Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.356.5ON76776736490.0
Smik_6.4786.5ON77377432020.0
YPL270W (MDL2)6.5ON77377432010.0
Skud_16.76.5ON77377331980.0
NDAI0I027306.5ON83273022970.0
NCAS0D022106.5ON77374122860.0
CAGL0A01133g6.5ON80177222880.0
ZYRO0F00396g6.5ON73275722400.0
Kpol_1045.836.5ON74863722220.0
TDEL0G046606.5ON73968822210.0
TPHA0J002206.5ON74065621680.0
TBLA0A071906.5ON79463421690.0
KNAG0E028006.5ON74162021040.0
SAKL0E00748g6.5ON77460320750.0
Kwal_56.223296.5ON77664020640.0
KLTH0C11616g6.5ON74070220370.0
ACR022W6.5ON75464820280.0
KLLA0D00748g6.5ON78961620220.0
Ecym_30076.5ON76962219440.0
KAFR0B064806.5ON75177919220.0
TPHA0B046201.67ON72069513511e-176
NDAI0A005601.67ON71461713351e-174
TDEL0C063501.67ON69368013201e-172
SAKL0C02244g1.67ON71266213171e-171
Skud_12.2531.67ON69264013151e-171
NCAS0B087001.67ON71565213151e-171
YLR188W (MDL1)1.67ON69563313111e-171
Smik_12.2481.67ON69664113041e-169
Kpol_2000.791.67ON70760713051e-169
KLLA0C01991g1.67ON70661712971e-168
Suva_10.2841.67ON69360412891e-167
ZYRO0F17050g1.67ON71463612761e-165
Ecym_10721.67ON68366312731e-165
KLTH0F02024g1.67ON73471512461e-160
AFR683C1.67ON67765112371e-160
Kwal_33.133081.67ON70665712351e-159
CAGL0E00385g1.67ON60861111761e-152
TBLA0A053001.67ON70761611821e-151
SAKL0H00968g5.20ON7003275122e-54
YKL209C (STE6)1.527ON12905155123e-53
Kwal_26.94805.20ON7193255016e-53
TDEL0F003401.527ON12575235062e-52
KLTH0B09482g5.20ON6943274865e-51
KLLA0A10131g5.20ON7203274832e-50
KAFR0I025805.20ON7093934672e-48
Suva_11.111.527ON12905154742e-48
Skud_13.4755.20ON6913924653e-48
TPHA0L022705.20ON7113914653e-48
Smik_13.5185.20ON6875294626e-48
KNAG0E013205.20ON6953264627e-48
Suva_13.4915.20ON6933954619e-48
YMR301C (ATM1)5.20ON6905274573e-47
NCAS0D024305.20ON7023284564e-47
Ecym_56495.20ON6963304557e-47
TBLA0C070005.20ON7253314495e-46
TBLA0B100701.527ON12965194556e-46
Kpol_1018.1851.527ON12765084548e-46
Skud_11.111.527ON12955174548e-46
TDEL0G004305.20ON6963264372e-44
Kpol_513.235.20ON7083284362e-44
NDAI0I024405.20ON7305494372e-44
AGL335W5.20ON6913454326e-44
KAFR0E002301.527ON12705574378e-44
ZYRO0G02244g1.527ON12733984333e-43
ZYRO0D07106g5.20ON7093294212e-42
KNAG0G001901.527ON12755544252e-42
Smik_11.141.527ON13165274226e-42
KLLA0B14256g1.527ON12712524192e-41
CAGL0K00363g1.527ON12275404182e-41
CAGL0M13739g5.20ON7273224132e-41
AFR432W1.527ON12845034164e-41
Ecym_36121.527ON13155104139e-41
NDAI0D015401.527ON12933464139e-41
NCAS0G035101.527ON12885104112e-40
SAKL0A10208g1.527ON13105044102e-40
TPHA0O001601.527ON12534074003e-39
KLTH0B01100g1.527ON12983143961e-38
NCAS0J00160singletonON16545043862e-37
NCAS0C059304.6ON16575383773e-36
NCAS0E041605.10ON15065673747e-36
CAGL0E03982g4.6ON16594933747e-36
CAGL0E03355g4.52ON15355453739e-36
NDAI0B006405.10ON14915503721e-35
TDEL0E056104.52ON15355403674e-35
SAKL0H26026g4.6ON16535473674e-35
KNAG0E011204.6ON17175483641e-34
ZYRO0G07612g4.6ON16955033631e-34
Kwal_33.155611.527ON12973243612e-34
KLLA0E00529g4.6ON16505133585e-34
Smik_12.484.52ON15575433576e-34
TPHA0C009608.303ON15235683577e-34
Kwal_34.157704.6ON14365053569e-34
YGR281W (YOR1)5.10ON14775533551e-33
Suva_10.234.6ON16615453551e-33
YHL035C (VMR1)4.6ON15925533514e-33
NDAI0J011508.303ON15174853504e-33
TBLA0G007104.6ON16915023515e-33
KLTH0H16038g4.6ON16495053496e-33
TDEL0G018504.6ON16424763498e-33
Kpol_311.34.6ON16574993488e-33
CAGL0G00242g5.10ON14775653481e-32
KLTH0C09240gna 1ON15463153481e-32
YLL048C (YBT1)4.6ON16615153471e-32
KAFR0C065105.10ON14575293462e-32
Smik_16.275.10ON14775633452e-32
Ecym_84184.6ON16785633442e-32
Skud_7.6145.10ON14775583434e-32
Ecym_42658.303ON15054933416e-32
Kwal_56.22747na 1ON15383173407e-32
Suva_7.5775.10ON14785763409e-32
Smik_12.114.6ON16615443391e-31
KNAG0J027304.52ON15375433391e-31
NCAS0B034708.303ON15122853382e-31
KNAG0K001705.10ON14425523362e-31
TPHA0F001804.6ON16465703363e-31
NDAI0H001904.6ON16825083353e-31
Skud_12.524.52ON15615483353e-31
Skud_12.224.6ON16615063344e-31
Smik_8.64.6ON15855093344e-31
KAFR0B056308.303ON15152493301e-30
KAFR0L001904.6ON16533103283e-30
ZYRO0G22176g4.52ON15703373273e-30
CAGL0C03289g4.6ON16485083273e-30
TBLA0A06840singletonON10582703254e-30
KLTH0G12716g8.303ON15002493264e-30
KAFR0I013004.52ON15362563255e-30
Zrou_YGOB_Anc_5.105.10ON9925623237e-30
TPHA0K023104.6ON16494793248e-30
SAKL0H00704g5.10ON14395723239e-30
Skud_4.3958.303ON15162843231e-29
TPHA0F004104.52ON15705573221e-29
TPHA0A056205.10ON14775543183e-29
Kpol_1033.288.303ON15312543184e-29
YKR104WsingletonON3062612994e-29
Kpol_1060.75.10ON14605493175e-29
YDR135C (YCF1)8.303ON15152853176e-29
Suva_2.2978.303ON15162843159e-29
TBLA0C071005.10ON14855653141e-28
Smik_4.3808.303ON15162773131e-28
ACL072C4.6ON16275133131e-28
KNAG0I009908.303ON15352513132e-28
Skud_8.94.6ON15875193132e-28
KLTH0B00396gsingletonON15072453122e-28
YLL015W (BPT1)4.52ON15595453112e-28
ZYRO0D06160g8.303ON15252903113e-28
Suva_8.164.6ON15995583103e-28
KLTH0B09724g5.10ON14865433103e-28
Kwal_56.238448.303ON14942493104e-28
Kwal_26.95325.10ON14715363094e-28
Suva_10.60singletonON9903303075e-28
TBLA0C06400singletonON13775573085e-28
KLLA0F20075g8.303ON15162293085e-28
SAKL0H16016g8.303ON14992833086e-28
Suva_10.594.52ON15615483061e-27
CAGL0L06402g8.303ON15352513014e-27
SAKL0H23958g4.52ON15582872997e-27
TDEL0F043008.303ON15142442971e-26
Skud_18.2singletonON15802592971e-26
TDEL0G003305.10ON14655842942e-26
AGR047W8.303ON14922642943e-26
KLLA0D04059g4.52ON15682792901e-25
KLLA0C14234g5.10ON14545352862e-25
Smik_11.367na 2ON15952602853e-25
Kpol_YGOB_1041.454.52ON15685472747e-24
Kpol_1041.45singletonOFF15965472731e-23
TBLA0A038008.303ON15465362632e-22
AGL346W5.10ON14002422505e-21
Ecym_56605.10ON15362202023e-15
YKR103W (NFT1)na 2ON12182321942e-14
ACR128C8.661ON8271931809e-13
YPL147W (PXA1)8.661ON8702321754e-12
SAKL0D10208g1.366ON7522371736e-12
Suva_16.1638.661ON8702061736e-12
Smik_6.3448.661ON8702321701e-11
Kpol_175.1singletonON13773901702e-11
SAKL0D09394g1.427ON10272751683e-11
Ecym_24108.661ON8281911673e-11
KNAG0I005301.427ON10472421673e-11
TDEL0B057601.427ON10362431673e-11
SAKL0H21010gsingletonON14472391673e-11
KLTH0D10890g8.661ON8302541664e-11
Kwal_26.87308.661ON8312101664e-11
Skud_16.1358.661ON8702321655e-11
KLTH0H12760g1.427ON10202621648e-11
NDAI0H035701.366ON7552071638e-11
TBLA0D043501.427ON11192491631e-10
AER190W1.427ON10112681631e-10
CAGL0K10472g1.366ON7522121611e-10
AEL032W1.366ON7532411611e-10
KLLA0F11484g8.661ON8452391612e-10
KNAG0C019601.366ON7522391602e-10
YER036C (ARB1)3.534ON6102421592e-10
ZYRO0B05588g3.133ON12702341602e-10
Smik_5.1593.534ON6101881593e-10
Ecym_11943.534ON6093281583e-10
Skud_5.1453.534ON6101881583e-10
ZYRO0E04092g1.427ON10622811593e-10
Suva_5.1343.534ON6101881583e-10
ZYRO0E08800g3.534ON6102421573e-10
KAFR0C045401.366ON7522391575e-10
TBLA0I033303.534ON6103201565e-10
TPHA0D011708.661ON9152101575e-10
Kwal_23.51613.220ON14892351575e-10
SAKL0F01606g3.534ON6081781565e-10
NDAI0E012408.661ON8972081575e-10
ZYRO0D11880g5.500ON14982371568e-10
YOL075C3.133ON12942471559e-10
Skud_4.2623.220ON15012361559e-10
KLTH0H13442g1.366ON7522411541e-09
SAKL0C11616g3.220ON14842371551e-09
NCAS0A085701.427ON10602591551e-09
Suva_15.913.133ON13022471551e-09
TPHA0A008403.133ON13122341541e-09
ZYRO0G01144g1.366ON7522351531e-09
CAGL0C02343g3.534ON7202771531e-09
KNAG0A029808.661ON8712781532e-09
TBLA0D01820singletonON15512341532e-09
KLTH0A01914g3.220ON14992321532e-09
Kpol_1043.431.366ON7522291522e-09
TBLA0D017805.500ON15952341532e-09
Kwal_0.3271.427ON10192621522e-09
KLLA0A10857g1.366ON7522291512e-09
KNAG0B038705.500ON15132391522e-09
TDEL0A060708.661ON8721931512e-09
ZYRO0B14762gsingletonON15152711513e-09
AGL142CsingletonON14972371513e-09
KLLA0D04554g1.427ON10222121513e-09
TBLA0C012201.366ON7512271503e-09
Ecym_36043.220ON14742411513e-09
KAFR0C052205.500ON14992501503e-09
Smik_15.843.133ON12952341504e-09
KAFR0A037908.661ON8762091504e-09
YNR070W (PDR18)na 3ON13332361504e-09
TDEL0D040403.220ON15002331504e-09
ZYRO0F07018g8.661ON8612001494e-09
YDR011W (SNQ2)3.220ON15012361495e-09
CAGL0I04862g3.220ON15072361495e-09
NCAS0A120605.500ON15432351495e-09
KAFR0C05210na 4ON14932341495e-09
KAFR0C00820na 5ON15172401495e-09
TPHA0A023101.366ON7522341485e-09
NCAS0F00410singletonON15312361495e-09
NCAS0B053003.133ON12732381486e-09
Skud_4.6805.500ON14452421487e-09
Skud_4.681na 4ON14452421487e-09
CAGL0F02717g5.500ON15422531487e-09
Kwal_34.162401.366ON7522411477e-09
NCAS0D005801.366ON7532341468e-09
Smik_7.3131.366ON7522331469e-09
TDEL0D060203.534ON6102431459e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.35
         (767 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...  1410   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...  1238   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...  1237   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)  1236   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   889   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      885   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   885   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   867   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   860   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   860   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   839   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   840   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   815   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   803   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   799   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   789   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   785   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   783   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   753   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   744   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   525   e-176
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   518   e-174
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   513   e-172
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   511   e-171
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   511   e-171
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   511   e-171
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   509   e-171
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   506   e-169
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   507   e-169
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   504   e-168
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   501   e-167
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   496   e-165
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   494   e-165
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   484   e-160
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   481   e-160
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   480   e-159
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   457   e-152
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   459   e-151
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   201   2e-54
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   201   3e-53
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   197   6e-53
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   199   2e-52
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   191   5e-51
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   190   2e-50
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   184   2e-48
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   187   2e-48
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   183   3e-48
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   183   3e-48
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   182   6e-48
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   182   7e-48
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   182   9e-48
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   180   3e-47
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     180   4e-47
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   179   7e-47
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   177   5e-46
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   179   6e-46
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   179   8e-46
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   179   8e-46
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   172   2e-44
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   172   2e-44
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   172   2e-44
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   171   6e-44
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   172   8e-44
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   171   3e-43
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   166   2e-42
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   168   2e-42
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   167   6e-42
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   166   2e-41
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   165   2e-41
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   163   2e-41
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   164   4e-41
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   163   9e-41
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   163   9e-41
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   162   2e-40
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   162   2e-40
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   158   3e-39
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   157   1e-38
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   153   2e-37
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   149   3e-36
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    148   7e-36
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   148   7e-36
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   148   9e-36
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    147   1e-35
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   145   4e-35
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   145   4e-35
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   144   1e-34
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   144   1e-34
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   143   2e-34
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   142   5e-34
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   142   6e-34
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   142   7e-34
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   141   9e-34
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   141   1e-33
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   141   1e-33
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   139   4e-33
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   139   4e-33
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   139   5e-33
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   139   6e-33
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   139   8e-33
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   138   8e-33
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   138   1e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   138   1e-32
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   138   1e-32
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   137   2e-32
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   137   2e-32
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   137   2e-32
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   136   4e-32
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   135   6e-32
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   135   7e-32
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   135   9e-32
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   135   1e-31
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   135   1e-31
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   134   2e-31
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   134   2e-31
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   134   3e-31
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   133   3e-31
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   133   3e-31
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   133   4e-31
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   133   4e-31
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   131   1e-30
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   130   3e-30
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   130   3e-30
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   130   3e-30
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   129   4e-30
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   130   4e-30
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   129   5e-30
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   129   7e-30
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   129   8e-30
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   129   9e-30
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   129   1e-29
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   128   1e-29
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   127   3e-29
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   127   4e-29
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   119   4e-29
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   126   5e-29
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   126   6e-29
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   125   9e-29
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           125   1e-28
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   125   1e-28
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   125   1e-28
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   125   2e-28
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   125   2e-28
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   124   2e-28
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   124   2e-28
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   124   3e-28
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   124   3e-28
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   124   3e-28
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   124   4e-28
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   123   4e-28
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   122   5e-28
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   123   5e-28
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   123   5e-28
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   123   6e-28
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   122   1e-27
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   120   4e-27
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   119   7e-27
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   119   1e-26
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   119   1e-26
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   117   2e-26
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   117   3e-26
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   116   1e-25
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   114   2e-25
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   114   3e-25
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   110   7e-24
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   109   1e-23
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   105   2e-22
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   100   5e-21
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    82   3e-15
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    79   2e-14
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    74   9e-13
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    72   4e-12
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    71   6e-12
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    71   6e-12
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    70   1e-11
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    70   2e-11
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    69   3e-11
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    69   3e-11
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    69   3e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    69   3e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    69   3e-11
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    69   4e-11
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    69   4e-11
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    68   5e-11
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    68   8e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    67   8e-11
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    67   1e-10
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    67   1e-10
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    67   1e-10
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    67   1e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    67   2e-10
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    66   2e-10
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    66   2e-10
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    66   2e-10
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    66   3e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    65   3e-10
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    65   3e-10
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    66   3e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    65   3e-10
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    65   3e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    65   5e-10
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    65   5e-10
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    65   5e-10
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    65   5e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   5e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     65   5e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    65   8e-10
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    64   9e-10
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    64   9e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    64   1e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    64   1e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    64   1e-09
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    64   1e-09
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    64   1e-09
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    64   1e-09
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    64   1e-09
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    64   2e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              64   2e-09
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    64   2e-09
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    63   2e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    64   2e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    63   2e-09
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    63   2e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    63   2e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    63   2e-09
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    63   3e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    63   3e-09
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    63   3e-09
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    62   3e-09
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    63   3e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    62   3e-09
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    62   4e-09
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    62   4e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    62   4e-09
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    62   4e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    62   4e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    62   5e-09
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    62   5e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    62   5e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            62   5e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              62   5e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    62   5e-09
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                62   5e-09
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    62   6e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   7e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   7e-09
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             62   7e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    61   7e-09
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       61   8e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    61   9e-09
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    60   9e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    61   9e-09
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    60   1e-08
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    61   1e-08
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    60   1e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    61   1e-08
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    60   1e-08
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    60   1e-08
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    60   1e-08
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    60   1e-08
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    60   1e-08
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    60   1e-08
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    60   2e-08
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    60   2e-08
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    60   2e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    60   2e-08
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    60   2e-08
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    60   2e-08
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    60   2e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    60   2e-08
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    60   2e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    60   2e-08
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    60   2e-08
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    60   2e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    60   2e-08
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    60   2e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    60   3e-08
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 59   3e-08
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    59   3e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    60   3e-08
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    60   3e-08
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    60   3e-08
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    59   3e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    59   3e-08
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    59   3e-08
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    59   3e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    59   4e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    59   4e-08
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    59   4e-08
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    59   4e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    59   5e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    59   5e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    59   5e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    59   5e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    59   5e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    59   5e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    59   5e-08
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    57   7e-08
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    58   7e-08
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    58   7e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    58   7e-08
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    58   8e-08
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     58   8e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    58   9e-08
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    58   9e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    58   9e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    58   9e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    57   9e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    58   9e-08
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    58   1e-07
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    58   1e-07
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    57   1e-07
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    57   1e-07
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    57   1e-07
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    57   1e-07
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    57   2e-07
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    57   2e-07
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    52   2e-07
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    57   2e-07
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    56   2e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    57   2e-07
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    57   2e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    56   2e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    56   3e-07
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    56   3e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    56   3e-07
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    56   3e-07
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    56   4e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    56   4e-07
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    56   4e-07
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    56   4e-07
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    56   4e-07
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    55   5e-07
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    55   5e-07
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            55   5e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    55   6e-07
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    55   6e-07
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    55   6e-07
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    55   7e-07
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    55   7e-07
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    54   7e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    55   7e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    55   7e-07
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    54   7e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    55   8e-07
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    55   9e-07
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    55   9e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    55   1e-06
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    55   1e-06
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    55   1e-06
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    54   1e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    54   1e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    54   1e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    54   1e-06
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    54   1e-06
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    54   1e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    54   1e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    54   1e-06
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    53   2e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    54   2e-06
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    54   2e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    53   3e-06
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    53   3e-06
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    53   3e-06
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    53   3e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    52   4e-06
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    52   5e-06
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    52   6e-06
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    52   6e-06
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    52   6e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    52   7e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    52   7e-06
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    51   9e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    51   9e-06
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    51   1e-05
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    51   1e-05
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    51   1e-05
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    50   1e-05
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    51   1e-05
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    51   1e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    51   1e-05
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    50   2e-05
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    50   2e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    50   2e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    50   2e-05
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    50   2e-05
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    50   2e-05
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     50   3e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    50   3e-05
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    50   3e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    49   4e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    49   6e-05
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    48   8e-05
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    48   1e-04
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    47   1e-04
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    47   1e-04
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    46   2e-04
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    47   2e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    47   2e-04
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              47   2e-04
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    46   2e-04
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    47   2e-04
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    46   2e-04
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    47   3e-04
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    46   3e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    46   3e-04
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    46   4e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    46   4e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    46   4e-04
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    45   6e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    45   6e-04
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    45   6e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    45   7e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    45   7e-04
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    45   7e-04
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    45   8e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    44   0.001
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    45   0.001
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    45   0.001
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    44   0.001
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    45   0.001
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    45   0.001
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    44   0.001
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    44   0.001
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    44   0.001
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    43   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    44   0.001
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    44   0.002
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    43   0.002
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    44   0.002
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    44   0.002
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    44   0.002
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.002
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    43   0.003
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    43   0.003
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    43   0.003
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    43   0.003
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    43   0.003
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    42   0.003
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    42   0.003
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    43   0.003
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    43   0.004
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    43   0.004
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    43   0.004
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    43   0.004
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    43   0.004
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    42   0.005
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    42   0.005
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    42   0.005
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    42   0.005
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    41   0.005
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    42   0.005
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    42   0.005
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    42   0.005
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    42   0.006
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    42   0.006
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    41   0.006
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    42   0.007
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.008
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    42   0.009
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    41   0.010
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    42   0.010
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     41   0.010
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    41   0.010
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    40   0.010
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    41   0.010
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    41   0.012
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    40   0.012
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    41   0.013
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    41   0.013
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    41   0.014
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    41   0.014
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    41   0.014
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    41   0.015
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    41   0.016
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    40   0.016
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    41   0.016
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.017
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    40   0.019
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    40   0.020
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    40   0.021
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    40   0.022
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    40   0.024
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    39   0.040
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    39   0.045
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    39   0.048
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    39   0.053
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    39   0.057
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    38   0.070
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    38   0.078
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    38   0.081
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    38   0.10 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    37   0.15 
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    37   0.15 
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    37   0.16 
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    37   0.18 
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    36   0.24 
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    36   0.37 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    36   0.42 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    36   0.45 
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    36   0.46 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.54 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    35   0.69 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    35   0.71 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.86 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    35   0.91 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    35   0.93 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    35   1.0  
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    34   1.2  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    34   1.4  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    33   2.5  
Suva_43.1 Chr43 (2..1099) [1098 bp, 366 aa] {ON} YDR011W (REAL)        33   3.8  
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    32   8.1  

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score = 1410 bits (3649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/767 (91%), Positives = 700/767 (91%)

Query: 1   MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL 60
           MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL
Sbjct: 1   MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL 60

Query: 61  SQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXX 120
           SQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWK      
Sbjct: 61  SQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKLLLTAI 120

Query: 121 XXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCV 180
                SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCV
Sbjct: 121 LLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCV 180

Query: 181 ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMT 240
           ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMT
Sbjct: 181 ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMT 240

Query: 241 QKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEAT 300
           QKVSDGVKALICGVVGVGMMCSLSPQ               ASVFGKQIRNTSKDLQEAT
Sbjct: 241 QKVSDGVKALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEAT 300

Query: 301 GQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGD 360
           GQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SLLGD
Sbjct: 301 GQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGD 360

Query: 361 LSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           LSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE
Sbjct: 361 LSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420

Query: 421 LTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 480
           LTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS
Sbjct: 421 LTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 480

Query: 481 GRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT 540
           GRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT
Sbjct: 481 GRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT 540

Query: 541 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKK 600
           YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKK
Sbjct: 541 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKK 600

Query: 601 PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 660
           PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS
Sbjct: 601 PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 660

Query: 661 VVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVXXXXXXXXXXXXXXHDQRNEXXX 720
           VVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQV              HDQRNE   
Sbjct: 661 VVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNEGDD 720

Query: 721 XXXXXXXXXXKPLESKDKKSDDIEESVEHVLKDAAKEANPIKLSPPP 767
                     KPLESKDKKSDDIEESVEHVLKDAAKEANPIKLSPPP
Sbjct: 721 GSNHDNDSNNKPLESKDKKSDDIEESVEHVLKDAAKEANPIKLSPPP 767

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/774 (81%), Positives = 659/774 (85%), Gaps = 8/774 (1%)

Query: 1   MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL 60
           MLN RLPL RLG+YRN+LSR R+ KLP +RFRSL T SSS LI I+ L TR   I K+L+
Sbjct: 1   MLNSRLPLLRLGLYRNMLSRPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLI 60

Query: 61  SQFVRFNSTKTQQDIPPLPSTSASKQP----AKPAYQSKSDDYKDIIRLFMLAKRDWKXX 116
               R+ S+KT+    PLPS S++ +     A    QSK+DDYKDIIRLFMLAKRDWK  
Sbjct: 61  LSSFRYISSKTKLQ-APLPSVSSTSKGSSKSAHSTEQSKTDDYKDIIRLFMLAKRDWKLL 119

Query: 117 XXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL 176
                    SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL
Sbjct: 120 LTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL 179

Query: 177 IGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 236
           IGC ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS
Sbjct: 180 IGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 239

Query: 237 RSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDL 296
           RSMTQKVSDGVKALICG+VGVGMMCSLSPQ               ASVFGKQIRNTSKDL
Sbjct: 240 RSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299

Query: 297 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 356
           QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              S
Sbjct: 300 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTS 359

Query: 357 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 416
           LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS
Sbjct: 360 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419

Query: 417 RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
           RLFELTDRKPSISPTVGHKY+P+RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI
Sbjct: 420 RLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 479

Query: 477 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 536
           VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK+NCKSLRR IGIVQQEPVLMSGTIR
Sbjct: 480 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIR 539

Query: 537 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARA 596
           DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP+GTLLSGGQKQRIAIARA
Sbjct: 540 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARA 599

Query: 597 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656
           LIKKPT+LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG
Sbjct: 600 LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 659

Query: 657 HDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVXXXXXXXXXXXXXXHDQRN 716
           HDGSVVEMGKFKELY+N TSALSQLLNER AP PS+QQ Q+              HDQ+N
Sbjct: 660 HDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEKHDQQN 719

Query: 717 EX---XXXXXXXXXXXXKPLESKDKKSDDIEESVEHVLKDAAKEANPIKLSPPP 767
           +                + LE KDK S++IEESVEH+LKDAAKEANPIKL+P P
Sbjct: 720 KQDDDNSHNNHDNDSNNQSLEVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score = 1237 bits (3201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/774 (81%), Positives = 658/774 (85%), Gaps = 8/774 (1%)

Query: 1   MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL 60
           MLNGRLPL RLG+ RN+LSR RL KLP IRFRSL T SSS LIP+  LC R   + KSL+
Sbjct: 1   MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI 60

Query: 61  SQFVRFNSTKTQQDIPPLPSTSA-SKQPAKPAY---QSKSDDYKDIIRLFMLAKRDWKXX 116
            Q  R NS+KT  +   LPS S  SK  A+ A+   QSK+DDYKDIIRLFMLAKRDWK  
Sbjct: 61  LQSFRCNSSKTVPETS-LPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLL 119

Query: 117 XXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL 176
                    SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL
Sbjct: 120 LTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL 179

Query: 177 IGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 236
           IGC ANFGRFILLRILSERVVARLRA+VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS
Sbjct: 180 IGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 239

Query: 237 RSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDL 296
           RSMTQKVSDGVKALICGVVGVGMMCSLSPQ               ASVFGKQIRNTSKDL
Sbjct: 240 RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299

Query: 297 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 356
           QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              S
Sbjct: 300 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTS 359

Query: 357 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 416
           LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS
Sbjct: 360 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419

Query: 417 RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
           RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCI
Sbjct: 420 RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479

Query: 477 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 536
           VGPSGRGKSTIALLLLRYYNPTTGTI IDNQDI+K+NCKSLRRHIGIVQQEPVLMSGTIR
Sbjct: 480 VGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIR 539

Query: 537 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARA 596
           DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP+GTLLSGGQKQRIAIARA
Sbjct: 540 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARA 599

Query: 597 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656
           LIKKPT+LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG
Sbjct: 600 LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 659

Query: 657 HDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVXXXXXXXXXXXXXXHDQRN 716
           HDGSVVEMGKFKELY+NPTSALSQLLNE+ AP PS+QQ Q+              HD + 
Sbjct: 660 HDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEHDDQK 719

Query: 717 EXXXXXXXXXXXXXKPL---ESKDKKSDDIEESVEHVLKDAAKEANPIKLSPPP 767
           +                   E+KD  SDDIE+SVEH+LKDAAKEANPIK++P P
Sbjct: 720 KDDNDDNDNNHDNDSNNQSPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/773 (81%), Positives = 659/773 (85%), Gaps = 6/773 (0%)

Query: 1   MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL 60
           MLNGRLPL RLG+ RN++SR RL KLP I+FRSL T SSSHLIPI+ LC R   + KSLL
Sbjct: 1   MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL 60

Query: 61  SQFVRFNSTKTQQDIPPLPSTSASK---QPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXX 117
            QF R+NS+KT+       S+SASK   +PA+P  +SK+DDYKDIIRLFMLAKRDWK   
Sbjct: 61  LQFSRYNSSKTEPVALLSSSSSASKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKLLL 120

Query: 118 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 177
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFF+LKIPIFSLPLYEFLSFFTVALLI
Sbjct: 121 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI 180

Query: 178 GCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 237
           GC ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 238 SMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQ 297
           SMTQKVSDGVKALICGVVGVGMMCSLSPQ               ASVFGKQIRNTSKDLQ
Sbjct: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 298 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 357
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 358 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 417
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 418 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 477
           LFELTDRKPSISPT GHKYKP RGV+EFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCIV
Sbjct: 421 LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480

Query: 478 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 537
           GPSGRGKSTIALLLLRYYNP+TGTIMID+QDITKMNCKSLRRHIGIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540

Query: 538 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARAL 597
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG  GTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600

Query: 598 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 657
           IKKPT+LILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIVLGH
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660

Query: 658 DGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVXXXXXXXXXXXXXXHDQRNE 717
           DGSVVEMGKFK+LY+NPTSALSQLLNER AP PS+QQQQ+               D  N+
Sbjct: 661 DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIEKDNENEESTEEKAPDHSNK 720

Query: 718 XXXXXXXXXXXXXKPLESKD---KKSDDIEESVEHVLKDAAKEANPIKLSPPP 767
                           +S++   K SDDIEESVEH+L+DAAKEA PIKL+P P
Sbjct: 721 NDNDDNDNNHDNDSNKQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/730 (63%), Positives = 540/730 (73%), Gaps = 21/730 (2%)

Query: 48  LCTRPAPISKSLLSQFVRFNSTKTQQD-IPP----LPSTSASKQPAKPAYQSKSDDYKDI 102
           L T+P   +K  L    RFNST    D IPP      ST AS +P +        ++KD+
Sbjct: 108 LKTKPFNCNKVAL----RFNSTTNTTDTIPPHTESTESTKASTEPNEIEPDQGESNFKDV 163

Query: 103 IRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIP---I 159
            RLF+L K+D+K           SC+IGM IPK+IG++LD LK+ + +       P   +
Sbjct: 164 FRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALKSVATTPDGGSSPPPTIM 223

Query: 160 FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
           F L LYEFL  F+VAL IGC AN+GR ILLRILSER+VARLR+ V+K TLHQD+EFFD H
Sbjct: 224 FGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVH 283

Query: 220 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXX 279
           KVGDLISRLG+D+Y+VSRS+TQK+SDGVK+LICG VG+GMM  LS               
Sbjct: 284 KVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVV 343

Query: 280 XXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ 339
             AS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G++TVQSFVAE  E+ R+N +IR+IF 
Sbjct: 344 LSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD 403

Query: 340 VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVF 399
           VG              SL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYTGNA+F
Sbjct: 404 VGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIF 463

Query: 400 GLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ 459
           GLSTFYSEIMQGAGAASRLFELTDR P+I PT+G  Y P +G IEFK+VSF+YPTRPS Q
Sbjct: 464 GLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQ 523

Query: 460 IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRR 519
           IFKSLNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+ID QDITK+N KSLRR
Sbjct: 524 IFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRR 583

Query: 520 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPN 579
            I +VQQEPVLMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHNFI KFP TYDT IGP+
Sbjct: 584 QIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643

Query: 580 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 639
           GTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI
Sbjct: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 703

