWLILRG---IMGFFGVFGMYFSLMYLSISDAVLITFMSPT 126
           +H N   + +I    L  ++ + L     I+ F        SL Y S++   +++  S  
Sbjct: 121 IHDNNHILTNISTQRLSLKETIRLSAQFCILWFLANLATNASLAYTSVASQTILSSTSSF 180

Query: 127 LTIFLSFLLLGEPFSKLEALGSLISFSGVVLI 158
            T+F+  L   E  +  + +GS+ISF G++L+
Sbjct: 181 FTLFIGALCQVETLNHSKIVGSIISFGGIILV 212

>NCAS0C03160 Chr3 complement(620413..622107) [1695 bp, 564 aa] {ON}
           Anc_8.348 YLR142W
          Length = 564

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 53/93 (56%), Gaps = 5/93 (5%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSIT 62
           ++ +SK+  +  YG  L++ S+ + S ++ +  + E++ L A+ S +   Q+L +  ++T
Sbjct: 449 IKDLSKNGDQSIYGH-LVVASHNYKSQLIATKLLKESKSLYAN-SNVVLGQLLGMADNVT 506

Query: 63  YCCTLVYMHWNKRSVPDIPWG-PLPYRKWLILR 94
           +   LVY H  K  +  +PWG PL  + +L+ R
Sbjct: 507 H--DLVYNHGAKNIIKYVPWGPPLETKDYLLRR 537

>Ecym_4224 Chr4 complement(468353..469753) [1401 bp, 466 aa] {ON}
           similar to Ashbya gossypii AGL165W
          Length = 466

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 19  LLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYCCTLVYMHWNKRSVP 78
           +++ S+ ++S M+ +  ++ ++    S  + N +   L+ MS      L+Y H  K  + 
Sbjct: 366 MVVASHNYHSQMLATMLLVSSD---GSYGKANVVLAQLLGMSDNVTHDLIYNHGAKNIIK 422

Query: 79  DIPWGPLPYRKWLILR 94
            +PWGP    K  +LR
Sbjct: 423 YVPWGPPEETKDYLLR 438

>NDAI0C03800 Chr3 (866392..868419) [2028 bp, 675 aa] {ON} 
          Length = 675

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 19  LLIVSYFFNSSMVVSTKILENE---PLEASQSRINPLQILLVRMSITYCCTLVYMHWNKR 75
           L++ S+ + S M+ +  + +N+    +E ++S +   Q+L +   +TY   L++ H    
Sbjct: 570 LMVASHNYKSQMIATQLLFKNKYANDIEYAKSNVVLGQLLGMADDLTY--DLIHHHGATN 627

Query: 76  SVPDIPWGPLPYRKWLILRGIM 97
            V  +PWGP    K  +LR + 
Sbjct: 628 IVKYVPWGPPRETKDYLLRRLQ 649

>KLTH0G04312g Chr7 (343552..344778) [1227 bp, 408 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 408

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIR 160
           SL Y S++   +++  S   T+ +  L   E  ++++ LGS+ISF G+V + +
Sbjct: 163 SLSYTSVASQTILSSTSSFFTLLIGSLFHVESVNRVKVLGSVISFVGIVFVTK 215

>KAFR0I00860 Chr9 (167141..168205) [1065 bp, 354 aa] {ON} Anc_5.551
           YML018C
          Length = 354

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%)

Query: 93  LRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISF 152
           L  ++ F   F   FSL Y +++   +++  S   T+F+  LL  E     +  G ++SF
Sbjct: 109 LFAVLWFSAAFTSNFSLSYTTVASQTILSSTSSFFTLFIGVLLSIESIDSTKLFGLVVSF 168

Query: 153 SGVVLII 159
            G+V+++
Sbjct: 169 MGIVILV 175

>YLR142W Chr12 (425186..426616) [1431 bp, 476 aa] {ON}  PUT1Proline
           oxidase, nuclear-encoded mitochondrial protein involved
           in utilization of proline as sole nitrogen source; PUT1
           transcription is induced by Put3p in the presence of
           proline and the absence of a preferred nitrogen source
          Length = 476

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 19  LLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYCCTLVYMHWNKRSVP 78
           L++ S+ + S M+V+  +   +    ++S I   Q+L +  ++TY   L+  H  K  + 
Sbjct: 372 LVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTY--DLITNHGAKNIIK 429

Query: 79  DIPWG-PLPYRKWLILR 94
            +PWG PL  + +L+ R
Sbjct: 430 YVPWGPPLETKDYLLRR 446

>NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551
          Length = 423

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGV 155
           I+ F   F    SL Y S++   +++  S   T+F+  L   E  ++ + +GS+ISF G 
Sbjct: 161 ILWFLANFVTNASLAYTSVASQTILSSTSSFFTLFIGSLCHVEQINRSKIIGSIISFLGT 220

Query: 156 VLIIR 160
           +L+ +
Sbjct: 221 MLVTK 225

>Kpol_1004.39 s1004 (83150..84325) [1176 bp, 391 aa] {ON}
           (83150..84325) [1176 nt, 392 aa]
          Length = 391

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTF 163
           SL Y S++   +++  S   T+F+  +   E  +K + LGSLISF G++ +    +
Sbjct: 144 SLAYTSVASQTILSSTSSFFTLFIGAIWKVESVTKSKLLGSLISFIGILFVTHSDY 199

>KLLA0D16962g Chr4 (1437692..1439095) [1404 bp, 467 aa] {ON} similar
           to uniprot|P09368 Saccharomyces cerevisiae YLR142W PUT1
           proline oxidase
          Length = 467

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 44/77 (57%), Gaps = 4/77 (5%)

Query: 19  LLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMSITYCCTLVYMHWNKRSVP 78
           L++ S+ ++S M+ +TK+L ++     ++ +   Q+L +  ++T+   L+  H  +  + 
Sbjct: 367 LVVASHNYDSQML-ATKLLADQKNSVGKANVTLAQLLGMSDNVTH--DLITNHKVENIIK 423

Query: 79  DIPWG-PLPYRKWLILR 94
            +PWG PL  + +L+ R
Sbjct: 424 YVPWGPPLETKDYLLRR 440

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,383,614
Number of extensions: 1293392
Number of successful extensions: 4382
Number of sequences better than 10.0: 75
Number of HSP's gapped: 4469
Number of HSP's successfully gapped: 75
Length of query: 353
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 242
Effective length of database: 40,753,473
Effective search space: 9862340466
Effective search space used: 9862340466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)