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVXX 699
           AHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+++PTS LS+LLNE+     S +++ V  
Sbjct: 704 AHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTSELSKLLNEK-----SSRKKVVTK 758

Query: 700 XXXXXXXXXXXXHDQRNEXXXXXXXXXXXXXKPLESKDK----KSDDIEESVEHVLKDAA 755
                        +  +              +  ES+       +  +E+S+E VL D +
Sbjct: 759 TVPPVSSTSVSSANGSSIHHEGTILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVS 818

Query: 756 KEANPIKLSP 765
            E+ PIKLSP
Sbjct: 819 AESKPIKLSP 828

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/741 (62%), Positives = 544/741 (73%), Gaps = 35/741 (4%)

Query: 31  FRSLATTSSSHLIPIHHLCTRPAPISKSLLSQFV--RFNST-KTQQDIPPLPSTSASKQP 87
           ++S+ T  S+   P   L  +      SL SQ    R NST  TQ      PS   +  P
Sbjct: 56  YQSIRTLVSTPPSPYFLLKCKNTGTVSSLTSQLTITRLNSTVSTQSKDNKQPSLQGN--P 113

Query: 88  AKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK-- 145
              + + KS+ + D+IRLF+L K DWK           SC IGM IPKVIGI+LD+LK  
Sbjct: 114 LSTSEEPKSN-FSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQ 172

Query: 146 TSSGSDFFDLKIPI--FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAH 203
           T++ S+  +   PI  F L +YEFL  F++ALL GC+ANFGR ILLRILSER+VARLR+ 
Sbjct: 173 TATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRST 232

Query: 204 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
           VIK+T+HQDA+F+D HK GDLISRLG+DAY+VSRS+TQK+SDG K+LICG VGVGMMCSL
Sbjct: 233 VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292

Query: 264 SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
           S                 AS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G+KTVQSFVAE
Sbjct: 293 SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352

Query: 324 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 383
             E+ R+N AIR+IF VG              SL+GDLSFLTVL YGSYLVL   L+IGD
Sbjct: 353 QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412

Query: 384 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVI 443
           LTAFMLYTEYTGN++FGLSTFYSEIMQGAGAASRLFELTD  P I PT+G  Y P +G I
Sbjct: 413 LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEI 472

Query: 444 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 503
           EFK+VSFSYPTRP  QIFK+LNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+
Sbjct: 473 EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532

Query: 504 IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563
           ID QDITKMN KSLRR +GIVQQEPVLMSG+IRDNITYGLTYTPTKEEIR VAKQCFCHN
Sbjct: 533 IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592

Query: 564 FITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY 623
           FITKFP+TYDT IGP+GTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINY
Sbjct: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652

Query: 624 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLN 683
           TFGQLMK+KSMTIVSIAHRLSTIRRSENVIVLG+DGSV+EMGKFKEL+S+P+S LS+LLN
Sbjct: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLN 712

Query: 684 ERTAPVPSEQQQQVXXXXXXXXXXXXXXHDQRNEXXXXXXXXXXXXXKPLESKDKKSDDI 743
           E+++                          + +              +P+E  D     I
Sbjct: 713 EKSS----------------------RKKTKSDPISSAPEVDADATGEPVEPIDPA---I 747

Query: 744 EESVEHVLKDAAKEANPIKLS 764
           E+++  VL D   E+ PIK+S
Sbjct: 748 EDALHSVLNDVTSESKPIKMS 768

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/772 (59%), Positives = 548/772 (70%), Gaps = 36/772 (4%)

Query: 23  LVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLLSQFVRFNSTKTQQDIPPLPSTS 82
           L+  PP R + +  T + + + + H     + I +   +     N   T      + S S
Sbjct: 29  LLARPPTR-QIIHNTGAGYGVWVSHKVLTSSTIRRPFTAHRALNNEYNTTAGNASVKSQS 87

Query: 83  ASKQP-------AKPAYQSKSD------DYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSI 129
           A+K+        +K   + +S+      +++DI+RL +L +RDWK           SCSI
Sbjct: 88  ATKEKNEEDRKYSKKEKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSI 147

Query: 130 GMSIPKVIGIVLDTLKTSSGSDFFDL------KIP--IFSLPLYEFLSFFTVALLIGCVA 181
           GM+IPKVIG++LD LK +  ++  D       K+P  +F L  YEFL  F +ALL+G  A
Sbjct: 148 GMTIPKVIGLILDQLKNALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAA 207

Query: 182 NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ 241
           N+GR ILLR+LSER+VARLRA VIKKT+HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQ
Sbjct: 208 NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQ 267

Query: 242 KVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATG 301
           KVSDG KALICG VG+GMM +LSPQ               ASVFGKQI  TS++LQEATG
Sbjct: 268 KVSDGFKALICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATG 327

Query: 302 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 361
            LT+VAEEQLSGIKTVQSFVAE  E++RYN AIRDIF +G              S +GDL
Sbjct: 328 HLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDL 387

Query: 362 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 421
           SFLTVL +GSYLVLQ+ L+IGDLTAFM+YTEYTGN++FGLSTFYSEIMQGAGAASRLFEL
Sbjct: 388 SFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 447

Query: 422 TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSG 481
           TDR PSIS T G KYKP  G IEFK+VSF+YPTRPS  IFK+LNFKI  GS+VCIVGPSG
Sbjct: 448 TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSG 507

Query: 482 RGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 541
           RGKST+ALLL +YY P++G I+ID Q+I  +N KSLRRHIG+VQQEP+LMSGTIRDNI Y
Sbjct: 508 RGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVY 567

Query: 542 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKP 601
           GLT  PTK+EIR VAKQCFCHNFIT+F ++YDTVIGP+GTLLSGGQKQRIAIARALIKKP
Sbjct: 568 GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKP 627

Query: 602 TVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
            +LILDEATSALDVESEGAINYTFGQLMK K MTIVSIAHRLSTIRRSENVIVLGHDGSV
Sbjct: 628 RILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSV 687

Query: 662 VEMGKFKELYSNPTSALSQLLNERT----------APVPSEQQQQVXXXXXXXXXXXXXX 711
           VEMGKFKEL+ +PTS LSQLLNE++           P P+   ++V              
Sbjct: 688 VEMGKFKELWDDPTSELSQLLNEKSTPHQTTNITVTPPPTTMAEKVVEEVVENAEPETVI 747

Query: 712 HDQRNEXXXXXXXXXXXXXKPLESKDKKSDDIEESVEHVLKDAAKEANPIKL 763
            D  +                 E  +  ++ IE+++E+V+KD   E  P+KL
Sbjct: 748 EDPGSPPMYISTVSEVSA----EGHELINEQIEDTIENVMKDVTSERKPLKL 795

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/757 (60%), Positives = 539/757 (71%), Gaps = 57/757 (7%)

Query: 32  RSLATTSSSHLIPIHHLCTRPAPISKSLLSQF-----VRFNS--TKTQQDIPPLPSTSAS 84
           R L   S S L P+ ++  RP  I +  +S       VR+NS  + +Q++  P P     
Sbjct: 10  RILRPLSKSQLRPLSYI--RPLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPV---- 63

Query: 85  KQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTL 144
           KQ  +P  Q K   YKD +RLF LAKRDW+           SC IGMSIPKVIG+VLD L
Sbjct: 64  KQILEP-IQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVL 122

Query: 145 KTS-SGSDFFDLKI----PI-FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVA 198
           +    G D  ++ +    PI F L +Y+FL  F   LL+G  ANF R ++LRILSERVVA
Sbjct: 123 RKGIEGKDLQNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVA 182

Query: 199 RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 258
           RLR+ V+ KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+G
Sbjct: 183 RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242

Query: 259 MMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 318
           MM S+SP+               ASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQ
Sbjct: 243 MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQ 302

Query: 319 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ 378
           SFVAE  EL RYN AIR I+ VG              ++LGD+SF+ VL YGSYLVLQ  
Sbjct: 303 SFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGS 362

Query: 379 LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP 438
           L+IGDLTAFMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P
Sbjct: 363 LTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP 422

Query: 439 DRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 498
            +G IEFK+VSFSYPTRP  QIFK +N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNPT
Sbjct: 423 GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482

Query: 499 TGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 558
            G I++D QDI+K+NCK+LRRHIG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQ
Sbjct: 483 NGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQ 542

Query: 559 CFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
           CFCHNFITKFP+ YDT+IG  G LLSGGQ+QRIAIARALIKKP +L+LDEATSALDVESE
Sbjct: 543 CFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESE 602

Query: 619 GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSAL 678
           GAINYTFGQLMKS SMTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL++NP S L
Sbjct: 603 GAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662

Query: 679 SQLLNERTA----------PVPSEQQQQVXXXXXXXXXXXXXXHDQRNEXXXXXXXXXXX 728
            +LL E+++          P P+  Q +V               +Q  E           
Sbjct: 663 CKLLTEKSSRSDGNDSLPPPPPNATQDKVV--------------EQIAE----------- 697

Query: 729 XXKPLESKDKKSDDIEESVEHVLKDAAKEANPIKLSP 765
             K LE   +     + +V+ + KD + E  PIK++P
Sbjct: 698 --KILERFPEAGQSPDATVKEIFKDVSSEGKPIKITP 732

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/637 (67%), Positives = 502/637 (78%), Gaps = 19/637 (2%)

Query: 65  RFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYK--DIIRLFMLAKRDWKXXXXXXXX 122
           RFNST T++            Q +       +D ++  D+ RL  LAKRDWK        
Sbjct: 75  RFNSTNTKE------------QESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISL 122

Query: 123 XXXSCSIGMSIPKVIGIVLDTLK-TSSGSDFFDLKIP--IFSLPLYEFLSFFTVALLIGC 179
              SC IGMS+PK+IGIVLD LK   S  DF    +P   F L LYEF+S   V+LL+G 
Sbjct: 123 LSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGT 182

Query: 180 VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 239
            AN+GR ILLR+LSERVVARLRA+VIKKT+HQDAEFFDN+KVGDLISRL SDAYVVSRS+
Sbjct: 183 AANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSL 242

Query: 240 TQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEA 299
           TQKVSDG KA++CG VG+GMM S+SPQ               AS FG+ IRN S+DLQEA
Sbjct: 243 TQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEA 302

Query: 300 TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLG 359
           TG LT+VAEEQ SGIKTVQSFVAE  E+ RYN AIR IF VG              ++LG
Sbjct: 303 TGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLG 362

Query: 360 DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 419
           D+SFL VLAYGSYLVL   LSIGDLTA+M+YTEYTG+++FGLSTFYSEIMQGAGAASRLF
Sbjct: 363 DMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLF 422

Query: 420 ELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGP 479
           ELTDR PSISPT+G K+ P++G IEFK+VSFSYPTR S QIFK+L+FKI  GS+VCIVGP
Sbjct: 423 ELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGP 482

Query: 480 SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 539
           SGRGKSTIA LLLRYYNPTTG I +D QDI+K++ KSLRRH+ IVQQEPVLMSGTIRDNI
Sbjct: 483 SGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI 542

Query: 540 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIK 599
           TYGL   PT++E+RS+ K+CFCHNFITKFPN+YDT++GP+GTLLSGGQKQRIAIARALIK
Sbjct: 543 TYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIK 602

Query: 600 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 659
           KPT+LILDEATSALDVESEGAINYTFG+LMKSKS+TI+SIAHRLSTIRRSENVIVLG+DG
Sbjct: 603 KPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDG 662

Query: 660 SVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQ 696
           SV E+GKFKELY++P S LS+LL+E+     SE+QQ 
Sbjct: 663 SVAEVGKFKELYADPGSELSKLLHEKAT--RSERQQN 697

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/688 (63%), Positives = 511/688 (74%), Gaps = 35/688 (5%)

Query: 86  QPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK 145
           Q   P    +    KD++RL MLAK DWK           SC IGM+IPKVIG++LD LK
Sbjct: 78  QAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLK 137

Query: 146 T----SSGSD----FFDLKIPIF-SLPLYEFLSFFTVALLIGCVANFGRFILLRILSERV 196
           T    + G D      D+  PIF    +YEFL  F   ++ G VAN+GR +LLRILSERV
Sbjct: 138 TGLETNEGKDGPISMADVP-PIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERV 196

Query: 197 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVG 256
           VARLRA+VIKKT+HQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG
Sbjct: 197 VARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVG 256

Query: 257 VGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 316
           VGMM S+SPQ               AS+FG++IR+TS DLQEATGQLTRV+EEQLSG++T
Sbjct: 257 VGMMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRT 316

Query: 317 VQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ 376
           VQSFVAE  E+ RY+ AIRDIF VG              S LGD+SFL VLAYGSYLVLQ
Sbjct: 317 VQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ 376

Query: 377 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 436
             L+IGDLTAFMLYTEYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G K+
Sbjct: 377 GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKF 436

Query: 437 KPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 496
            P +G I FKDV+FSYPTRP   IF+ ++ KI  GS+VC+VGPSGRGKSTIALLLLR+YN
Sbjct: 437 VPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496

Query: 497 PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
           P++G I ID QDI+K+N KSLRRHIG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR VA
Sbjct: 497 PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVA 556

Query: 557 KQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616
           KQCFCHNFI KFP+ YDTVIGP G LLSGGQKQRIAIARALIKKPT+L+LDEATSALDVE
Sbjct: 557 KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616

Query: 617 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
           SEGAINYTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+++P+S
Sbjct: 617 SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSS 676

Query: 677 ALSQLLNERTAPVPSEQQQQVXXXXXXXXXXXXXXHDQRNEXXXXXXXXXXXXXKPLESK 736
            LS+LLNE+++       +                 D+ N+              P E+ 
Sbjct: 677 ELSKLLNEKSS-------RSENSSSSYSPNASEQPEDEANQKNA-----------PEEAH 718

Query: 737 DKKSDDIEESVEHVLKDAAKEANPIKLS 764
           D       +SVE +LKD   E  PIK+S
Sbjct: 719 D-------DSVEEILKDVTAEGKPIKIS 739

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/656 (65%), Positives = 494/656 (75%), Gaps = 20/656 (3%)

Query: 51  RPAPISKSLLSQFVRFNSTKTQQDIPPLPST------SASKQPAKPAYQSKS-DDYKDII 103
           RP+ +   +L++ + F +   + +   +  T      S+SK  A      KS +D  DI 
Sbjct: 19  RPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKTTAPQVRVPKSRNDGNDIK 78

Query: 104 RLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT--SSGSDF----FDLKI 157
           RL  LAK+DWK           SC+IGMS+PKVIG+VLD LK   S   D      DL I
Sbjct: 79  RLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSI 138

Query: 158 ------PI-FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLH 210
                 PI F L LYEFL     ALLIG  ANFGR +LLR+LSERVVARLR+ VIKKT+H
Sbjct: 139 ESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIKKTIH 198

Query: 211 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXX 270
           QDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+CG VGVGMM S+SP+    
Sbjct: 199 QDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPELSAF 258

Query: 271 XXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 330
                      +  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE  E+ RY
Sbjct: 259 LLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRY 318

Query: 331 NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 390
           N  I+D++ VG              S LGD+SFL VLAYGSYLVL   LSIGDLTA+M+Y
Sbjct: 319 NNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMY 378

Query: 391 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSF 450
           TE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G IEFK+VSF
Sbjct: 379 TELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVSF 438

Query: 451 SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 510
           +YPTRP  QIFKSLNFKI PGS+VCIVGPSGRGKSTIA LLL+YY PT GTI +D QDI+
Sbjct: 439 AYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDIS 498

Query: 511 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 570
           K+N KSLRRHIGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHNFITKFP+
Sbjct: 499 KLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPD 558

Query: 571 TYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMK 630
            Y T++GPNGTLLSGGQKQRIAIARAL+KKP VLILDEATSALDVESE AINYTFG+LMK
Sbjct: 559 QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMK 618

Query: 631 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERT 686
            K +TI+SIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ NP S LSQLLNE++
Sbjct: 619 KKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/634 (65%), Positives = 494/634 (77%), Gaps = 16/634 (2%)

Query: 79  PSTSASKQPAKPAYQSKSDDYK----DIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIP 134
           PS+  S  P K  Y  +++D K    ++ RL ++  RDWK           SCSIGM+IP
Sbjct: 121 PSSIRSPPPNKTNYSPRAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIP 180

Query: 135 KVIGIVLDTLK-----TSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILL 189
           KVIG+VLD LK     + S  +  DL    F L LY FL  F  AL+IG + N+GR+ILL
Sbjct: 181 KVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILL 240

Query: 190 RILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA 249
           R+LSERVVARLR+HVIKKTLHQDAEFFD +KVGDLISRLGSDAYVVSRS+TQKVSDG KA
Sbjct: 241 RLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKA 300

Query: 250 LICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEE 309
           ++CG  G+GMM S+SPQ               AS+FGK+IR+ S  LQEATGQLTRV+EE
Sbjct: 301 ILCGGAGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEE 360

Query: 310 QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAY 369
           QL+G+KTVQSFVAE  E+ RYN AIRDI+ +G              S++GD+SFL VLAY
Sbjct: 361 QLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAY 420

Query: 370 GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS 429
           GSYLVL   L+IGDLTAFMLYT+YT N++FGLS FYSEIMQG GAA RLF+LTDR P+I 
Sbjct: 421 GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIR 480

Query: 430 PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 489
           PT+G K+ P  G IEF+++ F+YPTRP  Q+FK+LNFKI PG+SVCIVGPSGRGKSTIAL
Sbjct: 481 PTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL 540

Query: 490 LLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 549
           LLLRYYNP++G I+IDNQDI K+N KSLR+++GIVQQEPVLMSG+IRDNITYGL    T 
Sbjct: 541 LLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATP 600

Query: 550 EEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEA 609
           +EIR V+KQCFCHNFITKFP+ Y+T+IGP+GTLLSGGQKQRIAIARALIKKP +LILDEA
Sbjct: 601 DEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA 660

Query: 610 TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 669
           TSALDVESEGAINYTFG+LMKSKS+TIVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKE
Sbjct: 661 TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE 720

Query: 670 LYSNPTSALSQLLNE-------RTAPVPSEQQQQ 696
           LY++PTS LS+LLNE       + AP+P +   +
Sbjct: 721 LYADPTSELSKLLNEKQSRANKKEAPLPPQSDGE 754

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/620 (66%), Positives = 485/620 (78%), Gaps = 9/620 (1%)

Query: 85  KQPAKPAYQSKSDD--YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD 142
           KQPA   +    D+  YKDI RLF+L K DWK           SC IGM IPKVIG VLD
Sbjct: 72  KQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLD 131

Query: 143 TLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRA 202
           +LK   G +F +L I  + + L  F    +  LL+GC AN+ R ILLRILSE +VA+LRA
Sbjct: 132 SLKDIQGKEFSELMI--WDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRA 189

Query: 203 HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 262
           +VIK  +HQDA+FFD +KVGDLISR+G+DA++VSRS+TQK+SDGVKA+  G  GVGMM S
Sbjct: 190 NVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLS 249

Query: 263 LS-PQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFV 321
           +S P                A VFGKQIR+ SK LQE T  LTRV+EEQ +GIKT+QSFV
Sbjct: 250 ISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFV 309

Query: 322 AEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSI 381
           AE +E+ ++N +IR IF VG              S++GDLSFL VL+YGS+LV Q QLS+
Sbjct: 310 AEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSV 369

Query: 382 GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG 441
           GDLTAFMLYTEYTGNA+F LS F+SEIMQGAGAASR+FELTD KP I+PT G K+ P +G
Sbjct: 370 GDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKG 429

Query: 442 -VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500
             IEFK+VSF+YPTRP+V IF++LNFKI  GS+VCIVGPSG+GKSTIA LLL YYNP+ G
Sbjct: 430 GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQG 489

Query: 501 TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 560
            I+ID QDI+ ++ KSLRRHIGIVQQEP+LMSGTIRDNITYGLTYTPTKEEIRSVAKQCF
Sbjct: 490 QILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 549

Query: 561 CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA 620
           CHNFIT+FP+TYDT IGP+GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA
Sbjct: 550 CHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA 609

Query: 621 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQ 680
           INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG+DGSVVE GKFKEL++NP S LS+
Sbjct: 610 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSK 669

Query: 681 LLNERTA---PVPSEQQQQV 697
           LL E+++     P  Q Q++
Sbjct: 670 LLREKSSGNNAAPEIQPQEI 689

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/603 (65%), Positives = 471/603 (78%), Gaps = 5/603 (0%)

Query: 99  YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD-----FF 153
           YK+I RLF LA+ DWK           SCSIGM++PKVIG+VLD  K +  SD       
Sbjct: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183

Query: 154 DLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDA 213
           DL   ++ L LY+FL+ F  AL++   ANFGR +LLRIL E++VARLR++VIKKT+HQDA
Sbjct: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243

Query: 214 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXX 273
           EFFD +KVGDLISRL SDAYVVSRSMTQ +SDG KA+ICG VG+GMM  +S         
Sbjct: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATALFL 303

Query: 274 XXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 333
                   A+++G++IR+ S+DLQ++TG LT+VAEEQLSG+KTVQSFVAE  E+ RYN A
Sbjct: 304 FAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363

Query: 334 IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 393
           IR +F VG              S+LGD SFL VLAYGS+LVLQ  LSIGDLTAFMLYTEY
Sbjct: 364 IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423

Query: 394 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYP 453
           +G+AVFGLS FYSE+M+GAGAASRLFELTD +PSI  T G  Y P +G I+F++VSFSYP
Sbjct: 424 SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYP 483

Query: 454 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
           TR + QIF +LNF I  GS+VC+VGPSGRGKSTIA LLL+YYNPT+G I ID QDI+K++
Sbjct: 484 TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543

Query: 514 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 573
            KSLRRH+G+VQQEP+LMSG+IRDNITYG+ YTPT +EIRSV+K+CFCHNFITKF + Y+
Sbjct: 544 AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603

Query: 574 TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKS 633
           TVIGP G LLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYT GQLMKS+ 
Sbjct: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQ 693
           +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKELY++  S L +LLNE+     S+ 
Sbjct: 664 ITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKM 723

Query: 694 QQQ 696
             +
Sbjct: 724 NAE 726

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/640 (62%), Positives = 477/640 (74%), Gaps = 8/640 (1%)

Query: 62  QFVRFNSTKTQQDIPPLPSTSASKQPAK-PAYQSKSDDYKDIIRLFMLAKRDWKXXXXXX 120
           Q  R  S KT +     P+   S++       +S +  YK++IRLF LA  DWK      
Sbjct: 101 QLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAI 160

Query: 121 XXXXXSCSIGMSIPKVIGIVLDTLKTSSGS-----DFFDLKIPIFSLPLYEFLSFFTVAL 175
                S  IGMSIPKVIG+VLD +K +  S        DL   +  L +YEFL  F  AL
Sbjct: 161 GLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGAL 220

Query: 176 LIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVV 235
           +IG VANFGR +LLR+L E++VARLR++VI+K +HQDAEFFD +KVGDLISRL SDAYVV
Sbjct: 221 VIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVV 280

Query: 236 SRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKD 295
           SRSMTQ VSDG KA+ICG VG+GMM ++S                 A ++GK+IR  S+D
Sbjct: 281 SRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIGALIYGKRIRMISRD 340

Query: 296 LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXX 355
           LQE+TG LTRV+EEQLSG+KT+QSFVAEG EL RYN AIR +F  G              
Sbjct: 341 LQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSST 400

Query: 356 SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 415
           ++LGDLSFL VLAYGS+LVLQ  L++GDLTAFMLYTEYTG+AVFGLS FYSE+M+GAGAA
Sbjct: 401 NVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAA 460

Query: 416 SRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 475
           SRLFE+TD  PSI PT G  Y P  G I FKDVSFSYPTRP  QIF  LNF I PGS+VC
Sbjct: 461 SRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVC 520

Query: 476 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTI 535
           IVGPSGRGKSTI  LLLRYYNP++G I ID+QDI++++CKSLRRH+G+VQQEP+LMSG+I
Sbjct: 521 IVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI 580

Query: 536 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595
           + N+TYGL    + +EIRSVAK+CFCH F+TKFPN YDT+IGP G  LSGGQKQRIAIAR
Sbjct: 581 KYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIAR 640

Query: 596 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
           AL+KKP +LILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVL
Sbjct: 641 ALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVL 700

Query: 656 GHDGSVVEMGKFKELYSNPTSALSQLLNE--RTAPVPSEQ 693
           G+DGSVVE+GKFK+LY++  S L +LLN+  R  P P  Q
Sbjct: 701 GNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQ 740

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/702 (58%), Positives = 507/702 (72%), Gaps = 20/702 (2%)

Query: 5   RLPL-FRLGVYRNVLSRSR-LVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPIS--KSLL 60
           RLPL  +L  +R  LS  +  + L P R+       ++H  P+  L  RP  +     + 
Sbjct: 14  RLPLGVQLLSWRRGLSGVQAFIHLSPARYHG-----ATHR-PLG-LLQRPTQLDLRNPVS 66

Query: 61  SQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSD-DYKDIIRLFMLAKRDWKXXXXX 119
           S F+R++S  +     P  S  +  +    + + KS  +Y++I+RL  LA+ DWK     
Sbjct: 67  SSFIRYHSQNSPNSSTPSSSNDSGGKANNESTEEKSKTNYREILRLIRLARHDWKLLSVA 126

Query: 120 XXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS-----DFFDLKIPIFSLPLYEFLSFFTVA 174
                 S ++GM+IPKVIGIVLD +K +SG         DL   I+ L +++FL+ F   
Sbjct: 127 IGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGI 186

Query: 175 LLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 234
           L+ G +ANFGR +LLR+L E++VARLR++VIKK +HQDAEFFD +KVGDLISRL SDAYV
Sbjct: 187 LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYV 246

Query: 235 VSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSK 294
           VSRSMTQ VSDG KA+ICG VG+GMM ++S                 A ++GK+IR  S+
Sbjct: 247 VSRSMTQNVSDGFKAIICGGVGIGMMINISASLTSALFLFAPPLLVGALIYGKKIRMISR 306

Query: 295 DLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXX 354
           +LQE+TG LT+V+EEQLSG+KT+Q+FVAEG EL RYN AIR +F  G             
Sbjct: 307 ELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSS 366

Query: 355 XSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGA 414
             +LGDLSFL VLAYGS+LVLQ  LS+GDLTAFMLYTEYTG+AVFGLS FYSE+M+GAGA
Sbjct: 367 TGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 426

Query: 415 ASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSV 474
           ASRLFE+TD    I P+ G  Y P  G I+F+DVSFSYPTRP  QIF  LNF I PGS+V
Sbjct: 427 ASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNV 486

Query: 475 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGT 534
           C+VGPSGRGKSTIA LLLRYY+P +G IMID Q+I+K++CKSLRRH+G+VQQEP+LMSG+
Sbjct: 487 CVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGS 546

Query: 535 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIA 594
           IR N+TYG+    T +EIRSVAK+CFCH FITKFP  Y+TVIGP G  LSGGQKQRIAIA
Sbjct: 547 IRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606

Query: 595 RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 654
           RALIKKP +LILDEATSALDVESEGAINYT G+LM+S+ +TI+SIAHRLSTIRRSENVIV
Sbjct: 607 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666

Query: 655 LGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQ 696
           LG+DGSVVEMGKFKELY+N  S L +LLN++    P++ Q Q
Sbjct: 667 LGNDGSVVEMGKFKELYANDQSELFKLLNDKK---PTQLQSQ 705

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/648 (60%), Positives = 477/648 (73%), Gaps = 24/648 (3%)

Query: 65  RFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXX 124
           R    + ++ +   P+  +  QPAKPA       + ++ RL  L K DWK          
Sbjct: 75  RDKEHEQERKVEKRPAEPSRAQPAKPA------GWHEVFRLLRLVKPDWKLLLAALGLLT 128

Query: 125 XSCSIGMSIPKVIGIVLDTLK----------TSSGSDFFDLKIPIFSLPLYEFLSFFTVA 174
            SCSIGM++PKVIG+VLD  K          T +     D+   I +  L + L+ F  A
Sbjct: 129 ISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGA 188

Query: 175 LLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 234
           LL+G  ANFGR  LL++L ER+VARLRA VIKKTLH DAEFFD +KVGDLISRLGSDAY+
Sbjct: 189 LLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYI 248

Query: 235 VSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSK 294
           VSRSMT  +SDGVKA +CG VGVGMM  +S                 A+++GK+IR  S+
Sbjct: 249 VSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISR 308

Query: 295 DLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXX 354
           +LQ++TG LTRV+EEQ +GIKT++SFVAEG E+ RYN A+R +F V              
Sbjct: 309 ELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSG 368

Query: 355 XSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGA 414
            ++LGD+SFL VLAYGS+LVLQ +LS+G LTAFMLYTEYTG++VFGLS FYSE+M+GAGA
Sbjct: 369 TNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGA 428

Query: 415 ASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSV 474
           ASRLFELTD K S+  TVG  + P  G IEFKDVSFSYPTRP+ QIFK L   I PGS+V
Sbjct: 429 ASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNV 488

Query: 475 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGT 534
           CIVGPSGRGKSTIA LLLR+Y+  +GTI+ID QDI+K++ KSLR+H+G+VQQEPVLMSGT
Sbjct: 489 CIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGT 548

Query: 535 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIA 594
           IRDNITYGL+YTP+ +EIR+VAK+CFCHNFITKFP+ YDTVIGP G LLSGGQ+QRIAIA
Sbjct: 549 IRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIA 608

Query: 595 RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 654
           RALIKKP +LILDEATSALDVESEGAINYT G+LM+SK +TIVSIAHRLSTIRRSEN++V
Sbjct: 609 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVV 668

Query: 655 LGHDGSVVEMGKFKELYSNPTSALSQLLNE--------RTAPVPSEQQ 694
           LG+DGSV+E GKF +LY +  S L +LLNE          +P P++++
Sbjct: 669 LGNDGSVIEAGKFADLYRDEDSELFKLLNEHASEPAKPEASPAPAQEE 716

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/616 (62%), Positives = 466/616 (75%), Gaps = 17/616 (2%)

Query: 85  KQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT- 143
           K+  KP+  + S    D+ RLF LA+ DWK           SC+IGM++PKVIG+VLD  
Sbjct: 99  KKTNKPS-STVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDAT 157

Query: 144 ---------------LKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFIL 188
                          L+ S      DL   +  + LY+F   F  ALLIG +ANFGR +L
Sbjct: 158 KNALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVL 217

Query: 189 LRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVK 248
           L+IL ER+VARLR++VIKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDG K
Sbjct: 218 LKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFK 277

Query: 249 ALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAE 308
           ALICG VG+GMM  +S                 A+++G +IR  S++LQ+A+G LT+VAE
Sbjct: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337

Query: 309 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLA 368
           EQLSGIKTVQSFVAEG E+ RYN A+R +F VG              ++LGD SFL VLA
Sbjct: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLA 397

Query: 369 YGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 428
           YGS+LVLQ  L+IGDLTAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLFEL D KP+I
Sbjct: 398 YGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTI 457

Query: 429 SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIA 488
             T G  +KP  G +EF+ VSFSYPTR + QIFK LNF I PGS+VCIVGPSGRGKSTIA
Sbjct: 458 KSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIA 517

Query: 489 LLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT 548
            LLLRYYNPT+G I++D QDITK++ KSLRR +G+VQQEP+LMSGTIR+NITYG++  P+
Sbjct: 518 SLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPS 577

Query: 549 KEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDE 608
            EEIRSVAK+CFCH FI+KFPN Y+T+IGP G LLSGGQKQRIAIARAL+ KP +LILDE
Sbjct: 578 MEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDE 637

Query: 609 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 668
           ATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFK
Sbjct: 638 ATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFK 697

Query: 669 ELYSNPTSALSQLLNE 684
           +LY+N  SAL +LL E
Sbjct: 698 DLYANHDSALHKLLTE 713

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/622 (59%), Positives = 456/622 (73%), Gaps = 25/622 (4%)

Query: 99  YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF------ 152
           +++++RL  LAK DWK           SC+IGM++PKVIG+VLD  K +  S +      
Sbjct: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156

Query: 153 ------------------FDLKIPIF-SLPLYEFLSFFTVALLIGCVANFGRFILLRILS 193
                              D   PI  +L + +F+  F  AL++G  ANFGR +LL+I+ 
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 194 ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 253
           ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG KA+ICG
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 254 VVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 313
            VG+GMM  +S                 A ++GK+I   S+ LQ+++G LTRVAEEQL+G
Sbjct: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336

Query: 314 IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 373
           I+T++SFVAE  E+ RYN AIR +F VG              ++LGD+SF+ VL YG+ L
Sbjct: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANL 396

Query: 374 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 433
           VLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K S+   + 
Sbjct: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456

Query: 434 HKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493
           H   P +G IEF+DVSFSYPTRPS QIFK ++F I PGS+VCIVGPSG+GKSTI  LLLR
Sbjct: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516

Query: 494 YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
           +Y+P  G+I+IDN DI+K   KSLRRH+G+VQQEP LMSGTIRDNITYGL+YTPT +EIR
Sbjct: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576

Query: 554 SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
            V+KQCFCH FITKFP+ YDTVIGP G  LSGGQ+QRIAIARALIKKP +LILDEATSAL
Sbjct: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636

Query: 614 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +LY N
Sbjct: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696

Query: 674 PTSALSQLLNERTAPVPSEQQQ 695
             S L +LLNE+   + S+ + 
Sbjct: 697 EESELFKLLNEKDHDLVSKSEN 718

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/779 (53%), Positives = 511/779 (65%), Gaps = 49/779 (6%)

Query: 5   RLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLLSQFV 64
           +L L R  + R+ L+ S L  +P IR  S +  S     P      RP            
Sbjct: 3   KLCLPRTTLLRSQLAGSNLRIIPSIRLLSYSRPS-----PFPSNSPRPT----------- 46

Query: 65  RFNSTKTQQDIPP--LPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXX 122
           R  +  ++ +  P  LP      +  K A       ++D+ RL +L K+D K        
Sbjct: 47  RCLTVPSRTNFIPRTLPQFLVPHRTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVL 106

Query: 123 XXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVAN 182
              SCSIGM+IPK+IG +LDTL+ +  +     +I I ++PL  FL    + L+ GC AN
Sbjct: 107 LTISCSIGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFAN 166

Query: 183 FGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQK 242
           FGR ++LRI+SER+V+RLR+ V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T K
Sbjct: 167 FGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHK 226

Query: 243 VSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQ 302
           V+DGV++   G+ G+G+M +LS +                SVFGKQIR  SK LQ+ TG 
Sbjct: 227 VADGVRSGFIGIFGIGLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD 286

Query: 303 LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS 362
           LTRV EEQ +GI+TVQ FVAE NE+ R+N  +R+IFQVG              SL+GDL 
Sbjct: 287 LTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLG 346

Query: 363 FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 422
           FL VL YGSYLV+   +SIGDLTAFMLYTEYTGNA+FGLS+FYSE+MQG GAASR+FE+ 
Sbjct: 347 FLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN 406

Query: 423 DRKPSISPTVGH-KYKPDRGV----IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 477
           D++P I  T G  K+KP   V    IEFK+VSF YPTRP+ QIFK+LNFK+  GS+VCIV
Sbjct: 407 DKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIV 466

Query: 478 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 537
           GPSGRGKSTIA LLL +YN  +G I+ID QDI  +N KSLRR IGIVQQEP+LMSGTIRD
Sbjct: 467 GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526

Query: 538 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD--TVIGPNGTLLSGGQKQRIAIAR 595
           NITYGLT  P+KEEIR VAKQCFCHNFITKFP+TYD     G +GT LSGGQKQRIAIAR
Sbjct: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIAR 586

Query: 596 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
           ALIKKP +LILDEATSALDVESEGAINYTFGQ+MKSKSMTIVSIAHRLSTIRR E+VIVL
Sbjct: 587 ALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVL 646

Query: 656 GHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVXXXXXXXXXXXXXXHDQR 715
           G+DGSVVEMGKFKELY NPTS LS+LLNE+++   +  Q                  +  
Sbjct: 647 GNDGSVVEMGKFKELYDNPTSELSKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKEAD 706

Query: 716 NEXXXXXXXXXXXXXKPLESKDKKSDDIEESV---------EHVLKDAAKEANPIKLSP 765
           N                 E    K DD +E V         +  LK+A  E  PIK++P
Sbjct: 707 NAS---------------EENGAKLDDSKEDVSVPDNMTSSDDSLKEAVNEGGPIKITP 750

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  525 bits (1351), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 285/695 (41%), Positives = 421/695 (60%), Gaps = 34/695 (4%)

Query: 22  RLVKLPPI----------RF----RSLATTSSSHLIPIHHLCTRPAPISKSLLSQFVRFN 67
           RLV++ PI          R+    +++    + ++I +H    R   +SKS++ Q  RFN
Sbjct: 3   RLVRVHPILKPSYTRSFHRYQHPLKAIQLIQTKNIINLHASFNRS--VSKSMILQQTRFN 60

Query: 68  ST-KTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXS 126
           ST ++ + I    + +  K     + +S +  +KD+ RLF LAK +             S
Sbjct: 61  STNESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTLAKPETAYIVLALVLILIS 120

Query: 127 CSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIP-------------IFSLPLYEFLSFFTV 173
            ++ M +P VIG +LD    +S  D  D K               I+     +F +   +
Sbjct: 121 STVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDNNTIYGFTHTQFFAGLGI 180

Query: 174 ALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAY 233
             +IG +AN GR ++L++  E++VARLR   +K  L QDA F D+++VGDLISRL SDA 
Sbjct: 181 VFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLISRLSSDAS 240

Query: 234 VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTS 293
           +V++S+T  VSDG +A++ G VG  MM  +S +               A V+GK+IRN S
Sbjct: 241 IVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYGKKIRNLS 300

Query: 294 KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 353
           + LQ A G LT+VAEEQL+  KT+Q++  E  E+ RY   +RD+F VG            
Sbjct: 301 RQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAITSGIFFG 360

Query: 354 XXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG 413
              L+G+ + L++L  G+ ++    L++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAG
Sbjct: 361 STGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAG 420

Query: 414 AASRLFELTDRKPSISPTVGHKYKPDRG-VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 472
           AA+R+FEL DRKP I PT+G      +G  I F+DVSF YPTRP+ ++F  ++FKI PG 
Sbjct: 421 AAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKISFKIEPGE 480

Query: 473 SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMS 532
            +C VGPSG GKST++ LLLRYY+ T G I+I   +I  ++ +  R+ +G+VQQEP+L +
Sbjct: 481 HICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPMLFN 540

Query: 533 GTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQR 590
           GTI DNI Y +       K ++    K+  C  F+  FP+  +T++GP GT LSGGQKQR
Sbjct: 541 GTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQLSGGQKQR 600

Query: 591 IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 650
           IAIAR+ +  P++L+LDEATSALD +SE  I  T  +  +++ +T +SIAHRLSTI+ S 
Sbjct: 601 IAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHRLSTIKYSS 659

Query: 651 NVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNER 685
            V+VL  +GSVVE GKF EL +NPTS L+ LL++ 
Sbjct: 660 RVVVLNKNGSVVETGKFTELIANPTSELNLLLSKE 694

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  518 bits (1335), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 282/617 (45%), Positives = 387/617 (62%), Gaps = 15/617 (2%)

Query: 94  SKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTS------ 147
           SKS  +KDI RLF LA+ + +           S S+ M++P +IG +LD  K        
Sbjct: 89  SKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEE 148

Query: 148 SGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKK 207
             S      I  F L   +F +   V  L+G +AN GR I+L++  ER+VARLR   +K 
Sbjct: 149 EDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKA 208

Query: 208 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQX 267
            L QDA F D ++VGDLISRL SDA +VS+++TQ VSDG +A+I G VG GMM  LS + 
Sbjct: 209 ALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKL 268

Query: 268 XXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNEL 327
                         A V+G++IRN SK LQE+ G L++VAEEQL+  KT+Q++V E  E+
Sbjct: 269 TGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEI 328

Query: 328 SRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAF 387
            RY   +R++F++G               L+G+++ +++L  G+ ++    L++G+L++F
Sbjct: 329 HRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSF 388

Query: 388 MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VIEFK 446
           M+Y  YTG+++FGLS+FYSE+M+GAGAASR+FEL DRKP I  TVG   K   G  I+F+
Sbjct: 389 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFE 448

Query: 447 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 506
           +VSF+YP+RP+ +IF +LN +I PG  VCIVG SG GKSTIA LLLRYY+   G+I I +
Sbjct: 449 NVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGD 508

Query: 507 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG----LTYTPTKEEIRSVAKQCFCH 562
            DI   + +  RR IG VQQEP L +G+I DNI Y     LT     E ++   KQ  C+
Sbjct: 509 NDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCN 568

Query: 563 NFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 622
            F+ KFP+   T++GP G  LSGGQKQRIA+ARA +  PT+LILDE+TSALD  SE  + 
Sbjct: 569 IFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVA 628

Query: 623 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLL 682
            T  Q   ++ +T +SIAHRLSTI+ S  VIV+G  GSVVE G F  L  NP S L+ LL
Sbjct: 629 KTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLL 687

Query: 683 ---NERTAPVPSEQQQQ 696
              NE     PS+++Q+
Sbjct: 688 SQQNEHIDEDPSQEKQE 704

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  513 bits (1320), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 289/680 (42%), Positives = 404/680 (59%), Gaps = 28/680 (4%)

Query: 28  PIRFR-----SLATTSSSHLIPIHHLCTRP-----APISKSLLSQFVRFNSTKTQQDIPP 77
           P+ FR     +L    S+    +H++  R      AP  +  + + VR+NST   Q  P 
Sbjct: 8   PLSFRFPINTTLRRLHSTRFNAVHYMIDRQWMKTVAPKIQLTVERQVRWNST---QRAPV 64

Query: 78  LPSTSASKQPAKPAYQSKSD----DYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSI 133
             +++AS    K A  S SD     +KDI RLF LAK +             S ++ M+I
Sbjct: 65  NVNSNASVTAVKEAKLSPSDLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTI 124

Query: 134 PKVIGIVLDTLKTSSGSDFFDLKI---PIFSLPLYEFLSFFTVALLIGCVANFGRFILLR 190
           P ++G +LD  K    +D          IF +   +F +      L+G  AN GR ++L+
Sbjct: 125 PTIVGKLLDIAKDRKDADDTTEDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILK 184

Query: 191 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 250
           I  ER+VARLR   +K  L QDA F D ++VGDLIS L SDA +V++S+TQ VSDG +A+
Sbjct: 185 ITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAV 244

Query: 251 ICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQ 310
           I G VG GMM  +S Q               A V+G++IRN S+ LQ + G LT+V+EEQ
Sbjct: 245 IQGFVGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQ 304

Query: 311 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 370
           L  +KT+QS+V E  E+ RY   +R++F +G               L+G++S L +L  G
Sbjct: 305 LGAVKTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVG 364

Query: 371 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 430
           + ++    +++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I P
Sbjct: 365 TNMIQNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPP 424

Query: 431 TVGHK-YKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 489
           T+G          I F++VSF+YPTR + +IF  L+  + PG  VCIVGPSG GKST+A 
Sbjct: 425 TIGQDPVTLANKTIRFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVAS 484

Query: 490 LLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 549
           LLLRYY+   G IMI + +I   N +  RR +GIVQQEP L +GTI DNI Y  T  P +
Sbjct: 485 LLLRYYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILY--TVPPER 542

Query: 550 EE----IRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI 605
            +    I +   Q  C  F+  FP+   T++GP G  LSGGQKQRIA+ARA +  P++LI
Sbjct: 543 ADNDDLISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLI 602

Query: 606 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
           LDEATSALD +SE  +  T  ++   + +T +SIAHRLSTI+    V+VLG  G VVE G
Sbjct: 603 LDEATSALDSQSEEIVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESG 661

Query: 666 KFKELYSNPTSALSQLLNER 685
            F+EL  NP S LS LL+++
Sbjct: 662 PFEELLRNPLSELSILLSQQ 681

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  511 bits (1317), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/662 (44%), Positives = 400/662 (60%), Gaps = 32/662 (4%)

Query: 44  PIHHLCTRPAPISKSLLSQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDII 103
           PI  + TRP  +S  LL Q  R N T T+QD   L +    K      + SK+  +KDI 
Sbjct: 52  PIPRIQTRPPALSHQLL-QARRLN-TSTEQDQKTLQTLKTLKLSP---HDSKASGFKDIK 106

Query: 104 RLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK-------TSSG-----SD 151
           RLF+LAK +             S ++ M+IP VIG +LD  K       ++SG     SD
Sbjct: 107 RLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASGEGVGSSD 166

Query: 152 FFDLKIP-----IFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIK 206
             D +       I+ L   +F +      ++G  AN GR +LL++  E++VARLR   +K
Sbjct: 167 SSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKLVARLRTRTMK 226

Query: 207 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 266
             L QDA F DN++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GMM  +S +
Sbjct: 227 AALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVGFGMMSFISWK 286

Query: 267 XXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 326
                          A V+GK+IRN S+ LQ + G LT+VAEEQLS  +TVQ++  E  E
Sbjct: 287 LTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAARTVQAYGGEKQE 346

Query: 327 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 386
           + RY   +R++F +G                +G+++ L +L  G+ ++    +++GDL++
Sbjct: 347 IRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRSGAITVGDLSS 406

Query: 387 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VIEF 445
           FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G      +G  IEF
Sbjct: 407 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDPVTLQGKTIEF 466

Query: 446 KDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           ++V+F+YPTR   +IF  L+  I PG  VCIVGPSG GKSTIA LLLRYY+   G I I 
Sbjct: 467 RNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYYDVDAGRIAIG 526

Query: 506 NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHN 563
            QDI + N +  RR +G+VQQEP+L +GTI DNITY +      ++ R      Q  C  
Sbjct: 527 GQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRVSRAIGQANCTK 586

Query: 564 FITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY 623
           F+  FP+  +T++GP G  +SGGQKQRIA+ARA +  P VLILDEATSALD +SE  +  
Sbjct: 587 FLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVV-- 644

Query: 624 TFGQLMKSKSM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQ 680
              Q ++S+S    T VSIAHRLSTI+ S  VIVL   G V E G F+EL S+P S L+Q
Sbjct: 645 --AQSLRSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELISDPDSHLTQ 702

Query: 681 LL 682
           LL
Sbjct: 703 LL 704

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  511 bits (1315), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 284/640 (44%), Positives = 391/640 (61%), Gaps = 24/640 (3%)

Query: 57  KSLLSQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXX 116
           K+LLSQ +R  S+  +      P+   S         SKS  +KDI RLF+L++ + K  
Sbjct: 50  KALLSQSIRLQSSIAEGKASTKPTLKLSDA------NSKSSGFKDIKRLFVLSRPESKYI 103

Query: 117 XXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF----DLKIPIFSLPLYEFLSFFT 172
                    S S+ M++P VIG +LD    S   +      D K+  + L   +F +   
Sbjct: 104 GLALLLILISSSVSMAVPSVIGKLLDVASESDDEEDEEKARDSKL--YGLTKKQFFTALG 161

Query: 173 VALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDA 232
           +  +IG VAN  R I+L+I  ER+VARLR   +K  L QDA F D ++VGDLISRL SDA
Sbjct: 162 LVFVIGAVANASRIIILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDA 221

Query: 233 YVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNT 292
            +V++S+TQ VSDG +A+I G VG GMM  LS +               A V+GK+IRN 
Sbjct: 222 SIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKIRNL 281

Query: 293 SKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXX 352
           S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY   +R++F +G           
Sbjct: 282 SRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFF 341

Query: 353 XXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA 412
               L+G+ + L++L  G+ ++    ++IG+L++FM+Y  YTG+++FGLS+FYSE+M+GA
Sbjct: 342 GSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGA 401

Query: 413 GAASRLFELTDRKPSISPTVGH-----KYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFK 467
           GAA+R+FEL DRKP I PT+G       +KP    + FK+VSF+YPTRP  QIFK LN  
Sbjct: 402 GAAARVFELNDRKPLIHPTIGKDPISLAHKP----VVFKNVSFTYPTRPKHQIFKDLNIT 457

Query: 468 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQE 527
           I PG  VC VGPSG GKSTIA LLLRYY+  +G+I  D++D+   N +  RR IG VQQE
Sbjct: 458 IKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQE 517

Query: 528 PVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSG 585
           P+L +GTI DNI Y +     + E R     +Q  C  F+  FP+   T++G  G  LSG
Sbjct: 518 PLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCTKFLANFPDGLQTMVGARGAQLSG 577

Query: 586 GQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 645
           GQKQRIA+ARA +  P +LILDEATSALD +SE  +     Q    + +T +SIAHRLST
Sbjct: 578 GQKQRIALARAFLLDPALLILDEATSALDSQSEEIVAKNL-QKRVERGLTTISIAHRLST 636

Query: 646 IRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNER 685
           I+ S  +IVLG  GSVVE G F++L + P S L+ LL E+
Sbjct: 637 IKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNALLAEQ 676

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  511 bits (1315), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 283/652 (43%), Positives = 402/652 (61%), Gaps = 20/652 (3%)

Query: 48  LCTRPAPISKSLLSQFVRFNST----KTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDII 103
           L  +P  I +  L +  R+NS+    K ++  PP PS    K   +    SKS+  KDI 
Sbjct: 43  LVRQPLGIRRKTL-EIRRWNSSIVDVKKKRSSPP-PSIEVQKLSNEV---SKSNGMKDIK 97

Query: 104 RLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDL-----KIP 158
           RLF LAK + K           S S+ M+IP +IG +LD  K  +  +  D      K+ 
Sbjct: 98  RLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNAKKEKLM 157

Query: 159 IFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDN 218
           IF L   +F +      L G +AN  R ++L++  ER+VARLR   +K  L+QDA F D 
Sbjct: 158 IFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDASFLDT 217

Query: 219 HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXX 278
           ++VGDLISRL SDA +V++++TQ VSDG +A+I G VG GMM  +S +            
Sbjct: 218 NRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMIMVPPL 277

Query: 279 XXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 338
              A V+G++IR  S+ LQ + G LT+VAEEQL+  +T+Q++  E  E+ RY   +R +F
Sbjct: 278 GVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATEVRKVF 337

Query: 339 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 398
            VG               L+G+++ +++L  G+ ++    L++GDL++FM+Y  YTG+++
Sbjct: 338 DVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVYTGSSL 397

Query: 399 FGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VIEFKDVSFSYPTRPS 457
           FGLS FYSE+M+GAGAA+R+FEL DRKP I PT+G+  K   G  IEF++VSF+YPTRP+
Sbjct: 398 FGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSIEFQNVSFAYPTRPT 457

Query: 458 VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSL 517
             I  +L+  I PG  VCIVGPSG GKST++ LLLRYY+ +TG+I ID Q+I + N +  
Sbjct: 458 HSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEFNLRKY 517

Query: 518 RRHIGIVQQEPVLMSGTIRDNITYGL----TYTPTKEEIRSVAKQCFCHNFITKFPNTYD 573
           RR +G+VQQEP+L +GTI DNI Y +    T T    +++   +Q  C  F+  FP   +
Sbjct: 518 RRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNFPEGVN 577

Query: 574 TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKS 633
           T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     + ++   
Sbjct: 578 TLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVE-LG 636

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNER 685
           +T +SIAHRLSTI+ S  VIVL   GSVVE G F+EL     S L+ LL+++
Sbjct: 637 LTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQQ 688

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  509 bits (1311), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 281/633 (44%), Positives = 382/633 (60%), Gaps = 24/633 (3%)

Query: 66  FNSTKTQQDIPPLPSTSASKQPAKPAYQ-----SKSDDYKDIIRLFMLAKRDWKXXXXXX 120
             S + Q DI      +  K+  KP  +     SKS  +KDI RLF+L+K + K      
Sbjct: 54  LRSIRLQSDI------AQGKKSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLAL 107

Query: 121 XXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKI-PIFSLPLYEFLSFFTVALLIGC 179
                S S+ M++P VIG +LD    S G D    K   ++     +F +      +IG 
Sbjct: 108 LLILISSSVSMAVPSVIGKLLDLASESDGEDEEGSKSNKLYGFTKKQFFTALGAVFIIGA 167

Query: 180 VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 239
           VAN  R I+L++  ER+VARLR   +K  L QDA F D ++VGDLISRL SDA +V++S+
Sbjct: 168 VANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSV 227

Query: 240 TQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEA 299
           TQ VSDG +A+I G VG GMM  LS +               A ++G++IRN S+ LQ +
Sbjct: 228 TQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTS 287

Query: 300 TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLG 359
            G LT+VAEEQL+  +T+Q++  E NE+ RY   +R++F +G               L+G
Sbjct: 288 VGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVG 347

Query: 360 DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 419
           + + L++L  G+ ++    +++G+L++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+F
Sbjct: 348 NTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVF 407

Query: 420 ELTDRKPSISPTVGH-----KYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSV 474
           EL DRKP I PT+G        KP    I FK+VSF+YPTRP  QIFK LN  I PG  V
Sbjct: 408 ELNDRKPLIRPTIGKDPVSLAQKP----IVFKNVSFTYPTRPKHQIFKDLNITIKPGEHV 463

Query: 475 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGT 534
           C VGPSG GKSTIA LLLRYY+  +G+I   ++DI   N +  RR IG VQQEP+L +GT
Sbjct: 464 CAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGT 523

Query: 535 IRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
           I DNI Y +        + IR    +  C  F+  FP+   T++G  G  LSGGQKQRIA
Sbjct: 524 ILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIA 583

Query: 593 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
           +ARA +  P VLILDEATSALD +SE  +     Q    +  T +SIAHRLSTI+ S  V
Sbjct: 584 LARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRVERGFTTISIAHRLSTIKHSTRV 642

Query: 653 IVLGHDGSVVEMGKFKELYSNPTSALSQLLNER 685
           IVLG  GSVVE G F++L + P S L+ LL E+
Sbjct: 643 IVLGKHGSVVETGSFRDLIAIPNSELNALLAEQ 675

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  506 bits (1304), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 280/641 (43%), Positives = 386/641 (60%), Gaps = 20/641 (3%)

Query: 54  PISKSLLSQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDW 113
           P  K  LSQ +R  S+ ++      P+   S         SKS  +KDI RLF+L+K + 
Sbjct: 47  PYRKQFLSQSIRLQSSVSEGKTFTKPTLKLSDA------NSKSSGFKDIKRLFVLSKPES 100

Query: 114 KXXXXXXXXXXXSCSIGMSIPKVIGIVLD--TLKTSSGSDFFDLKIPIFSLPLYEFLSFF 171
           K           S S+ M++P VIG +LD  +       +       ++ L   +F +  
Sbjct: 101 KYIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEEKEEKAKSNKLYGLTKRQFFTAL 160

Query: 172 TVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 231
            +  +IG VAN  R I+L++  ER+VARLR   +K  L QDA F D ++VGDLISRL SD
Sbjct: 161 GLVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSD 220

Query: 232 AYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRN 291
           A +V++S+TQ VSDG +A+I G VG GMM  LS +               A ++G++IRN
Sbjct: 221 ASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRN 280

Query: 292 TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 351
            S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY   +R++F +G          
Sbjct: 281 LSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLF 340

Query: 352 XXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQG 411
                L+G+ + L++L  G+ ++    +++G+L++FM+Y  YTG+++FGLS+FYSE+M+G
Sbjct: 341 FGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKG 400

Query: 412 AGAASRLFELTDRKPSISPTVGH-----KYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNF 466
           AGAA+R+FEL DRKP I PT+G        KP    I FK+VSF+YPTRP  QIFK LN 
Sbjct: 401 AGAAARVFELNDRKPLIRPTIGKDPVSLAQKP----IVFKNVSFTYPTRPKHQIFKDLNI 456

Query: 467 KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ 526
            I PG  VC VGPSG GKSTIA LLLRYY+  +G+I   ++DI   N +  RR IG VQQ
Sbjct: 457 TINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQ 516

Query: 527 EPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
           EP+L +GTI DNI Y +     ++E R      Q  C  F+  FP+   T +G  G  LS
Sbjct: 517 EPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLS 576

Query: 585 GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 644
           GGQKQRIA+ARA +  P VLILDEATSALD +SE  +     Q    + +T +SIAHRLS
Sbjct: 577 GGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRVERGLTTISIAHRLS 635

Query: 645 TIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNER 685
           TI+ S  V+VLG  GSVVE G F++L + P S L+ LL E+
Sbjct: 636 TIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLAEQ 676

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  507 bits (1305), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 263/607 (43%), Positives = 374/607 (61%), Gaps = 16/607 (2%)

Query: 93  QSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF 152
           +S    +KD+ RLF LA+ +             S ++ M +P VIG +LD  K  S  + 
Sbjct: 91  ESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADEE 150

Query: 153 F------------DLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARL 200
                        D    I+ L   +F +   V   +G +AN GR I+L++  ER+VARL
Sbjct: 151 NGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVARL 210

Query: 201 RAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM 260
           R   +K  L Q+A F D++KVGDLISRL +DA +V++S+TQ VSDG +A++ G VG GMM
Sbjct: 211 RTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGMM 270

Query: 261 CSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSF 320
             +S Q               A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++
Sbjct: 271 SYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAY 330

Query: 321 VAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS 380
             E  E+ RY   +R++F +G               L+G+ + L++L  G+ ++    L+
Sbjct: 331 GGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGALT 390

Query: 381 IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR 440
           +G+L++FM+Y  YTG+++FGLSTFYSE+M+GAGAA+R+FEL+DRKP+I PT+G       
Sbjct: 391 VGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITLF 450

Query: 441 G-VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 499
           G  +EFK+VSF YPTRP  QIF+  + KI PG  VC VGPSG GKST++ LLLRYY+   
Sbjct: 451 GKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAK 510

Query: 500 GTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE--EIRSVAK 557
           G+I++  +DI   + +  RR +G+VQQEP+L +GTI +NI Y +      E   I    +
Sbjct: 511 GSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAIE 570

Query: 558 QCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES 617
              C  F+  FP+  +T++GP GT LSGGQKQRIA+AR  +  P++LILDEATSALD +S
Sbjct: 571 SANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQS 630

Query: 618 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSA 677
           E  I     Q    K  T +SIAHRLSTI+ S  V+VLG +G VVE G F+EL SNP+S 
Sbjct: 631 EDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSSG 689

Query: 678 LSQLLNE 684
           L+ LL +
Sbjct: 690 LNILLTQ 696

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  504 bits (1297), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 267/617 (43%), Positives = 380/617 (61%), Gaps = 16/617 (2%)

Query: 83  ASKQPAKPA------------YQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIG 130
           A+K+  KP+            + SK+  ++DI RLF+LAK + +           S ++ 
Sbjct: 55  AAKKQGKPSLTATVKGLRLSPHDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVS 114

Query: 131 MSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLR 190
           M++P VIG +LD  +        + +  IF L   +F +      ++G +AN GR ++L+
Sbjct: 115 MAVPTVIGKLLDIAREEHEQPETEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILK 174

Query: 191 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 250
           +  ER+VARLR   +K  L QDA F D+++VGDLISRL SDA +VS+S+TQ +SDG +A+
Sbjct: 175 VTGERLVARLRTRTMKAALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAV 234

Query: 251 ICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQ 310
           I G VG GMM  +S +               A V+GK+IRN S+ LQ + G+LT+V+EEQ
Sbjct: 235 IQGFVGFGMMSFISWKLTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQ 294

Query: 311 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 370
           LS  KT+Q++  E  E+ RY   +R +F VG                +G+++ L +L  G
Sbjct: 295 LSATKTIQAYCGEKKEIHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTG 354

Query: 371 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 430
           + ++    +++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I P
Sbjct: 355 TSMIKTGLMTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHP 414

Query: 431 TVGHK-YKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 489
           T+G      +   I F  V FSYPTRP   IF+ LNF + PG  VCIVGPSG GKST+A 
Sbjct: 415 TIGKDPVTLENKSIHFNHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVAS 474

Query: 490 LLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 549
           LLLRYY+  +G I + N +I   N +  RR +G+VQQEP+L SGTI DNITY +      
Sbjct: 475 LLLRYYDIGSGEIKLGNDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVN 534

Query: 550 EEIR--SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
           +E R      Q  C  F+  FP+   T +GP GT LSGGQKQRIA+ARA +  P++LILD
Sbjct: 535 DETRISRAIGQANCTKFLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILD 594

Query: 608 EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 667
           EATSALD +SE  +  +  Q   ++  T +SIAHR+STI+ S  VIVL   G+V E G F
Sbjct: 595 EATSALDSQSEEVVAQSLQQ-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSF 653

Query: 668 KELYSNPTSALSQLLNE 684
            +L + P S+L++LL++
Sbjct: 654 DKLIAIPDSSLNKLLSK 670

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  501 bits (1289), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 277/604 (45%), Positives = 378/604 (62%), Gaps = 20/604 (3%)

Query: 94  SKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF 153
           SKS  +KDI RLF+L++ +             S S+ M++P VIG +LD        +  
Sbjct: 80  SKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDA 139

Query: 154 ----DLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTL 209
               D K+  + L   +F +      LIG +AN  R I+L++  ER+VARLR   +K  L
Sbjct: 140 KETKDNKL--YGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKAAL 197

Query: 210 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXX 269
            QDA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +   
Sbjct: 198 DQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTC 257

Query: 270 XXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 329
                       A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ R
Sbjct: 258 VMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRR 317

Query: 330 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 389
           Y   +R++F VG               L+G+ + L++L  G+ ++    +++G+LT+FM+
Sbjct: 318 YAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSFMM 377

Query: 390 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIE 444
           Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G       +KP    I 
Sbjct: 378 YAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKP----IV 433

Query: 445 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 504
           FKDVSF+YPTRP  QIFK LN  I PG  VC VGPSG GKSTIA LLLRYY+ + G+I  
Sbjct: 434 FKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDF 493

Query: 505 DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFC 561
            ++DI   N +  RR +G VQQEP+L +GTI DNI Y +     ++E R VA+   Q  C
Sbjct: 494 GDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQANC 552

Query: 562 HNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 621
             F+  FP+   T++G  G  LSGGQKQRIA+ARA +  P VLILDEATSALD +SE  +
Sbjct: 553 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVV 612

Query: 622 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
                + +K + +T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L S P S L+ L
Sbjct: 613 AKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNAL 671

Query: 682 LNER 685
           L E+
Sbjct: 672 LAEQ 675

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  496 bits (1276), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 271/636 (42%), Positives = 383/636 (60%), Gaps = 20/636 (3%)

Query: 65  RFNSTKTQQDIPPLPSTSASKQPAKPAYQSK-SDDYKDIIRLFMLAKRDWKXXXXXXXXX 123
           R+NS+  +Q  P   +T  + Q A+ +   K S  ++DI RL  LA+ +           
Sbjct: 57  RWNSSNAKQ--PNTTNTDKTGQIAELSSNEKNSSGFRDITRLLGLARPEVWYIMGALCLI 114

Query: 124 XXSCSIGMSIPKVIGIVLDTLKTSSGSD-------------FFDLKIPIFSLPLYEFLSF 170
             S ++ M +P VIG +LD  K+SS S+                 +  I+     +F   
Sbjct: 115 VISSTVSMLLPSVIGKLLDLAKSSSPSENEKQESGDGDDKDKDKEEGTIYGFTPKQFCVI 174

Query: 171 FTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 230
                + G  AN GR I+L++  ER+VARLR   +K  L QD+ F D ++VGDLISRL S
Sbjct: 175 MGGIFVAGAFANCGRIIILKVTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLSS 234

Query: 231 DAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIR 290
           D+ +V++S+TQ VSDG +A+I G VG GMM  +S Q               A ++GK+IR
Sbjct: 235 DSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIR 294

Query: 291 NTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 350
           N SK LQ + G LT+VAEEQL   KT+QS+V E  E+ RY   +R +F +G         
Sbjct: 295 NLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGM 354

Query: 351 XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ 410
                  +G++S L +L  G+ ++    +++GDL++FM+Y  YTG ++FGLS FYSE+M+
Sbjct: 355 FFGSTGFVGNISLLALLMSGASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMK 414

Query: 411 GAGAASRLFELTDRKPSISPTVGHKYKPDRGV-IEFKDVSFSYPTRPSVQIFKSLNFKIA 469
           GAGAA+R+FEL DRKP+I+PT+G      R + I FKDVSF+YPTR + +IF  LN  I 
Sbjct: 415 GAGAAARVFELNDRKPAIAPTLGKGPTSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQ 474

Query: 470 PGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV 529
           PG  +CI GPSG GKSTIA LL+RYY+   G I I + D+   N +  RR IG+V QEPV
Sbjct: 475 PGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPV 534

Query: 530 LMSGTIRDNITYGLTYTPTKEEIRSVAK--QCFCHNFITKFPNTYDTVIGPNGTLLSGGQ 587
           L +GTI +NI Y +  +  ++E R  A   +  C  F++ FP+  +T++GP G  LSGGQ
Sbjct: 535 LFNGTILENILYAVPPSVAQDERRVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQ 594

Query: 588 KQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 647
           KQR+A+ARA +  P +L+LDEATSALD +SE  +  T  + ++ + +T +SIAHR+STI 
Sbjct: 595 KQRVALARAFLLDPALLVLDEATSALDSQSEEIVARTLQERVR-RGLTTISIAHRISTIA 653

Query: 648 RSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLN 683
            S  V+VLG DG VVE G F+EL   P S L+ LL+
Sbjct: 654 HSTRVVVLGRDGFVVESGPFQELIDRPNSELNYLLS 689

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  494 bits (1273), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 278/663 (41%), Positives = 399/663 (60%), Gaps = 11/663 (1%)

Query: 27  PPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLLSQFVRFNSTKTQQDIPPLPSTSASKQ 86
           P +R++S+   S S L PI    ++   + KS +    R+ ++   + +PP  +++  + 
Sbjct: 13  PLLRYQSI---SLSGLSPIRGRLSQV--VLKSEIHVQRRWQNSINVRGVPPSEASNRLQV 67

Query: 87  PAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT 146
                  SK   +K++ RLF LA+ + K           S ++ M+IP VIG +LD  K 
Sbjct: 68  LRLSGADSKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKE 127

Query: 147 --SSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHV 204
             + G    + +  I+ L   +F +      +IG  AN GR ++L++  E++VARLR   
Sbjct: 128 KEAGGDGDEEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKT 187

Query: 205 IKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS 264
           +K  L QDA F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I G+VG GMM  +S
Sbjct: 188 MKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYIS 247

Query: 265 PQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG 324
            Q               A V+G++IRN +++LQ   G LT+VAEEQL+  +T+QS+  E 
Sbjct: 248 AQLTGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGER 307

Query: 325 NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 384
            E+ RY   +R +F+VG               L+G+++ L +L  G+ ++    +++G+L
Sbjct: 308 KEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGEL 367

Query: 385 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YKPDRGVI 443
           ++FM+Y  YTG+++FGLS+FYSE+M+GAGAASR+FEL DR P I PT G          I
Sbjct: 368 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEI 427

Query: 444 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 503
           EFK+V FSYP+R +  +F  LN KI PG  VC+VGPSG GKSTI+ LLLR+Y+  +G I 
Sbjct: 428 EFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVIT 487

Query: 504 IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFC 561
           I  Q+I   N +  RR +GIVQQEP+L +G+I+DNI Y L       K  +    +   C
Sbjct: 488 IGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANC 547

Query: 562 HNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 621
             FI+ FP+  DT++GP GT LSGGQKQRIAIARA I  P++LILDEATSALD +SE  I
Sbjct: 548 TRFISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDII 607

Query: 622 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
                   +S  +TI SIAHR+STI  S  VIVL  +G V E G F +L + P S L++L
Sbjct: 608 AQALRARSESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKL 666

Query: 682 LNE 684
           L++
Sbjct: 667 LSK 669

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  484 bits (1246), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 291/715 (40%), Positives = 410/715 (57%), Gaps = 52/715 (7%)

Query: 3   NGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLLSQ 62
           N RLP+ R G+ R  L          ++ RSL    +S    +  +       +++++ Q
Sbjct: 14  NARLPILRAGIGRPSL---------LLQVRSLHNGKTSFERQLAAMLQ-----NRTIMRQ 59

Query: 63  FVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXX 122
            VR+  +   +     PST+ + +      +  S  +KDI RLF LA+ + K        
Sbjct: 60  -VRWQHSNASK-----PSTTLTSE------EQNSSSWKDIKRLFQLARPESKSMFFALVL 107

Query: 123 XXXSCSIGMSIPKVIGIVLDTLK----TSSGSDF----------------FDLKIPIFSL 162
              S S+ M +P VIG ++D  K    +SS +D                  D +  I  L
Sbjct: 108 IILSSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGL 167

Query: 163 PLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 222
            L +F        ++G  AN GR ++L++  E++VARLR   +K  L QDA F DN+KVG
Sbjct: 168 TLPQFYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVG 227

Query: 223 DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXA 282
           DLISRL SDA +VS+S+TQ +SDG ++LI G VG GMM  +S +               A
Sbjct: 228 DLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMA 287

Query: 283 SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 342
            V+G++IRN S+ LQ + G LT+ AEEQLS  +T+Q++  E   +  Y   +R ++QVG 
Sbjct: 288 LVYGRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGL 347

Query: 343 XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 402
                         L+G+ + L +L  G+ ++    +++GDL++FM+Y  YTG+++FG+S
Sbjct: 348 KEALTSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMS 407

Query: 403 TFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YKPDRGVIEFKDVSFSYPTRPSVQIF 461
           +FYSE+M+GAGAA+R+FEL DRKP+I PT G       R  +EFK V F+YPTR    IF
Sbjct: 408 SFYSELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIF 467

Query: 462 KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHI 521
           + L+ +I PG  VCIVGPSG GKST+A LLLR+Y+   G I+I  Q+I   N +  RR +
Sbjct: 468 EDLSLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLV 527

Query: 522 GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFCHNFITKFPNTYDTVIGP 578
           GIVQQEP+L +GTI +NI Y +      EE   VA+   Q  C  F++ FP+   T++GP
Sbjct: 528 GIVQQEPMLFNGTILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGP 587

Query: 579 NGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 638
            GT LSGGQKQRIA+ARA +  P +LILDEATSALD  SE  I  T      ++  T +S
Sbjct: 588 RGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVIARTL-HSRTTRGKTTIS 646

Query: 639 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPV-PSE 692
           IAHR+STI+ S  VIVLG +G VVE G F EL SN  S L++LL +   PV P E
Sbjct: 647 IAHRVSTIQHSTRVIVLGRNGGVVETGTFDELASNTDSQLNKLLRKEEEPVQPGE 701

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  481 bits (1237), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 270/651 (41%), Positives = 381/651 (58%), Gaps = 19/651 (2%)

Query: 44  PIHHLCTRPA-PISKSLLSQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQ-----SKSD 97
           P +HL  R     S S   Q  R NST         P  S  ++P +   +       + 
Sbjct: 29  PFNHLHQRTRFSFSASTRIQ-TRLNSTAN-------PRASTEEKPHQERLELSTATGNAS 80

Query: 98  DYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKI 157
             KD+ RLF LA+ + K           S ++ M+IP VIG +LD  +     +  D + 
Sbjct: 81  GAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQESGDEEE 140

Query: 158 PI-FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF 216
            + + LP  +F    +    +G +AN GR ++L+   ER+VARLR   +K  L Q+  F 
Sbjct: 141 AVLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFL 200

Query: 217 DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXX 276
           D+++VGDLISRL SDA +VS+S+TQ  SDG +A+I G VG GMM  +S Q          
Sbjct: 201 DSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAP 260

Query: 277 XXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 336
                A+ +G+++RN S++LQ   G LT+VAEEQL+  +TVQ++  E  E+ RY   +R+
Sbjct: 261 PLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRN 320

Query: 337 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 396
           +F VG                +G+ + L +L  G+ ++    +S+G+L++FM+Y  YTG+
Sbjct: 321 VFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGS 380

Query: 397 AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VIEFKDVSFSYPTR 455
           ++F LS+FYSE+M+GAGAA R+FEL DRKP I PT+G       G  I F  V+F+YPTR
Sbjct: 381 SLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTR 440

Query: 456 PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCK 515
           P  Q+F  ++  I PG  VCIVGPSG GKST+A LLLR+Y+P +G+I I  +DI   N  
Sbjct: 441 PHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLS 500

Query: 516 SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYD 573
             RR +GIVQQEPVL + +I +NITY L    TK+  R     +   C  F+  FP    
Sbjct: 501 KYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQ 560

Query: 574 TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKS 633
           T +GP GT LSGGQKQR+A+ARA ++ P +LILDEATSALD +SE  +  T  Q  +   
Sbjct: 561 TAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAK 620

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
           +TI SIAHR STI+ S  VIVL   G V+E G +++L  +P S+LS LL++
Sbjct: 621 ITI-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGLLSK 670

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  480 bits (1235), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 276/657 (42%), Positives = 395/657 (60%), Gaps = 50/657 (7%)

Query: 54  PISKSLLSQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDW 113
           PIS   +S+ +R+N  +++Q     PS++ + +      +  S  +KDI RLF LA+ + 
Sbjct: 50  PISLIHVSRQIRWNHAESRQ-----PSSTLTPE------EHNSSSWKDIKRLFQLARPES 98

Query: 114 KXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK------------------TSSGSDFFDL 155
           +           S S+ M +P VIG ++D  K                   + G   F L
Sbjct: 99  RSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQASKLVENDSDAAAPDADGRQIFGL 158

Query: 156 KIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 215
            +P F    Y  L  F+V  ++G  AN GR ++L++  E++VARLR   +K +L QDA F
Sbjct: 159 TMPQF----YGVL--FSV-FVVGAAANMGRIVILKVTGEKLVARLRTRTLKASLQQDASF 211

Query: 216 FDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXX 275
            DN+KVGDLISRL SDA +VS+S+TQ +SDG ++LI G VG GMM  +S +         
Sbjct: 212 LDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLA 271

Query: 276 XXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 335
                 A ++GK+IRN S+ LQ + G LT+ AEEQLS  +T+Q++  E + + +Y   +R
Sbjct: 272 PPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVR 331

Query: 336 DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 395
            ++QVG               L+G+++ L +L  G+ ++    +++GDL++FM+Y  YTG
Sbjct: 332 QVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTG 391

Query: 396 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG-----HKYKPDRGVIEFKDVSF 450
           +++FG+S+FYSE+M+GAGAA+R+FEL DR+P+I PT G        KP    +EF++V F
Sbjct: 392 SSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLAGKP----VEFQNVKF 447

Query: 451 SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 510
           +YPTR    IF++L F+I  G  VCIVGPSG GKST+A LLLR+Y+  TG I I  Q I 
Sbjct: 448 AYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDTGAITIGGQSIA 507

Query: 511 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFCHNFITK 567
             N +  RR +G+VQQEP+L +GTI DNI Y +  +   +E R VA+   Q  C  F++ 
Sbjct: 508 SFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENR-VARAIGQANCSAFLSS 566

Query: 568 FPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQ 627
           FP+   T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD  SE  +      
Sbjct: 567 FPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVVARALYS 626

Query: 628 LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
              ++  T +SIAHR+STI+ S  VIVLG  G VVE G F EL S+P S L+ LL +
Sbjct: 627 -RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDPDSQLNLLLRK 682

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  457 bits (1176), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/611 (42%), Positives = 362/611 (59%), Gaps = 23/611 (3%)

Query: 76  PPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPK 135
           P +   S++K   K     K+  +  + +L  LAK + K           S ++ MS+P 
Sbjct: 13  PVIHRNSSTKTDLK-----KTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPS 67

Query: 136 VIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSER 195
           VIG ++D   T           PI+ L   +FL       ++G +AN GR I+L+I  E+
Sbjct: 68  VIGTLIDHASTPDA--------PIYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEK 119

Query: 196 VVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVV 255
           +VARLR   +K  L QDA F D H+VGDLISRL SDA +VS+S+T  +SDG +A + GVV
Sbjct: 120 LVARLRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVV 179

Query: 256 GVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 315
           G+GMM  +S +               A ++G +I+  S+ LQ+  GQL++ +EEQL+ +K
Sbjct: 180 GIGMMTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLK 239

Query: 316 TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL 375
           TVQ++  E  EL RY+  +R +F +G               L+G+++ + +L  G+    
Sbjct: 240 TVQAYAGERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA--- 296

Query: 376 QSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG-H 434
            S +++G+L++FM+Y  YTG++VFGL+ FYSE+M+G GAA R+ EL + K  ISPT G  
Sbjct: 297 DSSITLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGIS 356

Query: 435 KYKPDRGV-IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493
             K  +G+ I F +VSF+Y    SV     +NF+I PG  VC VG SG GKSTI+ LLLR
Sbjct: 357 PPKTLKGLPITFNNVSFAYSNGKSV--LSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLR 414

Query: 494 YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
           YY   +G I I N DI+  N +  RR +G+VQQEP+L +GTI DNITYGL +  +  ++ 
Sbjct: 415 YYRTGSGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLN 473

Query: 554 SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
              K   C  FI +     DT++GP G  LSGGQ+QRIA+AR  ++ P +LILDEATSAL
Sbjct: 474 MALKAANCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSAL 533

Query: 614 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
           D +SE  IN    Q  +   MT +SIAHRLSTIR S  VIV+  DG VVE G F +L S 
Sbjct: 534 DTKSEDIINKEL-QRRQEAGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRST 591

Query: 674 PTSALSQLLNE 684
             S L++LL E
Sbjct: 592 RDSELNKLLKE 602

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  459 bits (1182), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/616 (41%), Positives = 367/616 (59%), Gaps = 31/616 (5%)

Query: 93  QSKSDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT---LKTSSG 149
            +K    +DI  LF LAK +             + ++ M +P VIG +LD    ++ +S 
Sbjct: 90  NTKGKTREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASN 149

Query: 150 SDFFD----------------LKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILS 193
            D  D                 +  I+      F S   V  ++G +AN GR I+L++  
Sbjct: 150 KDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTG 209

Query: 194 ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 253
           ER+VARLR   +K  L QD +F D++KVGDLISRL SD+ +VS ++T+ VSDG +A+I G
Sbjct: 210 ERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQG 269

Query: 254 VVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 313
            VGVGMM  +S +               A ++G++IRN SK LQE+ G LT+++EEQL+G
Sbjct: 270 CVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNG 329

Query: 314 IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 373
            +T+QS+V E  E+ +Y   +R ++ VG               L+G+ + L++L  G  +
Sbjct: 330 TRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNM 389

Query: 374 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 433
           +    LSIG L++FM+Y  YTG+++FGLS+FYSEIM+G+GAASR+FE+    P I+ T G
Sbjct: 390 ISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKG 449

Query: 434 -----HKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIA 488
                 + KP    IEF+ + F+YPTR    IF+ LN KI PG  VCI+GPSG GKSTI+
Sbjct: 450 IDPISFQDKP----IEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTIS 505

Query: 489 LLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--TYT 546
            LLLRYY+P  GTI I  +DI + + +  R+ +G+V QEPVL +GTI +NI Y +     
Sbjct: 506 SLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIA 565

Query: 547 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLIL 606
             KE + +  +   C+ F+   P   +T +GP GT LSGGQKQR+A+ARA + +PT+L+L
Sbjct: 566 NDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVL 625

Query: 607 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
           DEATSALD  SE  +  T  Q   +K  T +SIAHR+STI+ S  V+VL   G VVE G 
Sbjct: 626 DEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGP 684

Query: 667 FKELYSNPTSALSQLL 682
           ++EL     SAL++LL
Sbjct: 685 YEELLGIKDSALNKLL 700

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  201 bits (512), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/327 (38%), Positives = 181/327 (55%), Gaps = 11/327 (3%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LT + Y G   V+   LS+GDL             +  L + Y E+ Q       LF+
Sbjct: 359 SALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 418

Query: 421 LTDRKPSI----SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
           L   K +I    +P +  K KP    I+F++V+F Y   P  +I ++ NF +  G    I
Sbjct: 419 LQKNKVNIQNSKTPLMLPKDKPCE--IKFENVTFGY--HPDRKILENANFTLPAGWKTAI 474

Query: 477 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 536
           VGPSG GKSTI  L+ R+Y+P  G I+ID +DI +++ KSLRR IG+V Q+  L + TI 
Sbjct: 475 VGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFNDTIW 534

Query: 537 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARA 596
           +N+ +G   T T ++IR    +      I   P   +T++G  G ++SGG+KQR+AIAR 
Sbjct: 535 ENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQRLAIARV 593

Query: 597 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656
           L+K   ++  DEATSALD  +E A+  T  +     S T + IAHRL TI  ++ ++VL 
Sbjct: 594 LLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKIVVL- 652

Query: 657 HDGSVVEMGKFKELYSNPTSALSQLLN 683
            +G V E GK  EL S PTS  S+L N
Sbjct: 653 ENGRVKEEGKHAELLSKPTSLYSELWN 679

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  201 bits (512), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 150/515 (29%), Positives = 262/515 (50%), Gaps = 33/515 (6%)

Query: 180  VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 237
            + NF +  LL   SE  V  LR  V++K   ++ ++F  +N+K  ++ + + +D     R
Sbjct: 775  IFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDL----R 830

Query: 238  SMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQXXXXXXXXXXXXXXXASVFGKQIRNTS 293
             +   VS+ + A+     V  +G++ +L    +               ++++G  ++   
Sbjct: 831  DLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCE 890

Query: 294  KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN-ELSRYNVAIRDIFQVGXXXXXXXXXXX 352
             D + +  QL     + ++ IKT++   AE + +L+ +++ I+ + Q+            
Sbjct: 891  TDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIK-MQQIASKRAIATGFGI 949

Query: 353  XXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA 412
               +++       +  YG  LV+  + +  ++        +T  +   L +   +I +G 
Sbjct: 950  SMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQ 1009

Query: 413  GAASRLFELTDRKPSI-------SPTVG---HKY--KPDRGVIEFKDVSFSYPTRPSVQI 460
             AAS ++ + D K +        + TVG   H Y  K  + ++  ++++F+YP+ P+  +
Sbjct: 1010 RAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFV 1069

Query: 461  FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
            +K++NF +  G ++ I+G SG GKST+ LLL + YN   G I ID  D+   N  SLR+ 
Sbjct: 1070 YKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKE 1129

Query: 521  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
            I +V+Q+P+L +GTIRDN+TYGL     + E+    K    H+F+   P   DT I  + 
Sbjct: 1130 ISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRI--DT 1187

Query: 581  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVS 638
            TLLSGGQ QR+ IARAL++K  +LILDE TSALD  S   IN    +++K    ++  + 
Sbjct: 1188 TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIVKKGPPALLTMV 1243

Query: 639  IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            I H    +R   ++ VL  DG VVE G F  LY+N
Sbjct: 1244 ITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 135/513 (26%), Positives = 231/513 (45%), Gaps = 37/513 (7%)

Query: 192 LSERVVARLRAHVIKKTLHQD-AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA- 249
           + ER   R+R+ +++  L +   E++DN++      +L  D   ++R + +  S   +A 
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNE------KLLGDFTQINRCVEELRSSSAEAS 152

Query: 250 --------LICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATG 301
                    IC ++G     S S                 A VF + I   S+     T 
Sbjct: 153 AITFQNLVAICALLGTSFYYSWS--LTLIILCSSPIITFFAVVFSRMIHVYSEKENSETS 210

Query: 302 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 361
           +  ++    ++  + V+ +  +  E  ++   I +                     L   
Sbjct: 211 KAAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLT 270

Query: 362 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 421
            F+    +GS ++ + +L+I D+          G+ +         + +G  A  ++  L
Sbjct: 271 MFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTL 330

Query: 422 ----TDRKPSISPTVGHKYKPDRGV--IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 475
               + R P ++ TV H++  D     + F +VSFSYP+RPS  + K+++   + G    
Sbjct: 331 LKDGSKRNP-LNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTF 389

Query: 476 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTI 535
           IVG SG GKST++ LLLR+Y+   G+I I+  +I  ++ K L  +I +V+Q   L + T+
Sbjct: 390 IVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTL 449

Query: 536 RDNITYGLT---------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGG 586
           R NI  G T             +  I+   +      FI   P+  +T+IG  G  LSGG
Sbjct: 450 RKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGG 509

Query: 587 QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 646
           Q+QR+AIARA I+   +L LDEA SALD+     +        K K+  I++  H LS I
Sbjct: 510 QQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELSQI 567

Query: 647 RRSENVIVLGHDGSVVEMGKFKELYSNPTSALS 679
             S++ + L  +G VVE G   EL ++PT+  S
Sbjct: 568 -ESDDYLYLMKEGEVVESGTQSELLADPTTTFS 599

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  197 bits (501), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 125/325 (38%), Positives = 176/325 (54%), Gaps = 7/325 (2%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LT + Y G   V+  +LS+GDL             +  L + Y E+ Q       LF+
Sbjct: 379 SALTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQ 438

Query: 421 LTDRKPSISPTVGHKYKPDR--GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVG 478
           L   K SI  +      P      I FK+VSF Y   P   I K+ +F I  GS   IVG
Sbjct: 439 LQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVG 496

Query: 479 PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 538
           PSG GKSTI  L+ R+Y+P  G I++D +D+ +++ +SLRR IG+V Q+  L + +I DN
Sbjct: 497 PSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDN 556

Query: 539 ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALI 598
           + +G     T +EI     +      I + P   DT++G  G ++SGG+KQR+AIAR L+
Sbjct: 557 VKFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLL 615

Query: 599 KKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 658
           K   ++  DEATSALD  +E A+  T  +   + S T V IAHRL TI  ++ +IVL H 
Sbjct: 616 KDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLEH- 674

Query: 659 GSVVEMGKFKELYSNPTSALSQLLN 683
           G V E GK  EL + P S  ++L N
Sbjct: 675 GRVKEEGKHAELLATPKSLYAELWN 699

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  199 bits (506), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 152/523 (29%), Positives = 250/523 (47%), Gaps = 60/523 (11%)

Query: 180  VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR---------- 227
            + NF ++ L    SE  + +LR  V+++   ++ ++F  + HK  ++ +           
Sbjct: 748  ILNFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRA 807

Query: 228  LGSDAYVVSRSMTQKVSDGV-KALICGVVGVGMMC-SLSPQXXXXXXXXXXXXXXXASVF 285
            L SD  +   S     S G+  ALI G   + ++C S+ P                ++V+
Sbjct: 808  LASDFLIAVSSFAVVSSVGIIWALIIGW-KLSLVCISMFP-----------LIVIFSAVY 855

Query: 286  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN--------VAIRDI 337
            G  ++      + A   L  +  E  +GIKT++    E N L +Y         +A R  
Sbjct: 856  GMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRA 915

Query: 338  FQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLYTEYT 394
               G              ++L          Y   LV+  Q +   +      +L+T  T
Sbjct: 916  ITTGLGVAVIEALAMSIQAIL--------FYYALKLVIDGQYTTKKMFETLTLLLFTIMT 967

Query: 395  GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-------VIEFKD 447
             N    L +   +I +G  AA+R+ ++ D K         K +   G       VI  ++
Sbjct: 968  CNI---LISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQN 1024

Query: 448  VSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQ 507
            V+F+YP+ PS+ IF SL  ++  G +  +VG SG GKST+  LL + Y PT+GT++++N+
Sbjct: 1025 VTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENK 1084

Query: 508  DITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITK 567
            D+ + N + LRR + +V+Q P + SGT+R+N+ YGL + P + E+  V +    H+FI+K
Sbjct: 1085 DVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISK 1144

Query: 568  FPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQ 627
             P   DT I  +  LLSGGQ QR+ IARA++K+P +LILDE TSALD  S   IN    +
Sbjct: 1145 LPLGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRR 1202

Query: 628  LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
                 +   +SI H +  ++  + +I L  +G V   G F  L
Sbjct: 1203 --GCPAPLTISITHNVDMMKACDEIIFL-KNGRVAGTGSFDAL 1242

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 100/337 (29%), Positives = 177/337 (52%), Gaps = 42/337 (12%)

Query: 363 FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 422
           F+    +GS ++ + +++IGD+                ++ F+S I+ G+  +  L +L 
Sbjct: 257 FVQAFWFGSTMIRKGKMNIGDV----------------ITCFHSCILLGSTISGTLQQLV 300

Query: 423 D-RKPSISPTVGHKYKPD-------------------RGVIEFKDVSFSYPTRPSVQIFK 462
             +K S++  +  K+  D                   +G I F++V FSYP+RP   + +
Sbjct: 301 IIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLR 360

Query: 463 SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIG 522
           S++     G +  ++G SG GKS+++ LLL++Y   TG I +D ++I  ++   L ++I 
Sbjct: 361 SISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNIT 420

Query: 523 IVQQEPVLMSGTIRDNITYGLTYTPTKE---EIRSVAKQCFCHNFITKFPNTYDTVIGPN 579
           +V+Q   + +GT+++NI  G+     +E   +++ V +     NFI    +  +T+IG  
Sbjct: 421 VVEQRCNVFNGTLKENIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSG 480

Query: 580 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 639
           G  LSGGQ+Q++AIARAL+K P +LILDE+ SALDV   G I        K K+  I++ 
Sbjct: 481 GISLSGGQQQKVAIARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT- 539

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
            H L+ I  S +   L   G  +E G  + L ++P++
Sbjct: 540 -HELNQI-GSNDFCYLIESGQCIEHGLEETLVNDPST 574

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  191 bits (486), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 178/327 (54%), Gaps = 11/327 (3%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LT + Y G   V+   LS+GDL             +  L + Y E+ Q       LF+
Sbjct: 351 SALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQ 410

Query: 421 LTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
           L   K  I     P +    +P +  I F++VSF Y   P   I K+ +F +  G    I
Sbjct: 411 LQRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYD--PDRMILKNSSFTMPAGWKTAI 466

Query: 477 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 536
           VGPSG GKSTI  L+ R+Y+P  G I++D +D+ +++ +SLRR IG+V Q+  L + +I 
Sbjct: 467 VGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIW 526

Query: 537 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARA 596
           +N+ +G   + + EEIR   ++    + + + P   DT++G  G ++SGG+KQR+AIAR 
Sbjct: 527 ENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARV 585

Query: 597 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656
           L+K   ++  DEATSALD  +E A+  T      + S T V IAHRL TI  ++ +IV+ 
Sbjct: 586 LLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI- 644

Query: 657 HDGSVVEMGKFKELYSNPTSALSQLLN 683
             G V E GK  EL + P S  ++L N
Sbjct: 645 QQGQVKEEGKHAELLAKPGSLYAELWN 671

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 118/327 (36%), Positives = 180/327 (55%), Gaps = 11/327 (3%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LT + Y G+  V++  L++GDL             +  L + Y E+ Q       LF+
Sbjct: 372 SALTAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 431

Query: 421 LTDR----KPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
           L       K +  P +  ++ P    I+F++V+F Y  +P   I K+  F IAPG    I
Sbjct: 432 LQKNPILIKNTERPLMLPEHLPCE--IKFENVTFGY--QPDRNILKNATFTIAPGKKTAI 487

Query: 477 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 536
           VGPSG GKSTI  L+ R+Y+P  G I++D +DI +++   LRR +G+V Q+  L + TI 
Sbjct: 488 VGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIW 547

Query: 537 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARA 596
           +N+ +G     T  EI +  ++    + I K P   +T++G  G ++SGG+KQR+AIAR 
Sbjct: 548 ENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARV 606

Query: 597 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656
           L+K   ++  DEATSALD  +E ++  T  +     + T V IAHRL TI  ++ +IVL 
Sbjct: 607 LLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVL- 665

Query: 657 HDGSVVEMGKFKELYSNPTSALSQLLN 683
            +G+V E G    L +NP S  S+L N
Sbjct: 666 ENGAVREEGTHNALLANPNSLYSELWN 692

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  184 bits (467), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 128/393 (32%), Positives = 196/393 (49%), Gaps = 7/393 (1%)

Query: 294 KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 353
           +D  +A  +   +A + L   + V+ F  E    S+YN A+ D                 
Sbjct: 302 RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNS 361

Query: 354 XXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG 413
             +L+   +   ++  G   V+   L++GDL             +  L + Y E+ Q   
Sbjct: 362 GQNLIFTTALTGMMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 421

Query: 414 AASRLFELTDRKPSISPTVGHK--YKPDRGV-IEFKDVSFSYPTRPSVQIFKSLNFKIAP 470
               LF+L   +  I      K   K D    I F++V+F Y      +I K+ +F I  
Sbjct: 422 DMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTIPA 479

Query: 471 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVL 530
           G    IVGPSG GKSTI  L+ R+Y+P  G I+I+  D+ ++   SLR+ IG+V Q+  L
Sbjct: 480 GWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDTPL 539

Query: 531 MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQR 590
            + +I +N+ +G        EI  V ++    + I K P +Y+T++G  G ++SGG+KQR
Sbjct: 540 FNDSIWENVKFG-RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGEKQR 598

Query: 591 IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 650
           +AIAR L+K  +V+  DEATSALD  +E A+  T     K+ S T + IAHRL TI  ++
Sbjct: 599 LAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIADAD 658

Query: 651 NVIVLGHDGSVVEMGKFKELYSNPTSALSQLLN 683
            +IVL  DG+V E G   EL +  TS   +L N
Sbjct: 659 KIIVL-EDGTVREEGTHNELLAKSTSLYKELWN 690

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  187 bits (474), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 246/515 (47%), Gaps = 39/515 (7%)

Query: 182  NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSM 239
            NF +  LL   SE  +  LR  ++ K   ++  +F  +++K  ++ + + +D     R +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDL----RDL 833

Query: 240  TQKVSDGVKAL--ICGVVGVGMMCSL--SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKD 295
               VS+ + A+     V  +G++ +L    +               ++++G  ++    D
Sbjct: 834  RSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETD 893

Query: 296  LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXX 355
             + +  QL     + ++ IKT++   AE +    Y+   + + Q+               
Sbjct: 894  YKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVT 953

Query: 356  SLLGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA 412
            +++       +  YG  LVL  + +   + +    +L+T  +  ++ G      +I +G 
Sbjct: 954  NMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQ 1010

Query: 413  GAASRLFELTD-------------RKPSISPTVGHKYKPDRGV--IEFKDVSFSYPTRPS 457
             AAS ++ + D             R   IS   G +Y  DR +  I  +++SF+YP+ P+
Sbjct: 1011 RAASWIYRILDEEEDTLEIENNDARALDIS---GAEYYGDRNIPIISIRNLSFAYPSAPN 1067

Query: 458  VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSL 517
            V IFK ++  +    ++ IVG SG GKST+ALLL R YN    +I+ID  D+   N  SL
Sbjct: 1068 VPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSL 1127

Query: 518  RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 577
            R+ I +V+Q+P    G+IRDN+TYG      + EI  V K    ++F+   P   DT + 
Sbjct: 1128 RKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVD 1187

Query: 578  PNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 637
             N  LLSGGQ QR+ IARAL++K  +LILDE TSALD  S   IN    +      +  +
Sbjct: 1188 TN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVRK--GPPGLLTL 1243

Query: 638  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYS 672
             I H    +R   ++ VL H G VVE G F  LY+
Sbjct: 1244 VITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLYN 1277

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 109/348 (31%), Positives = 173/348 (49%), Gaps = 35/348 (10%)

Query: 359 GDLSFLTV------LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ-- 410
           G L FLT+        +GS ++ + +L+I D+      T +    + G ST  S + Q  
Sbjct: 263 GILRFLTLTMFVQGFWFGSTMIRKGKLNINDVI-----TCFHSCIMLG-STLNSTLHQIV 316

Query: 411 ----GAGAASRLFELTDR--KPSISPTVGHKYKP---DRGVIEFKDVSFSYPTRPSVQIF 461
               G  A  ++  L +   K + S T  H   P       + F++VSF+YP+RPS  + 
Sbjct: 317 VLQKGEVALQKIMALLESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVL 376

Query: 462 KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHI 521
           +++N K   G    IVG SG GKSTI+ LLL +Y+   G+I+I+ ++   +  K L  +I
Sbjct: 377 QNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNI 436

Query: 522 GIVQQEPVLMSGTIRDNITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTY 572
            +V+Q   L + T++ NI  G T +    +         I+   +       I   P+  
Sbjct: 437 TVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGL 496

Query: 573 DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
           +T+IG  G  LSGGQ+QR+AIARA I+   +L LDEA SALD+     +        K K
Sbjct: 497 ETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK 556

Query: 633 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQ 680
           +  I++  H LS I   +++ V+  +G VVE G   EL ++  +  S+
Sbjct: 557 TTIILT--HELSQIESDDHLYVM-QEGRVVESGIQSELLADSATTFSK 601

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  183 bits (465), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 125/392 (31%), Positives = 198/392 (50%), Gaps = 10/392 (2%)

Query: 294 KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 353
           +D   A  +   VA + L   + V+ F  E    S+YN ++ +                 
Sbjct: 286 RDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNS 345

Query: 354 XXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG 413
             +L+   +   ++  G   V+   L++GDL             +  L + Y ++ Q   
Sbjct: 346 GQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 405

Query: 414 AASRLFELTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIA 469
               LF+L   +  I     P +  ++ P    I F++V+F Y   P  +I K+ +F I 
Sbjct: 406 DMETLFKLRKNEVKIKSVERPLMLPEHVPYE--ITFENVTFGY--HPDRKILKNASFTIP 461

Query: 470 PGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV 529
            G    IVG SG GKSTI  L+ R+Y+P +G I+I+ +DI + +  +LRR IG+V Q+  
Sbjct: 462 AGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTP 521

Query: 530 LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQ 589
           L + TI +N+ +G     T EE+++  ++      I K P  ++T++G  G ++SGG+KQ
Sbjct: 522 LFNDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQ 580

Query: 590 RIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 649
           R+AIAR L+K   ++  DEATSALD  +E A+  T      S S T V IAHRL TI  +
Sbjct: 581 RLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADA 640

Query: 650 ENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
           + +IVL  +G+V E GK  EL + P S   +L
Sbjct: 641 DKIIVL-DNGTVKEDGKHIELLATPGSLYREL 671

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  183 bits (465), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 123/391 (31%), Positives = 193/391 (49%), Gaps = 9/391 (2%)

Query: 297 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 356
            +A  +   +A + L   + V+ F  E    S+YN +++   +                +
Sbjct: 305 NKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNSGQN 364

Query: 357 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 416
           L+   +   ++  G   +L   LS+GDL             +  L + Y ++ Q      
Sbjct: 365 LIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDME 424

Query: 417 RLFELTDRKPSI----SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 472
            LF+L   +  I    +P +    K     IEFK+V+F Y   P+ +I ++ +F I  G 
Sbjct: 425 SLFKLRKNEVKILNNKNPAI-LSLKDGPFNIEFKNVTFGYD--PNRKILRNASFIIPAGV 481

Query: 473 SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMS 532
              +VGPSG GKSTI  L+ R+Y+P  G ++++  D+   +  SLRR IG+V Q+  L +
Sbjct: 482 KTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPLFN 541

Query: 533 GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
            TI +N+ +G   T T E+I +  ++      I K P  Y+T++G  G ++SGG+KQR+A
Sbjct: 542 DTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQRLA 600

Query: 593 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
           IAR L+K   ++  DEATSALD  +E  +  T        S T V IAHRL T+  S+ +
Sbjct: 601 IARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSDKI 660

Query: 653 IVLGHDGSVVEMGKFKELYSNPTSALSQLLN 683
           IVL  +GS+ E G    L S P S    L N
Sbjct: 661 IVL-KEGSIFEEGTHLGLLSKPNSLYKDLWN 690

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  182 bits (462), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 154/529 (29%), Positives = 250/529 (47%), Gaps = 32/529 (6%)

Query: 173 VALLIGC--VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 230
           + L I C  VA FG  +L   L   V AR+  + I+    Q  +      +G  +SR   
Sbjct: 154 IGLTILCYGVARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTG 212

Query: 231 DAYVVSRSM---TQKVSDGVKALICGVV----GVGMMCS-LSPQXXXXXXXXXXXXXXXA 282
               ++R+M   T+ +S  + A++  ++     + ++C  L+ Q                
Sbjct: 213 G---LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLY 269

Query: 283 SVFGKQIRNTS------KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 336
           S+F   I+ T+      +D  +A  +   VA + L   + V+ F  E     +YN ++  
Sbjct: 270 SMF--TIKTTAWRTKFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLIS 327

Query: 337 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 396
                              +L+   +   ++  G   V+   L++GDL            
Sbjct: 328 YRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSV 387

Query: 397 AVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSY 452
            +  L + Y ++ Q       LF+L   +  I     P +  ++ P    I F++V+F Y
Sbjct: 388 PLNFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYD--ITFENVTFGY 445

Query: 453 PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKM 512
              P  +I K+ +F I  G    IVG SG GKSTI  L+ R+Y+P +G I+I+ +DI + 
Sbjct: 446 --HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREY 503

Query: 513 NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 572
           +  +LR+ IG+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P  +
Sbjct: 504 DINALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGF 562

Query: 573 DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
           DT++G  G ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+  T      S 
Sbjct: 563 DTIVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSG 622

Query: 633 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
           S T V IAHRL TI  ++ +IVL  +G V E GK  EL + P S   +L
Sbjct: 623 SRTSVYIAHRLRTIADADKIIVL-DNGRVREEGKHLELLATPNSLYREL 670

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  182 bits (462), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 118/326 (36%), Positives = 172/326 (52%), Gaps = 8/326 (2%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LT + Y G   +L   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 342 SALTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 401

Query: 421 LTDRKPSISPTVGHKYKPDRG---VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 477
           L   +  I      K  P  G    I F++V+F Y   P   I K+ +F IA G  + IV
Sbjct: 402 LRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIV 459

Query: 478 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 537
           GPSG GKSTI  L+ R+Y+P  G I+I+  D+ +++  SLR+ IG+V Q+  L + TI +
Sbjct: 460 GPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWE 519

Query: 538 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARAL 597
           N+ +G     T EE+ +  ++      I+K     DT++G  G ++SGG+KQR+AIAR L
Sbjct: 520 NVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVL 578

Query: 598 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 657
           +K   ++  DEATSALD  +E  +  T     K+ S T + IAHRL TI  ++ +IVL  
Sbjct: 579 LKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-E 637

Query: 658 DGSVVEMGKFKELYSNPTSALSQLLN 683
           DGSV E G   EL +   S    L +
Sbjct: 638 DGSVKEEGTHTELLARDHSLYKDLWD 663

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  182 bits (461), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 197/395 (49%), Gaps = 10/395 (2%)

Query: 291 NTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 350
           N  +D   A  +   VA + L   + V+ F  E     +YN ++ +              
Sbjct: 285 NFRRDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAF 344

Query: 351 XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ 410
                +L+   +   ++  G   V+   L++GDL             +  L + Y E+ Q
Sbjct: 345 LNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 404

Query: 411 GAGAASRLFELTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNF 466
                  LF+L   +  I     P +  ++ P    I F++V+F Y   P  +I K+ +F
Sbjct: 405 SLIDMEALFKLRKNEIKIKNAERPLMLPEHVPYD--ITFQNVTFGY--HPDRKILKNASF 460

Query: 467 KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ 526
            I  GS   IVG SG GKSTI  L+ R+Y+P +G I+I+ +DI + +  +LR+ IG+V Q
Sbjct: 461 TIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQ 520

Query: 527 EPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGG 586
           +  L + TI +N+ +G     T EE+ +V ++      I K P  ++T++G  G ++SGG
Sbjct: 521 DTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGG 579

Query: 587 QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 646
           +KQR+AIAR L+K   ++  DEATSALD  +E A+  T      S S T V IAHRL TI
Sbjct: 580 EKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTI 639

Query: 647 RRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             ++ +IV   +G V E GK  EL + P S   +L
Sbjct: 640 ADADKIIVF-DNGKVREEGKHLELLATPGSLYREL 673

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  180 bits (457), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 152/527 (28%), Positives = 248/527 (47%), Gaps = 28/527 (5%)

Query: 173 VALLIGC--VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 230
           + L I C  VA FG  +L   L   V A++  + I+    Q  +      +G  +SR   
Sbjct: 154 IGLTILCYGVARFGS-VLFGELRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTG 212

Query: 231 DAYVVSRSM---TQKVSDGVKALICGVV----GVGMMCS-LSPQXXXXXXXXXXXXXXXA 282
               ++R+M   T+ +S  + A++  ++     + ++C  L+ Q                
Sbjct: 213 G---LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLY 269

Query: 283 SVFGKQIRNTS------KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 336
           S+F   I+ T+      +D  +A  +   VA + L   + V+ F  E     +YN ++ +
Sbjct: 270 SIF--TIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMN 327

Query: 337 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 396
                              +L+   +   ++  G   V+   L++GDL            
Sbjct: 328 YRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSV 387

Query: 397 AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR--GVIEFKDVSFSYPT 454
            +  L + Y ++ Q       LF+L   +  I         P+     I F++V+F Y  
Sbjct: 388 PLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY-- 445

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514
            P  +I K+ +F I  G    IVG SG GKSTI  L+ R+Y+P +G I+I+ +DI + + 
Sbjct: 446 HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDI 505

Query: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574
            +LR+ IG+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P  +DT
Sbjct: 506 DALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDT 564

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 634
           ++G  G ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+  T      S S 
Sbjct: 565 IVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSR 624

Query: 635 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
           T V IAHRL TI  ++ +IVL  +G V E GK  EL + P S   +L
Sbjct: 625 TSVYIAHRLRTIADADKIIVL-DNGRVREEGKHLELLAMPGSLYREL 670

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  180 bits (456), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 175/328 (53%), Gaps = 12/328 (3%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LT + Y G   V+   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 351 SALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQ 410

Query: 421 LTDRKPSISPTVGHK---YKPDRGVIE--FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 475
           L  RK  I    G      K   G  E  F++V+F Y ++   +I  + +F I  G    
Sbjct: 411 L--RKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSKR--KILNNASFTIPGGLKTA 466

Query: 476 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTI 535
           +VGPSG GKSTI  L+ R+Y+P  G I+I+  D+ + +  SLRR +G+V Q+  L + TI
Sbjct: 467 VVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTI 526

Query: 536 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595
            +N+ +G     T EE+ +V ++      I K P  Y+T++G  G ++SGG+KQR+AIAR
Sbjct: 527 WENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIAR 585

Query: 596 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
            L+K   ++  DEATSALD  +E A+  T     +S S T V IAHRL TI  ++ +IVL
Sbjct: 586 VLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL 645

Query: 656 GHDGSVVEMGKFKELYSNPTSALSQLLN 683
             DG+V E G    L + P S  + L N
Sbjct: 646 -EDGAVKEEGTHSGLLATPGSLYANLWN 672

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  179 bits (455), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 176/330 (53%), Gaps = 10/330 (3%)

Query: 360 DLSFLTVLAYGSYL----VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 415
           +L F + L    Y+    V++  L++GDL             +  L + Y E+ Q     
Sbjct: 355 NLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELKQSLIDM 414

Query: 416 SRLFELTDRKPSISPTVGHKYKPDR--GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSS 473
             LF L   K +I   +  +  P++    I F++V+F Y   P  +I K+  F I  G  
Sbjct: 415 ESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKK 472

Query: 474 VCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSG 533
             IVGPSG GKSTI  L+ R+Y P  G I+ID +DI +++  SLR+ IG+V Q+  L + 
Sbjct: 473 TAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFND 532

Query: 534 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAI 593
           TI +N+ +G     + ++I +  ++      I   P   +T++G  G ++SGG+KQR+AI
Sbjct: 533 TIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAI 591

Query: 594 ARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 653
           +R L+K   ++  DEATSALD  +E ++  T  +  + +S T V IAHRL TI  ++ +I
Sbjct: 592 SRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKII 651

Query: 654 VLGHDGSVVEMGKFKELYSNPTSALSQLLN 683
           VL ++  V E G  K L   P S  S+L N
Sbjct: 652 VL-NNSRVHEEGDHKTLLKTPGSLYSELWN 680

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  177 bits (449), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 177/331 (53%), Gaps = 17/331 (5%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LTV+ Y G   ++   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 372 SALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQ 431

Query: 421 LTDRKPSISPTVGHKYKP----DRG----VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 472
           L  + P I   V    KP    ++G     I F++V+F Y  +   +I K+ +F+I  G 
Sbjct: 432 L-KKNPIIIKNV---EKPLMLAEKGHMPMTIRFENVTFGYDKQR--KILKNASFQIESGQ 485

Query: 473 SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMS 532
              IVGPSG GKSTI  LL R+Y+P  G I+++  D  + +  SLR+ IG+V Q+  L +
Sbjct: 486 KTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFN 545

Query: 533 GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
            TI +N+ +G     + +EI  V  +      + K P   +T++G  G ++SGG+KQR+A
Sbjct: 546 DTIWENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLA 604

Query: 593 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
           IAR L+K   ++  DEATSALD  +E A+  T  +  K  S T V IAHRL TI  ++ +
Sbjct: 605 IARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKI 664

Query: 653 IVLGHDGSVVEMGKFKELYSNPTSALSQLLN 683
           IVL  +G+V E GK  EL +   S   +L N
Sbjct: 665 IVL-QEGTVREEGKHSELLARSGSLYKELWN 694

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 138/519 (26%), Positives = 249/519 (47%), Gaps = 16/519 (3%)

Query: 176  LIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK--VGDLISRLGSDAY 233
            +I  ++NF +  LL I SE  +  LR   +K+ L +  ++F + K    ++ + + +D  
Sbjct: 780  IIDGISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLR 839

Query: 234  VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTS 293
             +   +++ +S     ++  + G+        +               ++++G  ++ + 
Sbjct: 840  DLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSE 899

Query: 294  KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 353
             D + +   L  +  + +S IKT++S   EG+    Y VA   +  V             
Sbjct: 900  TDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGIS 959

Query: 354  XXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG 413
              + +       +  YG  L++  + ++  +        +T      L     ++ +G  
Sbjct: 960  ITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQR 1019

Query: 414  AASRLFEL----TDRKPSISPTV----GHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLN 465
            AAS ++ +     D K    P       +    D  +++ K+++F+Y + PS+++   L 
Sbjct: 1020 AASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLT 1079

Query: 466  FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQ 525
             K+ PG  + I G SG GK+T+  LL+++Y+     I  + +DI     +SLR  I IV+
Sbjct: 1080 LKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVE 1139

Query: 526  QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSG 585
            Q+P ++SG+IRDN+        +  E+  V K     +FI   P+  DT+I  + TLLSG
Sbjct: 1140 QKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTII--DTTLLSG 1197

Query: 586  GQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 645
            GQ QRI IARAL++KP +LILDE TSALD  S   IN    + +    +TI+SI H  S 
Sbjct: 1198 GQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIISITHSESM 1255

Query: 646  IRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
            +   +NV VL  +G +VE+G +  L +  +S L +LL++
Sbjct: 1256 MTSCQNVAVL-KNGKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  169 bits (429), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 148/249 (59%), Gaps = 12/249 (4%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           I F+++SF+YP+RP+  I   +N      ++  IVG SG GKST++ LLL++Y    G I
Sbjct: 358 ISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDI 417

Query: 503 MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT-----YTPTK----EEIR 553
           +IDN +I  +N K+L  +I IV+Q+  L + TIR+NI +G++     Y   +    E ++
Sbjct: 418 LIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLK 477

Query: 554 SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
           +        +F+   PN  DTVIG  G  LSGGQ+QR+A+ARA ++ P +LILDEA SAL
Sbjct: 478 NACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAVSAL 537

Query: 614 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
           DV     +     +L +S   TI+ + H L+ I   + + V+ H G ++E GK KEL ++
Sbjct: 538 DVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRKELITD 594

Query: 674 PTSALSQLL 682
           P +   +L+
Sbjct: 595 PNTEFHKLV 603

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  179 bits (454), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 133/508 (26%), Positives = 237/508 (46%), Gaps = 24/508 (4%)

Query: 180  VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 237
            V+NF +  +L   SE  +  LR   +++   +  E+F  + +K  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 238  SMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQ 297
             ++Q +S     L   +VG+    +   +               + ++G  ++N     +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 298  EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 357
                 L  +  E ++G+KT++    + +    Y+    ++ Q+               + 
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 358  LGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSEIMQGAGA 414
            +       +  YG  LV+  + S   +      +L+T  T N+   L +   +I +G  A
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRA 999

Query: 415  ASRLFELTDRKPSISPT-----------VGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKS 463
            AS ++ + +                    G K    + ++   ++ F+YPT   V I+ +
Sbjct: 1000 ASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDN 1059

Query: 464  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGI 523
            L+  +  G +V IVG SG GKST+  LL + Y      I ID  D+ + + ++LRR I +
Sbjct: 1060 LSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISV 1119

Query: 524  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLL 583
            V+Q+PVL  GT+R+N+ YGL ++P + +I  + K    ++FI   P   +T +  + +L+
Sbjct: 1120 VEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSV--DTSLI 1177

Query: 584  SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 643
            SGGQ QR+ IARAL++KP +LILDE TSALD  S   IN    +     S+  +SI H  
Sbjct: 1178 SGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNE 1235

Query: 644  STIRRSENVIVLGHDGSVVEMGKFKELY 671
              +R    V VL  DG + E G F +L+
Sbjct: 1236 QMMRSCNTVAVL-KDGKICETGPFNKLF 1262

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/329 (29%), Positives = 165/329 (50%), Gaps = 17/329 (5%)

Query: 363 FLTVLAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 419
           F+    +G+  + +  L+I D +T F   L    T N   G   F    +Q    A R  
Sbjct: 272 FVQGFWFGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIF----LQKGQVALRKI 327

Query: 420 E--LTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 477
           +  L D K  I  +   +    +  I F+ VSFSYP+RP+  +   ++     G +  IV
Sbjct: 328 QSFLNDNKVEIDESALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIV 387

Query: 478 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 537
           G SG GKST++ LLL+ Y+   G I I +  I +++ + L ++I +V+Q   L + T+ +
Sbjct: 388 GRSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVN 447

Query: 538 NITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
           NI  G      +    +++++   K     + I    N  DT++G  G  LSGGQ+QR+A
Sbjct: 448 NILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVA 507

Query: 593 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
           +ARA ++   VLILDEA SALD+     +     +  + ++  I++  H LS I   + +
Sbjct: 508 LARAYMRDTEVLILDEAVSALDIVHREQLMSNITKWRQGRTTIILT--HELSQISIQDYL 565

Query: 653 IVLGHDGSVVEMGKFKELYSNPTSALSQL 681
            V+  +G ++E G   +L  +P SA  ++
Sbjct: 566 YVV-EEGRIIESGFQGQLMYDPDSAFCRM 593

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  179 bits (454), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 140/517 (27%), Positives = 243/517 (47%), Gaps = 37/517 (7%)

Query: 180  VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 237
            + NF +  LL   SE  +  LR  +++K   ++  +F  +N+K  ++ + + +D     R
Sbjct: 776  IFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDL----R 831

Query: 238  SMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQXXXXXXXXXXXXXXXASVFGKQIRNTS 293
             +   VS+ + A+     V  +G++ +L    +               + ++G  ++   
Sbjct: 832  DLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYE 891

Query: 294  KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 353
             D + +  QL     + ++ IKT++   AE +    Y+     +  +             
Sbjct: 892  TDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVS 951

Query: 354  XXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA---FMLYTEYTGNAVFGLSTFYSEIMQ 410
              +++       +  YG  LV+  + +   + A    +L+T  +   + G      +I +
Sbjct: 952  MTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQ---IPDISR 1008

Query: 411  GAGAASRLF----------ELTDRKPSISPTVGHKY--KPDRGVIEFKDVSFSYPTRPSV 458
            G  AAS ++          E+ D    +    G  Y    ++ ++  ++++F+YP+ P++
Sbjct: 1009 GQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNI 1068

Query: 459  QIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLR 518
             I+K ++  +  G +V IVG SG GKST+ LLL   Y    G I ID  D+   N  SLR
Sbjct: 1069 SIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLR 1128

Query: 519  RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 578
            R I +V+Q+P L  G+IRDN+TYG        E+    K    ++F+   P + DT I  
Sbjct: 1129 REISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDT 1188

Query: 579  NGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTI 636
            N  LLSGGQ QR+ IARAL++K  +LILDE TSALD  S   IN     ++K    ++  
Sbjct: 1189 N--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKKGPPALLT 1242

Query: 637  VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            + I H    +R   +V+V   DG +VE G F  LY++
Sbjct: 1243 MVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLYND 1278

 Score =  148 bits (373), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 107/343 (31%), Positives = 173/343 (50%), Gaps = 25/343 (7%)

Query: 359 GDLSFLTV------LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA 412
           G L FLT+        +GS ++ + +L+I D+          G  +         + +G 
Sbjct: 263 GVLRFLTLTMFVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGE 322

Query: 413 GAASRLFELTDRKP--SISPTVGHKYKP----DRGVIEFKDVSFSYPTRPSVQIFKSLNF 466
            A  ++  L +  P  + S T+   Y+P      G + F++VSF+YP+RP+  I ++   
Sbjct: 323 VALEKIMTLLENGPKRNTSNTI-ELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGI 381

Query: 467 KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ 526
           K   G    IVG SG GKSTI+ LLL++Y+   G+I I+ ++I  +  KSL  +I +V+Q
Sbjct: 382 KFPGGQFTFIVGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQ 441

Query: 527 EPVLMSGTIRDNITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIG 577
              L + T+++NI  G T +    +         I+   +       I   P+  +T+IG
Sbjct: 442 RCTLFNNTLKNNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIG 501

Query: 578 PNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 637
             G  LSGGQ+QR+AIARA I+   +L LDEA SALD+     +        K K+  I+
Sbjct: 502 SGGITLSGGQQQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIIL 561

Query: 638 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQ 680
           +  H+LS I  +++ + L  DG V+E G   EL  + T+  S+
Sbjct: 562 T--HQLSQI-EADDYLYLMQDGKVIESGIQSELLVDSTTTFSK 601

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/326 (33%), Positives = 172/326 (52%), Gaps = 8/326 (2%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S L+ + Y G   V+   L++GDL             +  L + Y E+ Q       LF 
Sbjct: 348 SALSAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFN 407

Query: 421 LTDRKPSISPTVGHKYKPDRG---VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 477
           L + K  I         P+      I+F++V+F Y TR   +I ++ +F I  G    IV
Sbjct: 408 LRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTRR--KILRNASFTIPAGVKTAIV 465

Query: 478 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 537
           GPSG GKSTI  L+ R+Y+P +G ++++ +D+ + +  S R+ IG+V Q+  L + TI +
Sbjct: 466 GPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVPQDTPLFNDTIWE 525

Query: 538 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARAL 597
           N+ +G     T +E+ +  ++      I K P    T++G  G ++SGG+KQR+AIAR L
Sbjct: 526 NVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISGGEKQRLAIARVL 584

Query: 598 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 657
           +K   ++  DEATSALD  +E ++  T  +     S T V +AHRL TI  ++ ++VL  
Sbjct: 585 LKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRTIADADKILVL-E 643

Query: 658 DGSVVEMGKFKELYSNPTSALSQLLN 683
           +G V E G   EL S P S   QL +
Sbjct: 644 EGCVREEGSHTELLSRPNSLYKQLWD 669

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 174/328 (53%), Gaps = 12/328 (3%)

Query: 362 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 420
           S LT + Y G   V+   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 365 SALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 424

Query: 421 LTDRKPSISPTVGHK--YKPDRGV---IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 475
           L  RK  I     H+    P+      I+F++V+F Y      +I K+ +F I  G    
Sbjct: 425 L--RKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYDKER--KILKNASFTIPAGWKTA 480

Query: 476 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTI 535
           +VGPSG GKSTI  L+ R+Y+P  G I+++  DI +++  SLR+ IG+V Q+  L + TI
Sbjct: 481 VVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTI 540

Query: 536 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595
            +N+ +G       E ++++ K       I K P   +T++G  G ++SGG+KQR+AIAR
Sbjct: 541 WENVKFGRIEATDNEILQAIEKAQLAP-LIKKLPKGRETIVGERGLMISGGEKQRLAIAR 599

Query: 596 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
            L+K   ++  DEATSALD  +E ++  T  +     S T V IAHRL TI  ++ +IVL
Sbjct: 600 VLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL 659

Query: 656 GHDGSVVEMGKFKELYSNPTSALSQLLN 683
             DG V E G  ++L +   S  S+L N
Sbjct: 660 -KDGQVEEEGTHRQLIAKKESLYSELWN 686

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 155/549 (28%), Positives = 252/549 (45%), Gaps = 41/549 (7%)

Query: 158 PIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD 217
           P  +LP+   L+ F+       VA FG  +L   L   V A++  + I+       E F 
Sbjct: 177 PTIALPMSICLTIFSYG-----VARFGA-VLFGELRNAVFAKVAQNAIRTV---SLETFQ 227

Query: 218 NHKVGDLISRLGSDAYVVSRSM---TQKVSDGVKALICGVVGVGMMCS-----LSPQXXX 269
           +    DL   L      ++R+M   T+ +S  + A++  ++ +G   S     L+ Q   
Sbjct: 228 HLMKLDLGWHLKRQTGGLTRAMDRGTKGISYVLSAMLFHIIPIGFEISVVCGILTYQFGA 287

Query: 270 XXXXXXXXXXXXASVFGKQIRNTS------KDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
                        S+F   IR T+      +D  +A  +   VA + L   + V+ F  E
Sbjct: 288 SFAGITFTTMLLYSIF--TIRTTAWRTQFRRDANKADNKGASVALDSLINFEAVKYFNNE 345

Query: 324 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 383
               ++Y+ ++                     +L+   +   ++  G   V++  L++GD
Sbjct: 346 TYLSNKYHDSLLQYRDSTIKVAQSLAFLNSGQNLIFTSALTMMMYLGCTGVIEGNLTVGD 405

Query: 384 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL-------TDRKPSISPTVGHKY 436
           L             +  L + Y E+ Q       LF+L        + K   +P +    
Sbjct: 406 LVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIM---L 462

Query: 437 KPDRG--VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 494
           K   G   I+F++V+F Y T  + +I K+ +F I  G    +VGPSG GKSTI  L+ R+
Sbjct: 463 KSSDGPFEIKFENVTFGYDT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRF 520

Query: 495 YNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 554
           Y+P  G ++I+  ++ + +  SLRR +G+V Q+  L + TI +N+ +G       EEI+ 
Sbjct: 521 YDPEEGRVLINGINVQRYDIDSLRRVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIKQ 579

Query: 555 VAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 614
           V ++      I K P    T++G  G ++SGG+KQR+AIAR L+K   ++  DEATSALD
Sbjct: 580 VIEKAQLAPLIEKLPQREKTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALD 639

Query: 615 VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNP 674
             +E A+  T      S + T + IAHRL TI  ++ +IVL  DG V E G   EL +  
Sbjct: 640 THTEQALLNTIRANFPSGTRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLATK 698

Query: 675 TSALSQLLN 683
            S  S L N
Sbjct: 699 GSLYSNLWN 707

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  171 bits (432), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 118/345 (34%), Positives = 178/345 (51%), Gaps = 15/345 (4%)

Query: 360 DLSFLTVLAYGSYL----VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 415
           +L F T L    Y+    V+Q  L++GDL             +  L + Y ++ Q     
Sbjct: 346 NLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDM 405

Query: 416 SRLFELTDRKPSI--SPTVGHK--YKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPG 471
             LF+L   + +I  SP   +   +KP    I F++V+F Y   P  +I  +++F I  G
Sbjct: 406 ESLFKLQKNQVTIKNSPNAQNLPIHKPLD--IRFENVTFGYD--PERRILNNVSFTIPAG 461

Query: 472 SSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLM 531
               IVGPSG GKSTI  L+ R+Y P  G I++   DI  ++  SLR+ IG+V Q+  L 
Sbjct: 462 MKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLF 521

Query: 532 SGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRI 591
           + TI +N+ +G   +   E +R++ K       +   P    TV+G  G ++SGG+KQR+
Sbjct: 522 NDTIWENVKFGNISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGERGLMISGGEKQRL 580

Query: 592 AIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 651
           AIAR L+K   ++  DEATSALD  +E A+ +T  Q   S S T V +AHRL TI  ++ 
Sbjct: 581 AIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADK 640

Query: 652 VIVLGHDGSVVEMGKFKELYSNPTSALSQLLN-ERTAPVPSEQQQ 695
           +IVL   GSV E G    L ++  S    L + +    +P   +Q
Sbjct: 641 IIVL-EQGSVREEGTHSSLLASQGSLYRGLWDIQENLTLPERPEQ 684

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  172 bits (437), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 160/557 (28%), Positives = 249/557 (44%), Gaps = 50/557 (8%)

Query: 133  IPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRIL 192
            +PKV G+         GS  + LK  +  L          VA   G ++ F +   L  +
Sbjct: 732  VPKVDGV---------GSSHYLLKWSVIVL---------CVAFTDG-ISTFLKSFSLGFV 772

Query: 193  SERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 250
            SE  +  LR   ++   +++ E+F  D +K  +L + + +D   +   +++ +S     +
Sbjct: 773  SENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAMSTFI 832

Query: 251  ICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQ 310
            +  + G+    +   +               ++++G  ++      +     L     E 
Sbjct: 833  VVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENCVYEI 892

Query: 311  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 370
            + GIKT++    E + + RY+V    +  +G              + L       +  YG
Sbjct: 893  MLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAILFYYG 952

Query: 371  SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ------GAGAASRLFEL--- 421
              LV      IG+ T   ++  +T   +F + T  S I Q      G  AASR+F +   
Sbjct: 953  LKLVF-----IGEYTTMKMFKTFTL-LLFTIMTCTSLINQIPDVTRGQRAASRIFRILDE 1006

Query: 422  TDRKPSISPTVGH-----KYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
            +DR    S   G      K    + +I   ++ F YP+  S  +F  LN +IA   +V +
Sbjct: 1007 SDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVAV 1066

Query: 477  VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 536
            V  SG GKST+  LL R Y     +I ID  DI +    SLR  I IV+Q+P L  G+IR
Sbjct: 1067 VAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSIR 1126

Query: 537  DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARA 596
             N+ YG        +I  V KQ    +F+T  PN  DT +  + +LLSGGQ QRI IARA
Sbjct: 1127 KNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNV--DTSLLSGGQAQRICIARA 1184

Query: 597  LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSENVIV 654
            L++K  +LILDE TSALD ES     +    L+KS    +  ++I H    +R   NVIV
Sbjct: 1185 LLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVIV 1240

Query: 655  LGHDGSVVEMGKFKELY 671
            L  DG   + G F ELY
Sbjct: 1241 L-QDGETAQQGTFDELY 1256

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 142/259 (54%), Gaps = 17/259 (6%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           I F  +SF YP+RP   + K+++    P  +  IVG SG GKST++ LLL++YN   G I
Sbjct: 352 ISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFIVGKSGSGKSTMSNLLLKFYNGYNGCI 411

Query: 503 MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS-VAKQC-- 559
            ++  ++  ++   + +++ +V+Q+  L + T+R+N+  GL++    E++ S + + C  
Sbjct: 412 KVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLRNNLLIGLSHISAAEDVDSRLQEACRF 471

Query: 560 -FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
               N I K P+  DT +G  G  LSGGQ+QR+A+ARA ++   V+ILDEA SALD  + 
Sbjct: 472 ALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVALARAYLRDTPVVILDEAISALDARNR 531

Query: 619 GAINYTFGQLMK-----SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
                   QLM+     ++S T + + H L+ I  S+  + L  +G + E G   EL  N
Sbjct: 532 -------RQLMENIRIWTRSKTAIILTHELNQILPSD-FLYLMENGQIKEEGYQNELIEN 583

Query: 674 PTSALSQLLNERTAPVPSE 692
             S   +  + + +   SE
Sbjct: 584 VESTFCKFFHLQNSNRESE 602

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 198/398 (49%), Gaps = 20/398 (5%)

Query: 284  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 343
            ++G  ++    + +    +L  V  E ++G+KT++    E +  +++NV  +    +G  
Sbjct: 869  IYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQR 928

Query: 344  XXXXXXXXXXXXSLLGDLSFLTVLAYGSY-LVLQSQLSIGDLT---AFMLYTEYTGNAVF 399
                        + L  +S   +L Y +  LV+  + +   +      +L+T  T N   
Sbjct: 929  RAIVTGFGVAVSNGL-TMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCN--- 984

Query: 400  GLSTFYSEIMQGAGAASRLFELTD--RKPSISPTVGHKY-----KPDRGVIEFKDVSFSY 452
             L     +I +G  AAS+++ + +   +     T GH+       P   +I F D+SF+Y
Sbjct: 985  NLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSFAY 1044

Query: 453  PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKM 512
            PT P+V+I K L+ +I  G  + IVG SG GKST+  ++ R Y   + ++ +DN D+   
Sbjct: 1045 PTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDW 1104

Query: 513  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 572
                LR  I +V+Q+P L  GTIR+N+ YG        ++ ++ K    ++F    P   
Sbjct: 1105 ALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGL 1164

Query: 573  DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
            +T I  +  LLSGGQ QR+ IARAL+++P +LILDE TSALD  S   IN    +     
Sbjct: 1165 ETKI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINEIIRE--GPP 1220

Query: 633  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            +M  +SI H    +R    V VL   G +VEMG  ++L
Sbjct: 1221 TMLTISITHDEQMVRACNKVAVLDQ-GHIVEMGNREDL 1257

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 141/245 (57%), Gaps = 9/245 (3%)

Query: 435 KYKPDRGV---IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL 491
           ++  D G+   IE ++V F+YP+RP+V   K+++  +  G    +VG SG GKS++  LL
Sbjct: 335 RFYLDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLL 394

Query: 492 LRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT--- 548
           L+ Y+   G+I ID  DI  ++ KS+ ++I +V+Q   L + T+R+NI +G   T     
Sbjct: 395 LKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVR 454

Query: 549 KEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDE 608
            E +++  +     NFI   P   DT+IG  G   SGGQ+QRIAIARA ++   +L+LDE
Sbjct: 455 DESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDE 514

Query: 609 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 668
           A SALD+   G +        +S+  TI+ + H LS I   +++I L  DG VVE G+ +
Sbjct: 515 AVSALDIIHRGLLMNAIRN-WRSEKTTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQR 571

Query: 669 ELYSN 673
            L  N
Sbjct: 572 NLLLN 576

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 166/329 (50%), Gaps = 18/329 (5%)

Query: 364 LTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 422
           LT + Y G   ++   L++GDL             +  L + Y E+ Q       LF L 
Sbjct: 349 LTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFNLR 408

Query: 423 DR--------KPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSV 474
           +         KP + P     +      I F++V+F Y   P  +I ++ +F I  G   
Sbjct: 409 NNPILIDNPSKPKMLPANAGPFD-----IVFENVTFGYD--PRRKILQNASFVIPAGWKT 461

Query: 475 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGT 534
            +VGPSG GKST+  L+ R+Y+P  G I+++  DI + +  SLRR IG+V Q+  L + T
Sbjct: 462 AVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQDTPLFNDT 521

Query: 535 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIA 594
           I +N+ +G      +E  RS+ K       + + P   +T++G  G ++SGG+KQR+AIA
Sbjct: 522 IWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPGGLNTIVGERGLMISGGEKQRLAIA 580

Query: 595 RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 654
           R L+K  +++  DEATSALD  +E A+  T        S T V IAHRL TI  ++ +IV
Sbjct: 581 RVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTIADADKIIV 640

Query: 655 LGHDGSVVEMGKFKELYSNPTSALSQLLN 683
           L  +G   E G   EL     S   +L N
Sbjct: 641 L-EEGRPREEGTHHELLQKEDSLYRELWN 668

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  168 bits (425), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 146/554 (26%), Positives = 253/554 (45%), Gaps = 39/554 (7%)

Query: 149  GSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKT 208
            GS F+ LK  +  L +           +I     F +  ++   SE  +  LR  V++  
Sbjct: 744  GSSFYLLKWSLIVLSV----------AIIDAFCTFSKTFIMGYCSEYWIMDLRKKVMRTI 793

Query: 209  LHQDAEFFD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 266
             +   E+F    +K  ++ +   +D   +   +T+ ++     L+    G+        +
Sbjct: 794  TYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTEFLATASTFLVVSTCGLIWALVAGWK 853

Query: 267  XXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 326
                           + V+G  ++    D + A  QL     E +  +KT++    + + 
Sbjct: 854  LSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHF 913

Query: 327  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGD 383
             +RY+   + +  +G                L       +  YG  LV+  + +   + +
Sbjct: 914  QNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFE 973

Query: 384  LTAFMLYTEYTGNAVFG----------LSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 433
            +   +L+T  T   +             +T+   I++ A A     ++ +R   IS T  
Sbjct: 974  VFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRILKEAAATREHQDMHNRTLPISNTS- 1032

Query: 434  HKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493
               + D  V+  KD++F+YP  PS  +++ LN  +   +SV +VG SG GKSTI  LL +
Sbjct: 1033 ---EKDTMVL-VKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGSGKSTIISLLTK 1088

Query: 494  YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EI 552
             Y+     I +D  D+++ +  SLR  I +V+Q   L++GTIR+N+TYGL    T E ++
Sbjct: 1089 LYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYGLPEEDTTEVDL 1148

Query: 553  RSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSA 612
              + K    ++F+++ PN  DT++  +  LLSGGQ QR+ IARAL+K   +LILDE TSA
Sbjct: 1149 IGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQAQRLCIARALVKPHRILILDECTSA 1206

Query: 613  LDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 671
            LD  S    N     + K    T I++I H    +R  E+V++L  +G++VE G F EL 
Sbjct: 1207 LDALST---NIIIDIVRKGIPNTLIIAITHDEHMMRSCESVLLL-KNGAIVEQGSFVELM 1262

Query: 672  SNPTSALSQLLNER 685
                S   + LN R
Sbjct: 1263 QQD-SEFKKCLNGR 1275

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/384 (27%), Positives = 180/384 (46%), Gaps = 16/384 (4%)

Query: 317 VQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ 376
           V+ + A+  E+S+++ ++     +                 L    F+    +G+ ++ +
Sbjct: 215 VKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGATMIRR 274

Query: 377 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPSISPTVGH 434
           ++L I D+          G  V    +  + I +G  A  +L  F   + K  +   +  
Sbjct: 275 NKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQAALKC 334

Query: 435 KYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 494
             K +   I F ++SF YP R S    ++++ ++  G    I+G SG GKST+A LLLR+
Sbjct: 335 PPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLLRF 394

Query: 495 YNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG-------LTYTP 547
           Y   +G+I +DN  I  +N + L  +I +V+Q   L + T+R+NI  G            
Sbjct: 395 YEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEPARMES 454

Query: 548 TKEEIRSVAKQC---FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVL 604
            +E  R + K C     +  +    +  DTVIG  G  LSGGQ+QR+A+ARA ++   ++
Sbjct: 455 IEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNTPIM 514

Query: 605 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 664
           I DE+ SALDV     +        + K  T + + H LS I  ++ + ++ H G V E 
Sbjct: 515 IFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-GRVCEY 571

Query: 665 GKFKELYSNPTSALSQLLNERTAP 688
           G  ++L  + TS  S+    + AP
Sbjct: 572 GYQEDLLKSETSYFSRFYQHQ-AP 594

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  167 bits (422), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 145/527 (27%), Positives = 256/527 (48%), Gaps = 30/527 (5%)

Query: 180  VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 237
            + NF +  LL   SE  +  LR  V++K   +   +F  +++K  ++ + + +D   + R
Sbjct: 801  IFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVLNDLRDL-R 859

Query: 238  SMTQKVSDGVKALICGVVGVGMMCSLSP--QXXXXXXXXXXXXXXXASVFGKQIRNTSKD 295
            S+  +    + + I  V  +G++ +L+   +               ++++G  ++    D
Sbjct: 860  SLVSEFLSAITSFIT-VSFIGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETD 918

Query: 296  LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXX 355
             + +  QL     + ++ IKT++   AE +    Y+     + Q+               
Sbjct: 919  YKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIATGFGISMT 978

Query: 356  SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 415
            +++       +  YG  LV+  + +   +        +T  +   L +   +I +G  AA
Sbjct: 979  NMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAA 1038

Query: 416  SRLFELTDRKP-----------SISPTVGHKY--KPDRGVIEFKDVSFSYPTRPSVQIFK 462
            S ++ + D K            SI   +G  Y  K    ++  ++++F+YP+ PSV I+K
Sbjct: 1039 SWIYRILDEKQVTLEIEDNNARSIG-IIGETYHEKQTTPMLSIQNLTFAYPSAPSVLIYK 1097

Query: 463  SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIG 522
            ++N  +  G ++ IVG SG GKST+ LLL R Y+   G+I +D  D+   N   LRR I 
Sbjct: 1098 NMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRREIS 1157

Query: 523  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL 582
            +V+Q+P+L +GTIRDN+TYG      + EI    K    ++F+   P    T I  N  L
Sbjct: 1158 VVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN--L 1215

Query: 583  LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIA 640
            LSGGQ QR+ IARAL++KP +LILDE TSALD  S   I     +++K    ++  + I 
Sbjct: 1216 LSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKKGPPALLTLVIT 1271

Query: 641  HRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTA 687
            H    +R  +++ V   DG V+E G F  LY+N    + ++++E+ A
Sbjct: 1272 HDEQMMRCCDSIAVF-KDGKVIEEGSFDTLYNN-CGEMFRIVSEKNA 1316

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 175/346 (50%), Gaps = 31/346 (8%)

Query: 359 GDLSFLTV------LAYGSYLVLQSQLSIGD-LTAF---MLYTEYTGNAVFGLSTFYSEI 408
           G L FLT+        +GS ++ Q +L+I D +T F   +L      N +  +      +
Sbjct: 288 GILRFLTLTMFVQGFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVV----L 343

Query: 409 MQGAGAASRLFELTDRKPSISP---TVGHKYKPDRGV--IEFKDVSFSYPTRPSVQIFKS 463
            +G  A  ++  L +  P  +P      H+Y  D     + F +VSFSYP+RPS  + ++
Sbjct: 344 QKGEVALQKIMNLLENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLEN 403

Query: 464 LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGI 523
            + K   G    IVG SG GKST++ LLL++Y+   G+I I+ ++I  +  K L ++I +
Sbjct: 404 ASLKFPAGQFTFIVGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITV 463

Query: 524 VQQEPVLMSGTIRDNITYGLT-------YTPTKEE--IRSVAKQCFCHNFITKFPNTYDT 574
           V+Q   L + T+R NI  G T       Y+  K    I+   +       I   P+  +T
Sbjct: 464 VEQRCTLFNDTLRKNILLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLET 523

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 634
           +IG  G  LSGGQ+QR+A+ARA I+   +L LDEA SALD+     +        K K+ 
Sbjct: 524 LIGSGGVTLSGGQQQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGKTT 583

Query: 635 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQ 680
            I++  H L  +  S++ + L  +G V+E G   EL ++ TS  S+
Sbjct: 584 IILT--HELGQV-ESDDHLYLMQEGKVIESGTQSELLADSTSTFSK 626

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 144/252 (57%), Gaps = 6/252 (2%)

Query: 441 GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500
           G IEF+DVSF+YPTRP   + K+++ KI  G++  IVG SG GKST+A LLL+ Y   TG
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 501 TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 560
            I     +I  ++   L  +I +V+Q   L +GT++DN+T    Y     E++   +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTIVNKYASCT-EVKQACQFAL 473

Query: 561 CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA 620
            +  +   PN  DT++G +G  LSGGQ+QR+A+ARA ++   VLILDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 621 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQ 680
           I        K K+  I++  H  + I+  E V ++  +G+VVE G   +L  NP S  +Q
Sbjct: 534 IVEAIRHWRKGKTTIILT--HEYTQIKDDEYVYLMS-EGTVVESGFKYDLLENPDSYFAQ 590

Query: 681 L--LNERTAPVP 690
           L  L E    VP
Sbjct: 591 LNSLQETRYEVP 602

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 107/318 (33%), Positives = 173/318 (54%), Gaps = 27/318 (8%)

Query: 369  YGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 428
            +G  LV+Q + S+  +        ++      L     EI +G  AA+ +F++ +   S+
Sbjct: 951  FGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAATYIFKVLEDSGSV 1010

Query: 429  SPTVGHKYKPD-------------RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 475
              +     KPD             R  I+  ++SF++ + P  +IF SL+ +I    +V 
Sbjct: 1011 DTS-----KPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCEICLNETVG 1065

Query: 476  IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTI 535
            IVG SG GKST++LLL R Y   +G + I   DI K +  +LRR I IV+Q+P    GT+
Sbjct: 1066 IVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKPKFFDGTV 1125

Query: 536  RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595
            R+N+ YGL    +  E+RSV K     +F+   PN  +T +  +  L+SGGQ QR++IAR
Sbjct: 1126 RENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQAQRLSIAR 1183

Query: 596  ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAHRLSTIRRSENVI 653
             L+++P ++ILDE TSALD  +  AI     +L+++  K++T++ I H    ++  + V+
Sbjct: 1184 TLLRQPKIIILDECTSALDAANSFAI----AELIRTVLKNVTVIVITHSEQLMQICDRVL 1239

Query: 654  VLGHDGSVVEMGKFKELY 671
            VL   G V E G + EL+
Sbjct: 1240 VL-KKGKVKEEGSYAELF 1256

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 147/540 (27%), Positives = 253/540 (46%), Gaps = 25/540 (4%)

Query: 160  FSLPLYEFLSFFT--VALLIGC--VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 215
            ++ P  E+L  F+  V+L+  C  V+ F +   L    E  +  LR     K +     +
Sbjct: 696  YNSPGSEYLLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISW 755

Query: 216  FD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXX 273
            F   N+K   L + L +D   +   +T+ +S     ++   +G+    ++  +       
Sbjct: 756  FSKSNNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIA 815

Query: 274  XXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 333
                      ++G  +  T    + +   L  +  E + G+KT+QS   +     ++N  
Sbjct: 816  IIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCK 875

Query: 334  IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLY 390
            I+ + + G              ++L  L    +  YG  LVL  + +   L    A +L+
Sbjct: 876  IKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLF 935

Query: 391  TEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISP-----TVGHKYKPDRGVI 443
            T  T   V  L T   +I +G  + S + ++   D + +I P     T    + P++ VI
Sbjct: 936  TIVT---VASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVI 992

Query: 444  EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 503
            E  ++SF+Y    + +   ++N ++       IVG SG GKST+  L+   Y+ + G+I 
Sbjct: 993  EVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSIN 1052

Query: 504  IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563
            I + DI K + K L + + ++QQ PVL   TIR+N+ YGLT T   E + +V +     +
Sbjct: 1053 ICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKS 1112

Query: 564  FITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY 623
            FI    N  D+ +  + +LLSGGQ QR+ +AR +++ P VLILDE TSALDV S   IN 
Sbjct: 1113 FIISLNNGLDSKL--DDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKIND 1170

Query: 624  TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLN 683
              G   +S +   + ++H+  TI+  + +  L  DG+V  MG ++EL  N      +LLN
Sbjct: 1171 IIGS--RSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMEN-NWEFRKLLN 1226

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 155/301 (51%), Gaps = 19/301 (6%)

Query: 363 FLTVLAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 419
           F+    +GS ++ Q +L+I   +T+F   L      N+  G +     + +G  A  RL 
Sbjct: 271 FVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVV---LQKGDVAMKRLL 327

Query: 420 ELTDRKPS-----ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSV 474
           ++ DR P      I    G    P    I F +VSF YP R + ++F  +NF I P    
Sbjct: 328 KMIDRTPRESLAFIDAISGIDLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMT 383

Query: 475 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGT 534
            ++GPSG GKST+  L+L +Y+   G+IM+ + DI  +N   +  +I +V Q P L + T
Sbjct: 384 YVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDT 443

Query: 535 IRDNITYGLTYT--PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
           IR+NI     +T  P+K E+  + K     N I + P+  DT IG  G  LSGGQ Q++A
Sbjct: 444 IRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVA 503

Query: 593 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
           +ARA  +  ++L+LDE  SA+D+     +     +    K  T V I H L  IR ++N+
Sbjct: 504 LARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITHDLEFIRNTDNI 561

Query: 653 I 653
           +
Sbjct: 562 L 562

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 109/322 (33%), Positives = 168/322 (52%), Gaps = 8/322 (2%)

Query: 364 LTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 422
           LT + Y G   V+   L++GDL             +  L + Y E+ Q       LF+L 
Sbjct: 382 LTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLR 441

Query: 423 DRKPSISPTVGHKY--KPDRGV-IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGP 479
             +  I      K   K D    I+F++V+F Y  +   +I K+ +F I  G    I GP
Sbjct: 442 KNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQR--KILKNASFTIPAGMKTAIAGP 499

Query: 480 SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 539
           SG GKST+  L+ R+Y+P  G ++++  D+ + +   LR+ IG+V Q+  L + TI +N+
Sbjct: 500 SGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWENV 559

Query: 540 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIK 599
            +G     + EEI  V  +    + I K P    T++G  G ++SGG+KQR+AIAR L+K
Sbjct: 560 KFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLLK 618

Query: 600 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 659
              ++  DEATSALD  +E ++  T  +   S   T V IAHRL TI  ++ +IVL  +G
Sbjct: 619 DADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKIIVL-EEG 677

Query: 660 SVVEMGKFKELYSNPTSALSQL 681
           +V E G  +EL +   S   +L
Sbjct: 678 TVREEGTHQELLARENSLYKEL 699

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  164 bits (416), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 132/503 (26%), Positives = 230/503 (45%), Gaps = 18/503 (3%)

Query: 179  CVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRS 238
             V NF +  LL  +SE+ V +LR ++++  L +D  +   +K  ++ +   +D   +   
Sbjct: 775  AVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNV 834

Query: 239  MTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQE 298
             +  +S      +   VG+     +  +                +++G  ++ +    + 
Sbjct: 835  TSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKT 894

Query: 299  ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 358
            A  QL  +  E + G+KT++    E     RY    + + +                S L
Sbjct: 895  AVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCL 954

Query: 359  GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 418
              L    +  YG  LV+  +     L        +T  +  GL +      +G  A + +
Sbjct: 955  VILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFV 1014

Query: 419  FELT-------DRKPSI---SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKI 468
            F +        D   ++   +PT     +P   ++  + ++F+YP    VQI+K+ N +I
Sbjct: 1015 FGMLEEPLPEPDNYSAVLRKAPTNHFSREP---LVVLRALNFAYPAAKDVQIYKNFNLRI 1071

Query: 469  APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEP 528
              G+ V IVG SG GKST+  L+   Y     ++ ID  DI      +LR+ I +V+Q+P
Sbjct: 1072 NQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKP 1131

Query: 529  VLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQK 588
               +GTIR+N+ YGL  T T  EI  V  +    NF+   P   +T +  N  L+SGGQ 
Sbjct: 1132 RFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQL 1189

Query: 589  QRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 648
            QR++I RAL+++PT+LILDE TSALD  +  AI       +    +T++ I H    ++ 
Sbjct: 1190 QRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKM 1247

Query: 649  SENVIVLGHDGSVVEMGKFKELY 671
             + ++VL  +G+V E G F +L+
Sbjct: 1248 CDRIVVL-KNGAVAEDGSFDDLF 1269

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 127/531 (23%), Positives = 226/531 (42%), Gaps = 43/531 (8%)

Query: 191 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV------- 243
           +L ER   R+R  +++  L +  +++D  K+ D+     +  Y ++    ++        
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYD--KIDDI-----NGMYTITNRCVEEARASCAEA 149

Query: 244 -----SDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQE 298
                   V ALI  V         S +                 VF K ++  +    E
Sbjct: 150 SGVLFQSAVTALILAVTAF----KFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENE 205

Query: 299 ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 358
            T   +      L+    V+ F  +  EL ++N A+    +                  L
Sbjct: 206 QTSSASSTLSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFL 265

Query: 359 GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 418
             + F+    YGS L+ + ++    +      +    +++  + +    + +G  A  ++
Sbjct: 266 SLMMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQI 325

Query: 419 FELTDRKPSISPT-------VGH--KYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIA 469
            E  + +P   P        VGH    +     I F  VSF+YP RP  +    ++    
Sbjct: 326 AEAVNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFR 385

Query: 470 PGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV 529
           P     IVG SG GKST+  LLL++Y+   G I +++ ++  ++   L ++I +V+Q   
Sbjct: 386 PNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCT 445

Query: 530 LMSGTIRDNITYGLTYTPTKEEIRSVAKQC---FCHNFITKFPNTYDTVIGPNGTLLSGG 586
           L +GT+ +NIT  L+  P  +   +V + C        +   P    T +G  G  +SGG
Sbjct: 446 LFNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGG 503

Query: 587 QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 646
           Q+QR+A+ARA+++   VLILDEA SALD+     +          K+  I++  H LS +
Sbjct: 504 QQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSHV 561

Query: 647 RRSENVIVLGHDGSVVEMGKFKELYSNPTS---ALSQLLNERTAPVPSEQQ 694
              + + ++ H G V+E G   EL SNP S   AL++L N +      E++
Sbjct: 562 LDDDYLYMMEH-GQVIEQGYKSELLSNPNSRFRALNRLQNSKNERALEERR 611

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  163 bits (413), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 137/510 (26%), Positives = 237/510 (46%), Gaps = 21/510 (4%)

Query: 173  VALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGS 230
            V++  GC     +FIL  + SE  +  LR   + +  +QD  +F  D +K  ++ + + +
Sbjct: 799  VSVTDGCFTFLKKFIL-SVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILN 857

Query: 231  DAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIR 290
            D   +   ++  +S     +    +G+        +                 ++G  ++
Sbjct: 858  DLRDLRYLVSGFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQ 917

Query: 291  NTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 350
                D + A  +L     E + GIKTV+    E +  ++Y +    +             
Sbjct: 918  KYETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGF 977

Query: 351  XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSE 407
                 + L       +  YG  LV+  + +  +L      +++T  T +A+      +S 
Sbjct: 978  GVALSNALVIGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS- 1036

Query: 408  IMQGAGAASRLFE-LTDRKPSISPTVGHKYKPDRG------VIEFKDVSFSYPTRPSVQI 460
              +G  AA+ +F  L  R   +S     + +P         +I  +D++F+YP+   V++
Sbjct: 1037 --RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEV 1094

Query: 461  FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
            +K L+  I  G ++ IVG SG GKST+ L+L   Y     T+ ID+ DI K N  SLR+H
Sbjct: 1095 YKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKH 1154

Query: 521  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
            I +V+Q+     G+IRDN+ YGL    T  +I  V       +F+ + P   +T I  N 
Sbjct: 1155 ISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN- 1213

Query: 581  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 640
             L+SGGQ QRI+I RAL+++P +LILDE TS+LD ++  AI    G  +    +T + I 
Sbjct: 1214 -LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITTIVIT 1270

Query: 641  HRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            H  + + +S N I+   +G + E G F+EL
Sbjct: 1271 HN-TQMMKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 129/258 (50%), Gaps = 21/258 (8%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           I F++VSFSYP+RP+     +++    P     IVG SG GKST++ LLL+ Y+   GTI
Sbjct: 368 ITFENVSFSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTI 427

Query: 503 MIDNQDITKMNCKSLRRHIGIVQQEPVLMSG--------TIRDNITYGLTYTPTKEEIRS 554
            +   DI       L  +I +V+Q   L +         T +D+          +  I+ 
Sbjct: 428 KVGTLDIRATKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDD-------NKNEASIKR 480

Query: 555 VAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 614
             +       +   P+   TVIG NG  LSGGQ+QR+A+ARA+++   VLILDE+ SALD
Sbjct: 481 ACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESISALD 540

Query: 615 VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNP 674
           +     +          K+  I++  H LS I   ++ + L  DG V E G  ++L S  
Sbjct: 541 IIHRDLLMEVIRNWRAGKTTIILT--HELSHI-LDDDYLYLMEDGKVGEHGYKRDLLSYT 597

Query: 675 TSALSQLLNERTAPVPSE 692
           +   ++L N   A +PS+
Sbjct: 598 SGRFTELHN---AVIPSD 612

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  163 bits (413), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 173/346 (50%), Gaps = 19/346 (5%)

Query: 363 FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL- 421
           F+    +G+ +V + +LSI D+          G+ +         + +G  A  ++ +  
Sbjct: 272 FVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFI 331

Query: 422 --TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGP 479
             + R PS+ P          G I F+++SF+YPTRP   + K ++    PG S  I+G 
Sbjct: 332 SFSQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGK 391

Query: 480 SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 539
           SG GKST+A LLL++YN   G+I I N ++ K+N   L  +I +V+Q   L + T+R+N+
Sbjct: 392 SGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNL 451

Query: 540 TYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQR 590
             G++ +  K E         ++   +       I + P+  DT+IG  G  LSGGQ+QR
Sbjct: 452 LLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQR 511

Query: 591 IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 650
           +AIARA IK  +VLILDEA SALD+     I          K+  I++  H LS +   +
Sbjct: 512 VAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGKTTIILT--HDLSQLDYDD 569

Query: 651 NVIVLGHDGSVVEMGKFKELYSNPTSALSQL----LNERTAPVPSE 692
            + V   DG V E G  + L  +  +  S+L    + +  +  PSE
Sbjct: 570 FLYVF-EDGEVKESGYQQALLQDEKTIFSKLYDIQMRKHMSYSPSE 614

 Score =  160 bits (405), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 137/521 (26%), Positives = 237/521 (45%), Gaps = 25/521 (4%)

Query: 180  VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 239
            ++NF +  +L   SE  +  LR   +   +++  ++F   +  +  S L +      R +
Sbjct: 780  ISNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEE--NKSSELSALLLNDLRDL 837

Query: 240  TQKVSDGVKALICGVVG--VGMMCSL--SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKD 295
               VS+ + A+   +V   VG++ +L    +               + ++G  ++     
Sbjct: 838  RSLVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETM 897

Query: 296  LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXX 355
             + A  +L     E ++ IKT++   A    +  Y V   ++ ++               
Sbjct: 898  YKTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISIT 957

Query: 356  SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 415
            + +       +  YG  LV + + S   +        +T  +   L +   +I +G  AA
Sbjct: 958  NTIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAA 1017

Query: 416  SRLFELTDRKPSISPTVGHKYKPDRGVIE----------FKDVSFSYPTRPSVQIFKSLN 465
            S L+ + D       +V    +    +I            K++ FSYP+  +V+I+K++ 
Sbjct: 1018 SWLYRILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNIT 1077

Query: 466  FKIAPGS-SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIV 524
              +     ++ IVG SG GKST+  LL + Y     +I ID  D+ + +   LR+ I +V
Sbjct: 1078 LHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVV 1137

Query: 525  QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
            +Q P L  GT+RDN+ YG     ++ EI  V K    + FI   P   D+ I  +  L+S
Sbjct: 1138 EQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRI--DTKLVS 1195

Query: 585  GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 644
            GGQ QR+ IARAL++KPT+LILDE TSALD  S   IN     L+K+   T+++I    S
Sbjct: 1196 GGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHS 1251

Query: 645  T-IRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
              +  + N + +  DG + E G F EL  N  S L +++NE
Sbjct: 1252 KQMMEACNSLAVIKDGRLAEQGNFAELMKN-NSELRRIINE 1291

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  162 bits (411), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 130/510 (25%), Positives = 242/510 (47%), Gaps = 29/510 (5%)

Query: 180  VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 237
            V+NF +  +L   SE  +  LR   ++  L++D  +F  D +K  +L + L +D   +  
Sbjct: 773  VSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRS 832

Query: 238  SMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQ 297
             +++ +S     ++  ++G+        +               ++V+G  ++      +
Sbjct: 833  LVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYK 892

Query: 298  EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 357
             +   L     E ++GIKT++S  AE + +  Y+    ++  +               ++
Sbjct: 893  TSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNM 952

Query: 358  LGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGL----------STF 404
            +       +  YG  LV + + S   + +    +L+T  T  ++             +TF
Sbjct: 953  ITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATF 1012

Query: 405  YSEIM-QGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKS 463
               I+ +G  +    FE   +   ++P    K  P   +I+ ++++F+YP+  +V +++ 
Sbjct: 1013 LYRILDEGLASDESEFETHRKAEIVAPKQESKSNP---LIKIQNLTFAYPSETNVNVYED 1069

Query: 464  LNFKI-APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIG 522
            LN ++ A   ++ +VG SG GKST+  LL + Y     +I +D  D+      +LR  I 
Sbjct: 1070 LNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQIS 1129

Query: 523  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL 582
            +V+Q+P L  GT+R+N++YG++      E+  + K    + F+   P   DT I  +  L
Sbjct: 1130 VVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRI--DTKL 1187

Query: 583  LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIA 640
            LSGGQ QRI IARAL++KP +LILDE TSALD  S   I      ++K+   ++  + I 
Sbjct: 1188 LSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIVIT 1243

Query: 641  HRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            H    + R+ N I +  +G ++E G FKEL
Sbjct: 1244 HS-EKMMRACNTIAVLKNGKIIEKGGFKEL 1272

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 145/274 (52%), Gaps = 18/274 (6%)

Query: 428 ISPTVGHK-----YKPDR----GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVG 478
           +S +V H      Y+P+       I F +++FSYP+RPS  + K+++    P     I+G
Sbjct: 333 LSTSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIG 392

Query: 479 PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 538
            SG GKST++ LLL++Y+   GTI +   D+ ++N   L  ++ +V+Q   L + T+R+N
Sbjct: 393 KSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNN 452

Query: 539 ITYGLT------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
           I  G++      +   +++++           +   P+  +T+IG  G  LSGGQ+QR+A
Sbjct: 453 ILLGVSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVA 512

Query: 593 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
           IARA ++   +LILDEA SALD+     +     Q    K  T + + H LS I   +  
Sbjct: 513 IARAFMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYT 570

Query: 653 IVLGHDGSVVEMGKFKELYSNPTSALSQLLNERT 686
            V+  +G V E G  K+L    TS  + +LN +T
Sbjct: 571 YVI-QEGEVKENGYQKDLKQKKTSVFNHMLNLQT 603

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 137/504 (27%), Positives = 228/504 (45%), Gaps = 27/504 (5%)

Query: 183  FGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMT 240
            F +   L   SE  +  LR   I+K   QD  +F  D +K  ++ + + +D   + RS+ 
Sbjct: 808  FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDL-RSLV 866

Query: 241  QKVSDGVKALICGVVGVGMMCSL--SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQE 298
             +    +  LI  V  VG++ +     +               +  +G  ++    D + 
Sbjct: 867  SEFLSSISTLII-VSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKT 925

Query: 299  ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 358
               +L     E   GI T++    E   L +Y    + + +                + L
Sbjct: 926  KVAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTL 985

Query: 359  GDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 415
                   +  YG  LV     S   + +    +L+T  T  ++ G      +I +G  AA
Sbjct: 986  TLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAA 1042

Query: 416  SRLFELTDR-----KPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAP 470
            + +F + D      K        +K+  D  +I  K++SFSYP+ PS  I+K L   +  
Sbjct: 1043 TYIFRIIDNQSPAAKDEKKKIASYKFTHD-PLISVKNLSFSYPSAPSTAIYKGLKLDVFS 1101

Query: 471  GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVL 530
            G ++ +VG SG GKST+ LL+   Y    G+I ID  DI + +   LR  I +V+Q+P  
Sbjct: 1102 GETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQF 1161

Query: 531  MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQR 590
              GT+ +N+ YG++   T+ +++         +F+   P   DT I  + +L+SGGQ QR
Sbjct: 1162 FDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRI--DTSLISGGQAQR 1219

Query: 591  IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRR 648
            ++IARA+++KP +L LDE TSALD  +  AI      L+K     +T + I H    +R 
Sbjct: 1220 LSIARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRA 1275

Query: 649  SENVIVLGHDGSVVEMGKFKELYS 672
             E + VL  +G V E G F +LY+
Sbjct: 1276 CERIAVL-QNGKVAEDGSFDDLYA 1298

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 127/248 (51%), Gaps = 4/248 (1%)

Query: 441 GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500
           G I FK+VSFSYPTRP+  + K+++       +  IVG SG GKSTI  LLL+ Y   TG
Sbjct: 367 GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGKLLLKSYGGYTG 426

Query: 501 TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE-IRSVAKQC 559
            I +D  DI  +    L  +I +V+Q   L + TI++NI  G       +  +R   +  
Sbjct: 427 AIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYGDSLVREACQMA 486

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                I   PN  DTV+G  G  LSGGQKQR+A+ARA ++   +LILDEA S +D+    
Sbjct: 487 LLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDEAISGMDIIHRD 546

Query: 620 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALS 679
            +     +    K MT V + H L+ I   E+ +    +G + E G    L  N  S  +
Sbjct: 547 LLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRESGFKCNLEKNENSHFN 603

Query: 680 QLLNERTA 687
           +L   + A
Sbjct: 604 RLWRLQKA 611

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 118/407 (28%), Positives = 195/407 (47%), Gaps = 29/407 (7%)

Query: 284  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 343
            ++G  ++N     + A   L  +  E ++ IKT++      + L  Y+   + + ++   
Sbjct: 843  IYGTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKK 902

Query: 344  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLST 403
                        + +       +  YG  LVL      G+ T+  ++  +T   +F ++T
Sbjct: 903  RTIVTGLGLSMLTTITTCIQSILYYYGLKLVLT-----GEYTSKTMFQTFTL-VLFTVTT 956

Query: 404  FYSEIMQ------GAGAASRLFELTDRKPSISP---------TVGHKYKPDRGVIEFKDV 448
              S + Q      G  AAS +  + D                T+ H+   D  +IE +++
Sbjct: 957  CNSLVSQIPDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSD-PLIEIENL 1015

Query: 449  SFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 508
            +F YP  P V +++ LN KI  G ++ +VG SG GKST+  LL + Y+     I+I+  D
Sbjct: 1016 NFHYPNTPGVNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTD 1075

Query: 509  ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY-TPTKE-EIRSVAKQCFCHNFIT 566
            I   +   LR  I +V+Q+P L  GTIR+NITYG++   P  E E++ + +    H F+ 
Sbjct: 1076 INDWSYDILRAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVE 1135

Query: 567  KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 626
              P   DTV+     LLSGGQ QR+ I R L++KP VLILDE TS+LD ++   +     
Sbjct: 1136 ALPKALDTVVDIG--LLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIK 1193

Query: 627  QLMKSKSMTIVSIA--HRLSTIRRSENVIVLGHDGSVVEMGKFKELY 671
             L       I++I   H    ++    ++VL   G VVE G+F +L+
Sbjct: 1194 DLNTKLGWDILTIVITHNRQMMQCCSRLVVLDV-GRVVEDGQFDDLH 1239

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 97/346 (28%), Positives = 181/346 (52%), Gaps = 19/346 (5%)

Query: 358 LGDLSFLTV------LAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNAVFGLSTFYSEIMQ 410
           +G L FLT+        +GS ++ + +L+I D +T F  Y+     ++   +  +   +Q
Sbjct: 254 IGILRFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQ 311

Query: 411 -GAGAASRLFELTDRKPSI-SPTVGHKYKPDRGV-IEFKDVSFSYPTRPSVQIFKSLNFK 467
            G  A +++ +  +  P + S T+         V I   +++F+YP+RP+  + K+++ K
Sbjct: 312 KGQVALAKIQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLK 371

Query: 468 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQE 527
           I    +  IVG SG GKSTI  L++++Y    G I++ ++DI  +    L ++I +V+Q 
Sbjct: 372 IKSARTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQR 431

Query: 528 PVLMSGTIRDNITYGLTYTPTKEE---IRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
             L + T+++NI  G  YT        + S+       + I+  P+  +T +G +G  LS
Sbjct: 432 CTLFNDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLS 491

Query: 585 GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 644
           GGQ+QR+A+ARA ++   +LILDEA SALD+     +     ++ ++K+  I++  H L+
Sbjct: 492 GGQQQRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKTTIILT--HDLN 549

Query: 645 TIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLN-ERTAPV 689
            I  ++  I L  +  + E G  K L ++  +    + N +R A +
Sbjct: 550 QINDND-YIYLFENNEIKENGFKKTLMNDENTLFYNMYNLQRNAAI 594

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 105/314 (33%), Positives = 165/314 (52%), Gaps = 12/314 (3%)

Query: 366  VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 425
            +L YG  LV+  + S   +   +    +T      L     EI +G  AA+ LF + D +
Sbjct: 976  LLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSE 1035

Query: 426  PSISPT--VGHKYKPDRG-----VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVG 478
               +     G      RG     +I  KD+ FSY    +  +++ LN  +  G +V +VG
Sbjct: 1036 TQFADANLEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVG 1095

Query: 479  PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 538
             SG GKST+  L+ R Y   +G+I  D  D+ +    +LR+ I +V+Q P L  G+I DN
Sbjct: 1096 LSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDN 1155

Query: 539  ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALI 598
            +TYGL+ +  + EIR + +     +F+   P    + I  +  +LSGGQ QR+AI RAL+
Sbjct: 1156 LTYGLSTSVDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALL 1213

Query: 599  KKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 658
            +KP +L+LDE TSALD +  G I   F +   S+S T + + H    + R+ N I+   +
Sbjct: 1214 RKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQSTTTLVLTHS-EQMMRACNRILTFAN 1270

Query: 659  GSVVEMGKFKELYS 672
            G+++E G F+ LYS
Sbjct: 1271 GNIIEDGSFERLYS 1284

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 130/244 (53%), Gaps = 4/244 (1%)

Query: 439 DRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 498
           +R  I F++V F+YPTRP   + K ++     G +  ++G SG GKSTI  LLL +Y   
Sbjct: 355 ERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIG 414

Query: 499 TGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EIRSVAK 557
           +GTI ++ QD+ ++N   L R+I +V+Q   L + T+ +N+T G       E  ++   +
Sbjct: 415 SGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVTIGEAGVDDDEIRLKQACQ 474

Query: 558 QCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES 617
                N I       +T IG +G  LSGG++QR+A+ARA  +   +LILDEA SA D   
Sbjct: 475 MAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALARAYFRNAPILILDEALSAQDRIH 534

Query: 618 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSA 677
           +  +     +    K+  I++  H LS I  ++ V V+  DG + E G    L SNP S 
Sbjct: 535 KSLLMEAIRKWRADKTTIILT--HELSDILDTDYVYVMS-DGQIREHGYKSGLLSNPKSE 591

Query: 678 LSQL 681
            S L
Sbjct: 592 FSNL 595

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/504 (25%), Positives = 228/504 (45%), Gaps = 43/504 (8%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++KK +H    FFD+  +G +++R   D   + + +   V     +L+  V  + ++  +
Sbjct: 1145 LLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFI 1204

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +PQ                  +    R   +        + +   E L G+ T+++F  E
Sbjct: 1205 TPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDE 1264

Query: 324  G----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQ 378
            G      LS+ +   R  F +               +L+       V   GS+++     
Sbjct: 1265 GRFMQENLSKIDENNRPFFYLWVANRWLSFRIDMVGALV-------VFGSGSFIIWNIKN 1317

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTVGHKY 436
            +  G     + Y          L   YS +     +  RL E    +++P    T     
Sbjct: 1318 IDAGMAGISLTYAISFTEGALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPP 1377

Query: 437  K-PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 495
            + P  G IE  D+S  Y      ++ K++ F +AP + + IVG +G GKSTI   L R+ 
Sbjct: 1378 EWPQEGKIEVCDLSLRYAEGLP-RVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFL 1436

Query: 496  NPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YGL-----TYTPTK 549
            +P TG I IDN DIT +N   LRR I I+ Q+P L +GTI+ N+  YG       +T  +
Sbjct: 1437 DPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALR 1496

Query: 550  ------EEIRS-VAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPT 602
                  E++ S +  +      + KF N  +  I   G+ LS GQ+Q + +AR+L++ P 
Sbjct: 1497 RVNLVPEDVSSNIETESISSQNVNKFLNL-NNEISEGGSNLSQGQRQLVCLARSLLRSPK 1555

Query: 603  VLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 662
            +++LDEAT+++D  S+  I  T  +  +  S TI++IAHRL ++   + ++V+       
Sbjct: 1556 IMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHRLRSVIDYDKILVM------- 1606

Query: 663  EMGKFKELYSNPTSALSQLLNERT 686
            + G+ KE Y +P S    LLN+++
Sbjct: 1607 DAGEVKE-YDHPYSL---LLNKKS 1626

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 124/540 (22%), Positives = 215/540 (39%), Gaps = 50/540 (9%)

Query: 167 FLSFFTVALLIGCVANFGRFILLRI----LSERVVARLRAHVIKKTLHQDAEFFDNHKV- 221
           FLS   V++  G     GR + +RI    +SE     LR  V  K+    AE  D   V 
Sbjct: 412 FLSRILVSICEGQALFLGRRVCIRIKSIVISEIYNKALRRKVSVKSNKVSAEDLDPQDVN 471

Query: 222 -------------------GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 262
                              G +I+ +  DA+ VS  +   +   V+A +  ++ + ++  
Sbjct: 472 EQKHIDGDEESSDPSSANLGGIINLMAVDAFKVSE-VCAYLFAFVEATVMAIISLTLLYR 530

Query: 263 LSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 322
           L                     F   +    K     T +  +   E L  I+ ++ F  
Sbjct: 531 LIGSSAIIGTIVILIAAPANYYFATLLGKIQKATLLVTDKRIQKLNESLQAIRIIKFFSW 590

Query: 323 EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVLAYGSYLVLQSQLS 380
           E N    +  +I D+ +                S +  +  S +T  A+  Y+ +Q ++ 
Sbjct: 591 EDN----FEKSINDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAFAFYIYVQKEVL 646

Query: 381 IGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL---TDRKPSISPTVGHK 435
              +  TA  L+T    N +  LS   S ++Q   +  R+ +    TD       TV   
Sbjct: 647 TTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKYDQLTVA-- 703

Query: 436 YKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 495
             P    +EFK+ + S+ +       K LN     G    ++GP+G GK+++ + LL   
Sbjct: 704 --PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEM 761

Query: 496 NPTTGTIMI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 552
               G I++   D ++   ++       I    Q   L++ T+R+NI +   Y   +   
Sbjct: 762 KIMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEAR--Y 819

Query: 553 RSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSA 612
            SV + C              T IG  G  LSGGQKQR+++ARA+      ++LD+  SA
Sbjct: 820 TSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSA 879

Query: 613 LDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
           +D  +   I  N   G LM  ++  +VS  H ++   ++ +++V+  DG V + G   EL
Sbjct: 880 VDSHTALWIYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILEDGKVKDQGDPMEL 937

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 132/538 (24%), Positives = 247/538 (45%), Gaps = 52/538 (9%)

Query: 170  FFTVALLIGCVANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 226
            + ++  LIG   +     + +L  +L  R   ++   ++ +TLH    FFD   +G +++
Sbjct: 1108 YLSIYFLIGLTQSLLAASKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMN 1167

Query: 227  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFG 286
            R   D   V + +T  +      L+  +  + ++  ++PQ                  + 
Sbjct: 1168 RFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYM 1227

Query: 287  KQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXX 346
               R   +    +   + +   E L G+ T++++   G+E SR+   + ++ ++      
Sbjct: 1228 AASRELKRFESISKSPIYQHFSETLVGVATIRAY---GDE-SRF--MLENLHKIDENNKP 1281

Query: 347  XXXXXXXXXSL---LGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEYTGNAV 398
                      L   +  +    +   G +++     + S ++   LT  + +TE      
Sbjct: 1282 FFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE----GA 1337

Query: 399  FGLSTFYSEIMQGAGAASRLFELTD--RKP--SISPTVGHKYKPDRGVIEFKDVSFSY-P 453
              L  FY+++     +  RL E  +  ++P      T+ H   P  G IE KD+S  Y P
Sbjct: 1338 LWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAP 1397

Query: 454  TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
              P  ++ K+++F + P + + IVG +G GKSTI   + R+ NP +G I ID+ +I  +N
Sbjct: 1398 NLP--KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASIN 1455

Query: 514  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEIRSVAKQCF 560
               LRR I I+ Q+P L +GTI+ N+     +T              T+EE+++   Q  
Sbjct: 1456 LTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTG 1515

Query: 561  CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA 620
                  KF N  +  I   G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  
Sbjct: 1516 TSENANKFLNL-ENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAK 1574

Query: 621  INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSAL 678
            I  T  +  +    TI++IAHRL ++   + +IV+       + G+ KE Y +P S L
Sbjct: 1575 IQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-------DAGEVKE-YDHPYSLL 1622

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 112/229 (48%), Gaps = 11/229 (4%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           I FK+V+ ++         + LN +  PG+   ++GP+G GK+++ L LL       G I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 503 MID----NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 558
           ++      QD+  ++   L   I    Q   L++ T+R+NI +   Y   +E   +V   
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPYN--EERYNAVIDA 827

Query: 559 CFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
           C     +     +  T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 619 GAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
             I  N   G LM  ++  +VS  H ++   ++  ++V+  +G V + G
Sbjct: 888 LWIYDNCITGPLMSGRTCILVS--HNIALTLKNAELVVILENGRVKDQG 934

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  148 bits (374), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 153/567 (26%), Positives = 245/567 (43%), Gaps = 74/567 (13%)

Query: 151  DFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLH 210
            D F  + P F + LY F  FF+  L     + F     + +LS + +  LRA  +K+ LH
Sbjct: 956  DKFKNRAPSFYMGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSKWL-NLRA--VKRILH 1009

Query: 211  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQ 266
                + D   +G +++R   D    + S+  ++++ V+ L+     +VGV +MC +  P 
Sbjct: 1010 TPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRMLLYQFANIVGVCIMCIIYLPW 1065

Query: 267  XXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 326
                           A  +    R   +        +     E L G+ T++S+ +E   
Sbjct: 1066 FAIAIPFLFVGFVLIADHYQSSGREIKRLEAIQRSFVYNNFNEVLGGMDTIKSYRSENRF 1125

Query: 327  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ---------- 376
            +++ +  I  + + G                     FL V+A    L++           
Sbjct: 1126 IAKSDFLIDKMNEAGYLVVAVQRWVAI---------FLDVIAVCFALIITLLCVTRAFPI 1176

Query: 377  SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKPSISPT 431
            S  S+G L  ++L      N V    T     M  A      A     E   RKP +SP 
Sbjct: 1177 SAASVGVLLTYVLQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRKPEVSPP 1236

Query: 432  VGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALL 490
               +  P +G I F++V FSY P  P+V   K+L+  I  G  + I G +G GKSTI   
Sbjct: 1237 ---EEWPTKGEIHFENVDFSYRPGLPTV--LKNLSLDIKSGEKIGICGRTGAGKSTIMSA 1291

Query: 491  LLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN------------ 538
            L R    ++G ++ID+ DI+ +    LRR + I+ Q+PVL  GTIR N            
Sbjct: 1292 LYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHL 1351

Query: 539  ----ITYGLTYTPTKEEIRSVA-KQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAI 593
                +  G        EI++    +   H+ + KF    D ++   G   S G++Q +A+
Sbjct: 1352 WNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLAL 1409

Query: 594  ARALIKKPTVLILDEATSALDVESEGAINY----TFGQLMKSKSMTIVSIAHRLSTIRRS 649
             RAL+++  +LILDEATS++D E++G I       FG        TI+ IAHRL TI   
Sbjct: 1410 TRALVRQARILILDEATSSVDYETDGKIQARIVEEFGHC------TILCIAHRLKTILTY 1463

Query: 650  ENVIVLGHDGSVVEMGKFKELYSNPTS 676
            + ++VL   G V E    K L++   S
Sbjct: 1464 DRILVL-EKGEVAEFDTPKTLFAQEDS 1489

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 114/223 (51%), Gaps = 21/223 (9%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F  LNF+I  G  + +VGP G GK+++      + N  +G I I N D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQI-NGDL----------- 696

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
             ++   P + + +++DNI +G  Y   K +   V + C   + +   P    T IG  G
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYD--EVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 639
             LSGGQK RI +AR++ K+  + + D+  SA+D    +  ++  F  L+K K+  + + 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT- 811

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLL 682
            H+LS + R+  VIVLG+DGS  ++G  +EL    +S L  LL
Sbjct: 812 -HQLSLLERASRVIVLGNDGS-FDIGTVEEL-KQRSSTLVNLL 851

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  148 bits (374), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 131/493 (26%), Positives = 223/493 (45%), Gaps = 45/493 (9%)

Query: 199  RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 258
            R+   ++ K LH    F D+  +G +++R   D   V + +T  +      L+  +  + 
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 259  MMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGI 314
            ++  ++PQ                 + G    NTS++L+         + +   E L+G+
Sbjct: 1201 LITFITPQFLFVAVLVCVLYY----LVGYFYINTSRELKRIESITKSPIYQHFSETLTGV 1256

Query: 315  KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV 374
             T+++F   G+E+      +  I +                  +  +  L +   G +++
Sbjct: 1257 ATIRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFIL 1313

Query: 375  LQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKPS 427
            L      S ++   LT  + +TE        L  FYS +     +  RL E  D  ++P 
Sbjct: 1314 LNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPY 1369

Query: 428  ISPTVGHKYK-PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKST 486
               T+      P  G IE KD+S  Y      ++ K ++F I P + V IVG +G GKST
Sbjct: 1370 NEGTITTSTNWPTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGAGKST 1428

Query: 487  IALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 546
            I   L R+  P TG+I ID  DIT ++ ++LRR I I+ Q+P L +GTIR N+     Y 
Sbjct: 1429 IITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKY- 1487

Query: 547  PTKEEIRSVAKQCFCHN----------------FITKFPNTYDTVIGPNGTLLSGGQKQR 590
            P +E  R + +     +                 + KF N  +  I   G  LS GQKQ 
Sbjct: 1488 PDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLNL-ENEITEGGNNLSQGQKQL 1546

Query: 591  IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 650
            + +ARAL++ P V++LDEAT+++D  S+  I  T   +      T+++IAHRL ++   +
Sbjct: 1547 MCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYD 1604

Query: 651  NVIVLGHDGSVVE 663
             ++V+   G V+E
Sbjct: 1605 KILVMDA-GEVIE 1616

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 124/271 (45%), Gaps = 12/271 (4%)

Query: 401 LSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI 460
           LS   S ++Q   +  R+    D + +       K  PD   + F++ + ++        
Sbjct: 672 LSNMLSYVIQSKVSLDRVQNFLDEEDT-QKYNQLKVAPDGNKLAFENATIAWSNNNQDFK 730

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK---MNCKSL 517
            K L+     G    ++GP+G GK+++ L LL      +G I++ + D      ++   +
Sbjct: 731 LKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGM 790

Query: 518 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE-IRSVAKQCFCHNFITKFPNTYDTVI 576
              I    Q   L++ T+R+NI   L Y+P  E+  + V   C        F     T I
Sbjct: 791 TNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDFELFDAGDQTEI 847

Query: 577 GPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSM 634
           G  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N   G LM+ ++ 
Sbjct: 848 GEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGRTC 907

Query: 635 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
            +VS  H ++   ++  ++V+  +G +   G
Sbjct: 908 VLVS--HNIALTLKNAELVVMLENGRITNRG 936

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  148 bits (373), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 146/545 (26%), Positives = 244/545 (44%), Gaps = 46/545 (8%)

Query: 165  YEFLSFFTVALLIGC----VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK 220
            Y  L F  V   IG       N     +L   S R   +L   + K  +     FF+   
Sbjct: 989  YNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTP 1048

Query: 221  VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXX 280
             G +I+R  SD   V  ++    S   ++++  ++ V ++    P               
Sbjct: 1049 TGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVTFNMPLFFLLNAGLLVIYLY 1108

Query: 281  XASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 340
              S +    R   +    +   +  +  E LSG  T+ ++     ++ R++    +  Q 
Sbjct: 1109 YQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYERIQF 1164

Query: 341  GXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTG 395
                           S+ L  +  L VL+ G    S L    QLS G +   M Y     
Sbjct: 1165 SINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVT 1224

Query: 396  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK-----PDRGVIEFKDVSF 450
            +++  +      I     +  R+ E  D  P  +P V  +++     P++G IEFK+ S 
Sbjct: 1225 SSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQGQIEFKNYST 1283

Query: 451  SYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 509
            SY  R ++  + K +N  I+PG  + +VG +G GKST+++ L R   PT GTI IDN DI
Sbjct: 1284 SY--RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDI 1341

Query: 510  TKMNCKSLRRHIGIVQQEPVLMSGTIR-----------DNITYGLTYTPTKEEIRSVAKQ 558
            T +  + LR HI I+ Q+     GTIR           D++ + +  +  K  + ++AK+
Sbjct: 1342 TSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKE 1401

Query: 559  CFC---HNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
                  ++  ++  +  D  +   G+ LS GQKQ + +ARAL+ K  +L+LDEAT+++DV
Sbjct: 1402 INDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDV 1461

Query: 616  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT 675
            E++  I  T  +    +  TI++IAHRL T+  S+ +IVL  DG     G+ KE +  P 
Sbjct: 1462 ETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL--DG-----GEVKE-FDKPE 1511

Query: 676  SALSQ 680
            + L Q
Sbjct: 1512 TLLEQ 1516

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 113/225 (50%), Gaps = 15/225 (6%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIV 524
           NF++   S +C+VG  G GKSTI   +L      +G     N D      +     +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG-----NNDHLSPQFQINATTVAYC 693

Query: 525 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
            QE  +M+ +++DNI +G  Y   +   ++  K C     I   P+  +T++G  G +LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYD--EAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 585 GGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIA 640
           GGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K KS  IV   
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS--IVLAT 809

Query: 641 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT-SALSQLLNE 684
           + +S ++ S  + +L  + S+ + G + ++ +N   S L  +L+E
Sbjct: 810 NTISVLKHSTKIYLL-ENKSIAQEGNYDDIMNNQQDSKLKNILHE 853

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 151/550 (27%), Positives = 236/550 (42%), Gaps = 58/550 (10%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + LY   SFF  A   G +    +F LL  +  R    L    + + LH    + D  
Sbjct: 950  FYMGLY---SFFVFA---GYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTT 1003

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQXXXXXXXXX 275
             +G +++R   D    + S+  ++++ ++ ++     +VGV +MC +  P          
Sbjct: 1004 PLGRILNRFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAIPFLF 1059

Query: 276  XXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 335
                     +    R   +        +     E L G+ T++S+ +E   L++ +  I 
Sbjct: 1060 IGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYLIN 1119

Query: 336  DIFQVGXXXXXXXXXXXXXXSLLG-DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 394
             + + G               L+    + +  L   +     S +S+G L  ++L     
Sbjct: 1120 KMNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQLPGL 1179

Query: 395  GNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYKPDRGVIEFKDVS 449
             N V    T     M  A      A+ L  E   R+P +SP    +  P  G IEFK V 
Sbjct: 1180 LNGVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPP---ENWPSEGKIEFKHVD 1236

Query: 450  FSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 508
            FSY  RP + I  K L+  I  G  + I G +G GKSTI   L R    + G I+IDN D
Sbjct: 1237 FSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILIDNVD 1294

Query: 509  ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE---------IRSVAKQC 559
            I+K+    LRR + I+ Q+PVL  GTIR N+       P  E          +R  A + 
Sbjct: 1295 ISKLGLYDLRRKLAIIPQDPVLFRGTIRKNL------DPFNEHDDDLLWDSLVRGGAIER 1348

Query: 560  FCHNFITK------------FPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
               N I              F    D ++   G   S G++Q +A+ RAL+++  VLILD
Sbjct: 1349 AALNKIKNQKVDKDGTHADMFKFHLDQLVEEEGANFSLGERQLLALTRALVRQAKVLILD 1408

Query: 608  EATSALDVESEGAINYTFGQLMKS-KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            EATS++D E++G I     +++K     TI+ IAHRL+TI   + ++VL   G V E  K
Sbjct: 1409 EATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFEK 1464

Query: 667  FKELYSNPTS 676
             K L+    S
Sbjct: 1465 PKVLFDQEDS 1474

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 101/206 (49%), Gaps = 20/206 (9%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F  +   I  G  + +VGP G GK++    L  + N T G I + N D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQV-NGDL----------- 674

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
             ++   P + + T+RDNI +G  Y   K E   V + C     +   P    T IG  G
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 639
             LSGGQK RI +AR + KK  + + D+  SA+D    +  ++  F  L+K+++  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMG 665
            H+LS + R+  VIVLG DGS  E+G
Sbjct: 790 -HQLSLLERASRVIVLGTDGS-FEIG 813

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 139/540 (25%), Positives = 228/540 (42%), Gaps = 31/540 (5%)

Query: 164  LYEFLSFFT-VALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 222
            +++F+  +  + +      N    +LL   + R  A+L   + K  L     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXA 282
             +I+R  SD   V  ++    +   ++++   V V ++    P                 
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQ 1112

Query: 283  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 342
            + +    R   +    +T  +  +  E L G   + +F        R++    +  Q   
Sbjct: 1113 AFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRFDFINFNNVQFNI 1168

Query: 343  XXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGNA 397
                         S+ L  +    VLA      S +  + +LS G +   M Y     ++
Sbjct: 1169 NCSFNFRSTNRWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSS 1228

Query: 398  VFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTVGHKYKPDRGVIEFKDVSFSYP 453
            +  +     +I     +  R++E  +  P     I      K  P  G I FK+ S  Y 
Sbjct: 1229 LMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYK 1288

Query: 454  TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
            T+  + + K +N  I P   + +VG +G GKST++L L R    T GTI ID  DI+KM 
Sbjct: 1289 TKGDLAL-KGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMG 1347

Query: 514  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF----- 568
             K LR H+GI+ Q+     GT+R N+     Y+ T+E   S+       + +  F     
Sbjct: 1348 LKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYS-TEELWASIELSHLKPHIVEMFRKEDN 1406

Query: 569  -------PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 621
                       D  I  NG  LS GQ+Q + ++RAL+    VL+LDEAT+A+D+E++  I
Sbjct: 1407 SELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKII 1466

Query: 622  NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
              T    +K K  TI++IAHR+ T+  S+ +IVL   G V E    + L SN  S    L
Sbjct: 1467 QETIRSELKEK--TILTIAHRIDTVLDSDKIIVLDA-GQVKEFDTPENLLSNKQSIFYAL 1523

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 116/224 (51%), Gaps = 15/224 (6%)

Query: 466 FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH--IGI 523
           F+   G   CIVG  G GKST+   +L       G +   N  +  +  K L R   +  
Sbjct: 644 FQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAY 696

Query: 524 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLL 583
             QEP +M+ +I+DNIT+G  Y  T     +  K C     +   P   +T++G  G  L
Sbjct: 697 CPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEKGISL 754

Query: 584 SGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMK-SKSMTIVSIAH 641
           SGGQK RI++ARA+  +  + +LD+  SA+D E S+  +     + M   ++ T+V   +
Sbjct: 755 SGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKTVVLTTN 814

Query: 642 RLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT-SALSQLLNE 684
            +S + RS+ + +L   GS+VE G F E+ S+P  S L ++++E
Sbjct: 815 AISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 142/547 (25%), Positives = 244/547 (44%), Gaps = 59/547 (10%)

Query: 164  LYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGD 223
            LY    +F + +L   +A+  + I+  I       ++   V+KK L+    FFD+  +G 
Sbjct: 1099 LYYLAIYFAIGVLHAVIAS-SKTIINFIAGLNASRKIFNLVLKKVLYAKLRFFDSTPIGR 1157

Query: 224  LISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXAS 283
            +++R   D   V + +T  V     +L+  +  V ++  ++P                  
Sbjct: 1158 IMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYITPGFLVVAIFIGFLYYLVGY 1217

Query: 284  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 343
             +    R   +    +   + +   E L GI T+++F   G+E       ++ I +    
Sbjct: 1218 FYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRAF---GDERRFMLENLQKIDENNKP 1274

Query: 344  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAV 398
                          +  +    V A G +++L      S L+   LT  + +TE      
Sbjct: 1275 FFYLWVANRWLAFRIDMIGACVVFAAGVFILLNIKKLDSGLAGISLTYAISFTE----GA 1330

Query: 399  FGLSTFYSEIMQGAGAASRLFE--LTDRKPS----ISPTVGHKYKPDRGVIEFKDVSFSY 452
              L   YS +     +  RL E  + +++PS     +P +     PD+G IE  D+S  Y
Sbjct: 1331 LWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAFNPPIEW---PDQGKIEVNDLSLRY 1387

Query: 453  PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKM 512
             T    ++ K+++F + P   V IVG +G GKSTI   L R+ +P TG I IDN DIT +
Sbjct: 1388 ATNLP-RVIKNVSFTVDPKCKVGIVGRTGAGKSTIITALFRFLDPETGHIKIDNVDITSI 1446

Query: 513  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT-----K 567
              K LR+ I I+ Q+P L SGT++ N+     Y  T E+I    K+    N +T      
Sbjct: 1447 GLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEY--TDEQIFKALKRV---NLVTADELDH 1501

Query: 568  FPNTYDTV----------------IGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             P++ D                  I   G  LS GQ+Q + +AR+L++ P +++LDEAT+
Sbjct: 1502 VPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQRQLVCLARSLLRSPKIILLDEATA 1561

Query: 612  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 671
            ++D  S+  I  T  +  +    TI++IAHRL +I   + ++V+       + G+ +E Y
Sbjct: 1562 SIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSIIDYDKILVM-------DAGEVRE-Y 1611

Query: 672  SNPTSAL 678
             +P S L
Sbjct: 1612 DHPYSLL 1618

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 127/544 (23%), Positives = 227/544 (41%), Gaps = 62/544 (11%)

Query: 164 LYEFLSFFTVALLIGCVAN---FGRFILLR----ILSERVVARLRAHV-----------I 205
           LY F  FF   L+  C A    FGR + +R    I+SE     LR  +           I
Sbjct: 394 LYVFGMFFCRILVAICQAQALFFGRRVCIRMKAIIISEIYTKALRRKISPNSSKVSTDEI 453

Query: 206 KKTLHQDAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGM 259
                 + E  D  +      +G +I+ +  DA+ VS  +   +   V+A I  +V + +
Sbjct: 454 DPQALNETEEIDGDEESTTANLGGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTL 512

Query: 260 MCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 319
           +  L                         I    KD    T +  +   E    I+ ++ 
Sbjct: 513 LYKLLGWAAVIGAILIVCMLPLNFKLANLIGKLQKDNLGVTDKRIQKLNETFQSIRIIKF 572

Query: 320 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLV 374
           F  E N         RDI  +               +L+  + F+T      +++  Y+ 
Sbjct: 573 FSWEEN-------FERDIKAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVSFAFYIY 625

Query: 375 LQSQLSIGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV 432
           +Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+ E  D + +     
Sbjct: 626 VQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDEEET----- 679

Query: 433 GHKYKP---DRGVIEFKDVSFSYPTR-PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIA 488
             KY      R  I F++ +F++  + PS ++ K+LN +   G    ++G +G GK+++ 
Sbjct: 680 -EKYNQLTISRNKIAFENATFAWDKKNPSFKL-KNLNVEFKLGKLNVVIGSTGSGKTSLL 737

Query: 489 LLLLRYYNPTTGTIMI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 545
           + LL   +   G + +   D ++   +    +   I    Q   L++ T+R+NI +   Y
Sbjct: 738 MGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPY 797

Query: 546 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI 605
             T+   ++V + C              T IG  G  LSGGQKQR+++ARAL      ++
Sbjct: 798 NETR--YKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVL 855

Query: 606 LDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHDGSVV 662
           LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++ T++ +E V+VL  +G + 
Sbjct: 856 LDDCLSAVDSHTALWIYENCITGPLMQGRTCILVS--HNVALTLKNAEWVVVL-DNGRIK 912

Query: 663 EMGK 666
           + G+
Sbjct: 913 DQGE 916

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 135/548 (24%), Positives = 237/548 (43%), Gaps = 59/548 (10%)

Query: 165  YEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 224
            Y  + +F + L    V +   F L  I       ++ A ++ K +H    FFD   +G +
Sbjct: 1160 YYLIMYFMIGLTGATVGSLKTF-LTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRI 1218

Query: 225  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASV 284
            ++R   D   V + +T  ++    + +     + ++  ++PQ                  
Sbjct: 1219 MNRFSKDIESVDQELTPYLTGAFYSFVECFSTIILISWITPQFFVVAILISIMYYLVGYF 1278

Query: 285  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 344
            +    R   +        + +   E L G+ T+++F   G+E+      +  I +     
Sbjct: 1279 YMAGSRELKRLDSITKSPIYQHFSETLVGVTTIRAF---GDEMRFLKENLFKIDENNKPF 1335

Query: 345  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEYTGNAVF 399
                         +  +    V   G +++     + S ++   LT  + +TE       
Sbjct: 1336 FYLWVANRWLSFRIDMIGSFVVFGAGVFILADIKNIDSGMAGISLTYAISFTE----GAL 1391

Query: 400  GLSTFYSEIMQGAGAASRL----------FELTDRKPSISPTVGHKYKPDRGVIEFKDVS 449
             L  FYSE+     +  R+          +++ D      PTV     PD G IE  D+S
Sbjct: 1392 WLVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVW----PDEGKIEVNDLS 1447

Query: 450  FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 509
              Y      ++ K+++F + P S V +VG +G GKSTI   L R+ +P +G I IDN DI
Sbjct: 1448 LRYAANLP-RVIKNVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDI 1506

Query: 510  TKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEIR--- 553
            T +    LRR I I+ Q+P L +GT++ N+     Y               + EE+    
Sbjct: 1507 TTIPLTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGET 1566

Query: 554  -SVAKQCFCH-NFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             +V+ Q   H N   +F +  + +    G  LS GQ+Q I +AR+L++ P +L+LDEAT+
Sbjct: 1567 TAVSDQGSMHSNNENRFLDLSNEITEGGGN-LSQGQRQLICLARSLLRNPKILLLDEATA 1625

Query: 612  ALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            ++D ES+  +  T  G+   S   TI++IAHRL ++   + ++V+   G V+E       
Sbjct: 1626 SIDYESDARLQATIRGEFGNS---TILTIAHRLRSVIDYDKILVMDA-GEVIE------- 1674

Query: 671  YSNPTSAL 678
            Y +P S L
Sbjct: 1675 YDHPYSLL 1682

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 105/228 (46%), Gaps = 9/228 (3%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           + F + + S+ T  S    ++LN     G    ++G +G GK+++ + LL   +   G I
Sbjct: 759 LAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGRI 818

Query: 503 MI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
           ++   + +     N       I    Q   L++ T+R+NI +  ++   +     V + C
Sbjct: 819 IVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFDENR--YHKVVEAC 876

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                         T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +  
Sbjct: 877 GLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSHTAS 936

Query: 620 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
            I  N   G LM  ++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 937 WIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 982

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 129/503 (25%), Positives = 229/503 (45%), Gaps = 52/503 (10%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            +++K LH    FFD+  +G +++R   D   V + +T        +L+  +  V ++  +
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +PQ                  +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDE 1301

Query: 324  G----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQ 378
                   L + +   R  F +                L+G L    V   G +++L    
Sbjct: 1302 SRFIQENLHKIDENNRPFFYLWVANRWLAMRI----DLIGSL---VVFGAGVFILLNIDH 1354

Query: 379  LSIG----DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE--LTDRKPSISPTV 432
            +  G     LT  + +TE        L   YS +     +  RL E  + +++P   P +
Sbjct: 1355 IDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIM 1410

Query: 433  GHKYK-PDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALL 490
                  P  G +E  DVS  Y P  P  ++ K+++F + P S V +VG +G GKSTI   
Sbjct: 1411 TPPSDWPQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIITA 1468

Query: 491  LLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--- 547
            L R+ +P TG I IDN DI+ ++ + LRR I I+ Q+P L +GTI+ N+     Y+    
Sbjct: 1469 LFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDEDI 1528

Query: 548  ----------TKEEI--RSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595
                      ++EE+   ++         + KF +  ++ I   G  LS GQ+Q + +AR
Sbjct: 1529 FAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDL-NSEINEGGGNLSQGQRQLVCLAR 1587

Query: 596  ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
            +L++ P +++LDEAT+++D +S+  I  T  +  +    TI++IAHRL ++   + ++V+
Sbjct: 1588 SLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILVM 1645

Query: 656  GHDGSVVEMGKFKELYSNPTSAL 678
                   + G+ KE Y +P S L
Sbjct: 1646 -------DQGEVKE-YDHPYSLL 1660

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 123/270 (45%), Gaps = 10/270 (3%)

Query: 401 LSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI 460
           LS   S ++Q   +  R+ E  + +P           P    + F++ + S+ +      
Sbjct: 705 LSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPGGQKLGFENATISWDSEKQDFK 763

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITKMNCKSL 517
            ++LN     G    ++GP+G GK++I + LL       G I++   D + +  ++   +
Sbjct: 764 LRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLDPRALLPIDADGM 823

Query: 518 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 577
              I    Q   L++ T+R+NI +   Y+  +     V + C              T IG
Sbjct: 824 TNSIAYCSQAAWLLNDTVRNNILFNSPYSEAR--YNDVIEACGLKRDFEILSAGDMTEIG 881

Query: 578 PNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMT 635
             G  LSGGQKQRI++AR+L      L+LD+  SA+D  +   I  N   G LM+ +  T
Sbjct: 882 ERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCITGPLMQGR--T 939

Query: 636 IVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
            + I+H ++   R+  ++VL  +G V E G
Sbjct: 940 CILISHNIALTLRNAELVVLLENGQVKEQG 969

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 166/324 (51%), Gaps = 19/324 (5%)

Query: 361  LSFLT---VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 417
            L+F+T   +L +G  LV+  + + G +   +    +T      L +   EI +G  AA+ 
Sbjct: 967  LTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAATY 1026

Query: 418  LFELTDRKPSISPTV-GHKYKP------DRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAP 470
            LF+L   +     +V   ++ P       + +I  K + FSY    +  ++K+L+ K+  
Sbjct: 1027 LFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLKVDR 1086

Query: 471  GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVL 530
            G  V ++G SG GKST+  LL R Y    G+I ID  DI + + K+LR  I +V+Q+P+ 
Sbjct: 1087 GEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPLF 1146

Query: 531  MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQR 590
             SG+I +N+TYGL    + EE+  +        F+   P    +VI  +  LLSGGQ QR
Sbjct: 1147 FSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVI--DTQLLSGGQVQR 1204

Query: 591  IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRR 648
            +AI RAL++KP +L+LDE TSALD       ++   + +K      T + + H    +R 
Sbjct: 1205 LAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQMMRS 1260

Query: 649  SENVIVLGHDGSVVEMGKFKELYS 672
               ++   + G +VE G    L++
Sbjct: 1261 CHRILTF-NKGEIVEEGSIDNLFN 1283

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/245 (35%), Positives = 139/245 (56%), Gaps = 7/245 (2%)

Query: 439 DRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 498
           ++  I F++VSF+YP+R    + K+LN K+  G    IVG SG GKSTI+ LLL+ Y P 
Sbjct: 356 EQAQISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPC 415

Query: 499 TGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVA 556
           +G I +++ DI ++N + L R I +V+Q   L   +I++NI   LT    +++ R     
Sbjct: 416 SGLIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQ--LTSDEHRDDGRLSQAC 473

Query: 557 KQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616
           +       I       DT+IG +G  LSGG++QR+A+ARA ++   +LILDEA SA D  
Sbjct: 474 QAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRM 533

Query: 617 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
            +  +        K ++  I++  H L+ I   ++ ++L  DG+V+E G+  +L S+ TS
Sbjct: 534 HKDLLMEAIRFWRKGRTTIILT--HELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTS 590

Query: 677 ALSQL 681
             S L
Sbjct: 591 KFSLL 595

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 139/513 (27%), Positives = 234/513 (45%), Gaps = 51/513 (9%)

Query: 197  VARLRAH------VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 250
            VA +RA       ++K  L+    FFD+  +G +++R   D   + + +T  +     +L
Sbjct: 1123 VAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSL 1182

Query: 251  ICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQ 310
            I  V  + ++  ++PQ               A  +    R   +    +   + +   E 
Sbjct: 1183 IQCVSTIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSRSPIHQHFSET 1242

Query: 311  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 370
            L GI T+++F  E   L      I D  +                 L+G L    VLA G
Sbjct: 1243 LVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRIELIGAL---IVLAAG 1299

Query: 371  SYLVLQSQLSIGDLTAFML--YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP 426
            S+++L  +     L    L    ++T  A++ +   YS +     +  RL E T  +++P
Sbjct: 1300 SFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTTIEQEP 1358

Query: 427  S-ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 485
            S +   V     P  G IE KD+S  Y      ++ K++ F +     V IVG +G GKS
Sbjct: 1359 SNVGALVPPCEWPQNGKIEVKDLSLRYAAGLP-KVIKNVTFTVDSKCKVGIVGRTGAGKS 1417

Query: 486  TIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 545
            TI   L R+ +P TG I ID+ DIT +  K LR+ I I+ Q+P L +GT++ N+     Y
Sbjct: 1418 TIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLDPYNEY 1477

Query: 546  TPTKEEIRSVAKQCFCHNFITK----FPNTYDTV----------------IGPNGTLLSG 585
              ++ EI    K+    N ++      P+T D+                 +   G+ LS 
Sbjct: 1478 --SEAEIFEALKRV---NLVSSEELGNPSTSDSTSVHSANMNKFLDLENEVSEGGSNLSQ 1532

Query: 586  GQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 645
            GQ+Q I +AR+L++ P V++LDEAT+++D  S+  I  T  +  +  + TI++IAHRL +
Sbjct: 1533 GQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIRE--EFSNSTILTIAHRLRS 1590

Query: 646  IRRSENVIVLGHDGSVVEMGKFKELYSNPTSAL 678
            I   + ++V+       + G+ KE Y +P S L
Sbjct: 1591 IIDYDKILVM-------DAGEVKE-YDHPYSLL 1615

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 142/322 (44%), Gaps = 27/322 (8%)

Query: 362 SFLTVLAYGSYLVLQSQ-----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 416
           S +T  ++  Y+ +Q Q     ++   L+ F L      N +  LS   S ++Q   +  
Sbjct: 620 SIVTSASFAVYIYVQGQTLTTPVAFTALSLFALLR----NPLDMLSDMLSFVIQSKVSLD 675

Query: 417 RLFELTDRKPSISPTVGHKYKP---DRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSS 473
           R+ E  + + +       KY+     R  +  ++ +F++         K+L      G  
Sbjct: 676 RVQEFLNEEET------KKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKL 729

Query: 474 VCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITKMNCKSLRRHIGIVQQEPVL 530
             IVGP+G GK+++ + LL       G + +   + ++   +    +   I    Q   L
Sbjct: 730 NVIVGPTGSGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWL 789

Query: 531 MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQR 590
           ++ T+R+NI +   Y   +    +V   C              T IG  G  LSGGQKQR
Sbjct: 790 LNDTVRNNILFNAPYNENR--YNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQR 847

Query: 591 IAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRR 648
           +++AR+L      L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   +
Sbjct: 848 VSLARSLYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNVALTLK 905

Query: 649 SENVIVLGHDGSVVEMGKFKEL 670
           + + +++  +G V E G+  EL
Sbjct: 906 NADWVIIMENGRVKEQGEPVEL 927

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 144/543 (26%), Positives = 240/543 (44%), Gaps = 45/543 (8%)

Query: 170  FFTVALLIG----CVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 225
            F  V  LIG       N    ++L   S R   +L   + K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLIGVGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRII 1079

Query: 226  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVF 285
            +R  SD   V  S+    S   K+++  +V V ++    P                 + +
Sbjct: 1080 NRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQTFY 1139

Query: 286  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQ 339
                R   + +  +   +  +  E L+G   +      + F+    E  +YN+     F+
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFR 1199

Query: 340  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAV 398
                             +L   + LT+    +    + QLS G +   M Y+ E TG+  
Sbjct: 1200 STNRWLSVRLQTIGATIVLAT-AMLTLATMNT----KKQLSSGMVGLLMSYSLEVTGSLT 1254

Query: 399  FGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD-----RGVIEFKDVSFSYP 453
            + + T    I     +  R+ E  +  PS + ++  + +PD     RG IEFKD S  Y 
Sbjct: 1255 WIVRTTVM-IETNIVSVERIVEYCEL-PSEAQSINPEKRPDKNWPSRGSIEFKDYSTKY- 1311

Query: 454  TRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKM 512
             R ++  + K +N KI P   V IVG +G GKST++L L R   PT G I+ID  +I+ +
Sbjct: 1312 -RENLDPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDL 1370

Query: 513  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF---- 568
                LR H+ I+ Q+     GT++ N+     Y  +++E++   +       + K     
Sbjct: 1371 GLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKKAVELAHLKPHLEKMLENE 1428

Query: 569  ----------PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
                       +  D  I  NG+ LS GQ+Q + +ARAL+ +  +L+LDEAT+++D+E++
Sbjct: 1429 PSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETD 1488

Query: 619  GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSAL 678
              I  T  +  K +  TI++IAHR+ T+  S+ +IVL  +GSV E     +L SN  S  
Sbjct: 1489 KIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLSNKASIF 1545

Query: 679  SQL 681
              L
Sbjct: 1546 YSL 1548

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 85/329 (25%), Positives = 160/329 (48%), Gaps = 46/329 (13%)

Query: 395 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTVGHKYKPDRGVIEFKD 447
            +A++ + +  + I++ + +  RL  F L+D         I P+V  +  P   VIE  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLP---VIEMNN 619

Query: 448 VSFSYPTRPSV--------------------QI-FKSLN-FKIAPGSSVCIVGPSGRGKS 485
           ++F + ++ ++                    QI  K+++ F+   G+ VCIVG  G GKS
Sbjct: 620 ITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKS 679

Query: 486 TIALLLLRYYNPTTGTIMIDNQDIT-KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 544
           T    +L      +G+     + I  K+  +S    +    QE  +M+ ++++NI +G  
Sbjct: 680 TFLKAILGQLPCMSGS----KESIPPKLIIRS--SSLAYCSQESWIMNASVKENILFGHK 733

Query: 545 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVL 604
           +     ++    K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  + 
Sbjct: 734 FDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIY 791

Query: 605 ILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 662
           +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ +  L  +G +V
Sbjct: 792 LLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIV 850

Query: 663 EMGKFKELYS--NPTSALSQLLNERTAPV 689
           E G +  + +  N TS L +LL E  +P+
Sbjct: 851 EQGNYDSVMNRENSTSKLKKLLEEFDSPI 879

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 151/568 (26%), Positives = 244/568 (42%), Gaps = 69/568 (12%)

Query: 165  YEFLSFFTVALLIGCVANFGRFILLRILSE-RVVARLRAHVIKKTLHQDAEFFDNHKVGD 223
            Y    +FT+      +AN  + I+L I    +   +L + +          FF+   +G 
Sbjct: 984  YYLFIYFTLGF-ASSLANLIQTIILWIFCTIQGSKQLHSSMTSSIFRAPMSFFETTPIGR 1042

Query: 224  LISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXX 279
            +++R  +D Y    ++ RS +Q   + ++     VV    +CS + Q             
Sbjct: 1043 ILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVV----ICSTTWQFIFLIIPMAFLYI 1098

Query: 280  XXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ 339
                 F +  R   +        L    +E L G+ T++ F A+ +     N +     +
Sbjct: 1099 YYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGF-AQQDRFIHINQS-----R 1152

Query: 340  VGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 398
            V                L   L FL +++  G+  +   +L  G LTA M+         
Sbjct: 1153 VDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMI--------- 1203

Query: 399  FGLSTFYS-EIMQGAGAASRL-------------FELTDRKPSISPTVGHKYKPD----- 439
             GLS  Y+ ++ Q      R+              E     PS +P +    +P      
Sbjct: 1204 -GLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEEWPS 1262

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 498
            +G IEFK+ S  Y  RP +  + K++N KI P   V IVG +G GKS++ L L R    +
Sbjct: 1263 KGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEAS 1320

Query: 499  TGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 558
            +G+I ID  +I ++    LR  + I+ Q+  +  G+IR+NI    T   +++EI +  + 
Sbjct: 1321 SGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNALEM 1378

Query: 559  CFCHNFITKF---------------PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTV 603
                  I K                 N  D  I   G+ LS GQ+Q I +ARAL+    V
Sbjct: 1379 AHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNV 1438

Query: 604  LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 663
            LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ +IVL  +G V E
Sbjct: 1439 LILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLD-NGEVAE 1495

Query: 664  MGKFKELYSNPTSALSQLLNERTAPVPS 691
              K + L +N  S    L  E     P+
Sbjct: 1496 FDKPEILLTNKNSLFYSLCYESGVLKPN 1523

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 121/242 (50%), Gaps = 22/242 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           + +F +  +P  ++  K++NF+   G   CIVG  G GKS     +L       G     
Sbjct: 619 NATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSILGDLFRVKG----- 673

Query: 506 NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 565
                     S+  ++  V Q   +M+GT++DNI +G  Y P  E      K C     +
Sbjct: 674 --------FASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDP--EFYEKTIKACALTIDL 723

Query: 566 TKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 624
           +  P+   T++G  G  LSGGQK R+++ARA+  +  + +LD+  +A+D   S+  I   
Sbjct: 724 SILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNV 783

Query: 625 FGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLL 682
            G   L+KSK+  + +  +++  +  ++++ +L  +G + E G + ++ +   S+LS+L+
Sbjct: 784 LGAKGLLKSKTRILTT--NKIPVLSIADSITLL-ENGEITEQGTYFDVMATEGSSLSKLI 840

Query: 683 NE 684
            E
Sbjct: 841 TE 842

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  141 bits (356), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 134/505 (26%), Positives = 224/505 (44%), Gaps = 53/505 (10%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +P                   +    R   +    +   + +   E L GI T+++F   
Sbjct: 980  TPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAF--- 1036

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 378
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1037 GDERRFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1096

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPSISPTVGHK- 435
            L+   LT  + +TE        L   YS +     +  RL E    +++P    T  H  
Sbjct: 1097 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQST--HTP 1150

Query: 436  --YKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492
                P +G IE  D+S  Y P+ P  ++ K+++F + P   V IVG +G GKSTI   L 
Sbjct: 1151 PPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTIITALF 1208

Query: 493  RYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----- 547
            R+ +P +G I IDN DIT +  K LR+ I I+ Q+P L +GT++ N+     Y+      
Sbjct: 1209 RFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFE 1268

Query: 548  --------TKEEIRSV-----AKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIA 594
                    T+EE+ S               + KF    D  I   G  LS GQ+Q + +A
Sbjct: 1269 ALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRL-DNEITEGGANLSQGQRQLVCLA 1327

Query: 595  RALIKKPTVLILDEATSALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVI 653
            R+L++ P V++LDEAT+++D  S+  I  T  G+   S   TI++IAHRL +I   + ++
Sbjct: 1328 RSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKIL 1384

Query: 654  VLGHDGSVVEMGKFKELYSNPTSAL 678
            V+       + G+ KE Y +P S L
Sbjct: 1385 VM-------DAGEVKE-YDHPYSLL 1401

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 148/320 (46%), Gaps = 21/320 (6%)

Query: 362 SFLTVLAYGSYLVLQSQLSIG--DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 419
           S +T +++ +Y+ +Q ++       TA  L+T    N +  LS   S ++Q   +  R+ 
Sbjct: 396 SIVTTVSFATYIYIQGEVLTTPVAFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRVQ 454

Query: 420 ELTDRKPSISPTVGHKYKP---DRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
              +   +       KY      R  I F++ +FS+  +      K+++ +   G    +
Sbjct: 455 VFLEEDET------EKYDQITVSRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVV 508

Query: 477 VGPSGRGKSTIALLLLRYYNPTTGTIM---IDNQDITKMNCKSLRRHIGIVQQEPVLMSG 533
           +GP+G GK+++ + LL   +   G +    +D ++   +    +   I    Q   L++ 
Sbjct: 509 IGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLND 568

Query: 534 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAI 593
           T+++NI +   +   + +  +V + C              T IG  G  LSGGQKQR+++
Sbjct: 569 TVKNNILFSSPFNEARYD--AVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSL 626

Query: 594 ARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 651
           ARAL      L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ +
Sbjct: 627 ARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCILVS--HNVALTLKNAD 684

Query: 652 VIVLGHDGSVVEMGKFKELY 671
            +V   +G V + G+  EL+
Sbjct: 685 WVVFMENGKVKDQGEPLELF 704

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 147/553 (26%), Positives = 236/553 (42%), Gaps = 60/553 (10%)

Query: 158  PIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD 217
            P F + LY   SFF  A  I     F     + I++ + +  LRA  +K+ LH    + D
Sbjct: 931  PSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKWL-NLRA--VKRILHTPMSYID 984

Query: 218  NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXXXXXXX 276
               +G +++R   D   +   +T+ +   + +    +VGV +MC +  P           
Sbjct: 985  TTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAIPFLLV 1043

Query: 277  XXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 336
                 A  +    R   +        +     E L G+ T++++ ++   L++ +  I  
Sbjct: 1044 IFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINK 1103

Query: 337  IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----------SQLSIGDLTA 386
            + + G                     FL ++A    L++           S  S+G L  
Sbjct: 1104 MNEAGYLVVVLQRWVGI---------FLDMVAIAFALIITLLCVTRAFPISAASVGVLLT 1154

Query: 387  FMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKPSISPTVGHKYKPDRG 441
            ++L      N +    T     M  A      A     E + RKP ++P    +  P  G
Sbjct: 1155 YVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPP---ESWPSMG 1211

Query: 442  VIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500
             I F++V F+Y  RP + I  K+LN  I  G  + I G +G GKSTI   L R    T G
Sbjct: 1212 EIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAG 1269

Query: 501  TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP------------- 547
             I+IDN DI+++    LRR + I+ Q+PVL  GTIR N+      T              
Sbjct: 1270 KILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAI 1329

Query: 548  TKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTV 603
             K+++  V  Q       H  + KF    D  +   G+  S G++Q +A+ RAL+++  +
Sbjct: 1330 AKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKI 1387

Query: 604  LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 663
            LILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   G V E
Sbjct: 1388 LILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAE 1444

Query: 664  MGKFKELYSNPTS 676
                  L+S   S
Sbjct: 1445 FDTPWTLFSQEDS 1457

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 120/245 (48%), Gaps = 21/245 (8%)

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514
           + S + FK LNF I  G  + I GP G GKS++   +      T G + + N D+  + C
Sbjct: 598 KTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEV-NGDL--LMC 654

Query: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574
                        P + + ++RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 655 GY-----------PWIQNASVRDNIIFGSPFN--KEKYDEVVRVCSLKADLDILPAGDMT 701

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKS 633
            IG  G  LSGGQK RI +AR++ KK  + + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKT 761

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL-LNERTAPVPSE 692
             + +  H+LS I R+  VIVLG DG  V++G   EL +   + ++ L  + + +    E
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQTLINLLQFSSQNSEKEDE 818

Query: 693 QQQQV 697
           +Q+ V
Sbjct: 819 EQEAV 823

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 136/545 (24%), Positives = 241/545 (44%), Gaps = 56/545 (10%)

Query: 168  LSFFTVALLIGCVANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 224
            + +  + L+IG   +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLVLYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRI 1161

Query: 225  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASV 284
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ                  
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIGYF 1221

Query: 285  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 344
            +    R   +    +   + +   E L G+ T+++F  EG  +      I +  +     
Sbjct: 1222 YMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYL 1281

Query: 345  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEYTGNAVF 399
                        ++G L    +   G +++     L S ++   LT  + +TE       
Sbjct: 1282 WVANRWLAFRIDMIGSL---VIFGAGLFILSNIDHLDSGMAGISLTYAISFTE----GAL 1334

Query: 400  GLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFKDVSFSY-P 453
             L   YSE+     +  R+ E  + +    P   HK       P  G IE  D+S  Y P
Sbjct: 1335 WLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDLSLRYAP 1392

Query: 454  TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
              P  ++ K+++F +   S V IVG +G GKSTI   L R+  P TG I IDN DI+ ++
Sbjct: 1393 NLP--RVIKNVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVD 1450

Query: 514  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK------------EE------IRSV 555
             + LRR I I+ Q+P L SGTI+ N+     ++  K            EE      +R V
Sbjct: 1451 LQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREV 1510

Query: 556  AKQCFCHNF--ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
            A      +   + KF +  ++ +   G+ LS GQ+Q + +AR+L++ P +++LDEAT+++
Sbjct: 1511 ATDTSSADSENVNKFLDL-ESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASI 1569

Query: 614  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+       + G+ KE Y +
Sbjct: 1570 DYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDH 1619

Query: 674  PTSAL 678
            P S L
Sbjct: 1620 PYSLL 1624

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 108/233 (46%), Gaps = 9/233 (3%)

Query: 438 PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
           P+     F++ + S+         K LN +   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 498 TTGTIMI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 554
             G +++   D +    +        I    Q   L++ T+++NI +   +  T+   ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNETR--YKA 806

Query: 555 VAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 614
           V + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 615 VESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
             +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 150/553 (27%), Positives = 244/553 (44%), Gaps = 77/553 (13%)

Query: 170  FFTVALLIGCV-ANFGRF-ILLRILS-ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 226
            + TV  LIG + A  G F  ++  LS  R   ++  +++   LH    FFD   VG +++
Sbjct: 1041 YLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMN 1100

Query: 227  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVFG 286
            R   D   V + +   +   +  LI     + ++  ++P+                   G
Sbjct: 1101 RFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYF----FVG 1156

Query: 287  KQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 342
            K     S++L+         + +   E L G+ T+++F   G+E       +  I Q   
Sbjct: 1157 KWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAF---GDERRFILENMNKIDQNNR 1213

Query: 343  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNA 397
                           +  +    VLA GS+++L      S L+   LT  +L+T+     
Sbjct: 1214 AFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD----G 1269

Query: 398  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY----------KPDRGVIEFKD 447
               L   YS       +  RL E +  +      +GH             P  G IE ++
Sbjct: 1270 ALWLVRLYSTFEMNMNSVERLKEYSSIEQE--NYLGHDEGRILLLNEPSWPKDGEIEIEN 1327

Query: 448  VSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 506
            +S  Y P  P V   ++++FK+ P S + IVG +G GKSTI   L R   P TG I ID 
Sbjct: 1328 LSLRYAPNLPPV--IRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDG 1385

Query: 507  QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK----------------- 549
            QDI+K++  +LRR I I+ Q+P+L +GTI+ N+     Y   K                 
Sbjct: 1386 QDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFE 1445

Query: 550  EEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEA 609
            E + S  +    HN   KF N + T I   G  LS G++Q + IAR+L+++P +++LDEA
Sbjct: 1446 EVLNSEERFNSTHN---KFLNLH-TEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEA 1501

Query: 610  TSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
            TS++D +S    +G I   F +       TI++IAHRL ++   + +IV+       + G
Sbjct: 1502 TSSIDYDSDHLIQGIIRSEFNK------STILTIAHRLRSVIDYDRIIVM-------DAG 1548

Query: 666  KFKELYSNPTSAL 678
            + KE Y  P+  L
Sbjct: 1549 EVKE-YDRPSELL 1560

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 132/268 (49%), Gaps = 25/268 (9%)

Query: 438 PDRGVIEFKDVSFSYPTRPS-VQIFK--SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 494
           PD+  IEFK+ + ++    S +  FK   LN K   G    I+G +G GKS + L LL  
Sbjct: 659 PDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGE 718

Query: 495 YNPTTGTIMIDN----QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 550
            N  +G+I++ +     D+   +C+ L        Q   L++ T+++NI +   Y   ++
Sbjct: 719 LNLISGSIIVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYN--ED 775

Query: 551 EIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEAT 610
               V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  
Sbjct: 776 RYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCL 835

Query: 611 SALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVL-----GHDGSVV 662
           SA+D  +   I  N   G LMK++  T + + H +S T+R +   IVL      + G++ 
Sbjct: 836 SAVDSHTAVWIYENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTIT 893

Query: 663 EM---GKFKELYSNPTSALSQLLNERTA 687
           E+   G FKE Y   +S  S  +NE+ A
Sbjct: 894 ELQSKGLFKEKYVQLSSRDS--INEKNA 919

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 128/485 (26%), Positives = 222/485 (45%), Gaps = 31/485 (6%)

Query: 215  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXX 270
            FF+   +G +++R  +D Y    V+ R+ +Q   + VK        +G++C  + Q    
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFT----IGVICVTTWQFIFV 1098

Query: 271  XXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 325
                          + +    TS++L+     +TR       +E L GI T++ +  +  
Sbjct: 1099 IVPLGVFYIYYQQYYLR----TSRELRRLDS-ITRSPVYSHFQETLGGIVTIRGY-GQQK 1152

Query: 326  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 384
              S+ N   + +                    L+G +  L         + Q  L+ G +
Sbjct: 1153 RFSQINQCRVDNNMSAFYPSVNANRWLAYRLELIGSIIILGAATLSVMRLKQGTLTAGMV 1212

Query: 385  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIE 444
               + Y      ++  +     E+     +  R+ E  D K S +P +   ++P     E
Sbjct: 1213 GLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLK-SEAPEIIEDHRPQETWPE 1271

Query: 445  FKDVSFSYPT---RPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500
              D+ F + +   RP +  + K +NF I P   + IVG +G GKS++ L L R    + G
Sbjct: 1272 EGDIKFEHYSTRYRPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEG 1331

Query: 501  TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 560
             I+IDN DI+ +    LR  + I+ Q+  +  GTIR+NI     Y  T E+I  V +   
Sbjct: 1332 NIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNQY--TDEQIWRVLELSH 1389

Query: 561  CHNFI-TKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
              + I T   +  DT +   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++ 
Sbjct: 1390 LRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDK 1449

Query: 620  AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALS 679
             +  T     K +  TI++IAHR++TI  ++ ++VL  +GS+ E  + K+L  N +S   
Sbjct: 1450 VLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLD-NGSIKEFDEPKKLLENKSSLFY 1506

Query: 680  QLLNE 684
             L  E
Sbjct: 1507 SLCEE 1511

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 119/242 (49%), Gaps = 22/242 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L       G     
Sbjct: 630 DATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSILGDLFRVKG----- 684

Query: 506 NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 565
                     ++  ++  V Q   +M+GT++DNI +G  Y    E      K C     +
Sbjct: 685 --------FATIHGNVAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKTIKACALTIDL 734

Query: 566 TKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 624
           +   +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 735 SVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 794

Query: 625 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLL 682
            G   L+ +K+  + +  +++S +  +++V +L  +G +V+ G + E+  +  S L++L+
Sbjct: 795 LGPNGLLHTKTKVLAT--NKVSVLSVADSVSLL-ENGEIVQQGSYDEIMKDGASQLNKLI 851

Query: 683 NE 684
            E
Sbjct: 852 ME 853

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  139 bits (351), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 128/502 (25%), Positives = 227/502 (45%), Gaps = 46/502 (9%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++K +LH    FFD+  +G +++R   D   V + +   +      L+     + ++  +
Sbjct: 1174 LLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLI 1233

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +PQ                +V+    R   +        + +   E L+GI TV+++  E
Sbjct: 1234 TPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITTVRAYGDE 1293

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 383
               +      I +  +                 ++G  +F+ + A G  +   +++  G 
Sbjct: 1294 SRFMRENLEKIDENNKPFFYMWVSNRWLSFRTQIIG--AFVILGAGGFSIWNINKIDSGL 1351

Query: 384  LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTVGHKYK-PDR 440
                + Y     +A   L  FY +      +  R+ E    D++P    TV      P+ 
Sbjct: 1352 AGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADWPEN 1411

Query: 441  GVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 499
            G IE  DVS  Y P  P  ++ K+++F +   S V IVG +G GKSTI   L R+  P T
Sbjct: 1412 GKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLEPET 1469

Query: 500  GTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
            G I IDN DI  ++ + LRR I I+ Q+P L +GTIR N+     YT   +  + +    
Sbjct: 1470 GNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLD---PYTQYSD--KEIFDSL 1524

Query: 560  FCHNFITK-------FPNTYDT--VIGPN--------------GTLLSGGQKQRIAIARA 596
             C N +++        P++ DT  ++  N              G+ +S GQ+Q + +AR+
Sbjct: 1525 ICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSEGGSNISQGQRQLLCLARS 1584

Query: 597  LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656
            L+ KP +++LDEAT+++D ES+  I  T     +  + TI++IAHRL ++   + ++V+ 
Sbjct: 1585 LLGKPKIILLDEATASIDYESDKKIQETIRN--EFGNSTILTIAHRLRSVIDYDKILVM- 1641

Query: 657  HDGSVVEMGKFKELYSNPTSAL 678
                  + G+ +E Y +P S L
Sbjct: 1642 ------DAGEVEE-YDHPYSLL 1656

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 142/314 (45%), Gaps = 19/314 (6%)

Query: 362 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFG-----LSTFYSEIMQGAGAAS 416
           + +T L++  Y+ +Q Q    +LT+ + +T  +  A+       ++   S ++Q   +  
Sbjct: 677 TIVTSLSFAYYIFIQKQ----ELTSPVAFTALSLFALLKIPLDQMANMLSYVVQSKVSLD 732

Query: 417 RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476
           R+    D +P            ++  + FK+ + S+         ++L+     G    +
Sbjct: 733 RVQTFLD-EPDTKKYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVV 791

Query: 477 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK---MNCKSLRRHIGIVQQEPVLMSG 533
           +GP+G GK+++ + LL     T G I I + D      +        I    Q   L++ 
Sbjct: 792 IGPTGSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLND 851

Query: 534 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAI 593
           T+R+NI +   Y   + +   VA        I    +   T IG  G  LSGGQKQRI++
Sbjct: 852 TVRNNILFNSPYNKDRYDAAIVAAGLKRDFEILAAGDL--TEIGERGITLSGGQKQRISL 909

Query: 594 ARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 651
           ARAL      ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ +
Sbjct: 910 ARALYSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNAS 967

Query: 652 VIVLGHDGSVVEMG 665
           ++V+  +G V + G
Sbjct: 968 LVVMLKNGRVADQG 981

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 132/505 (26%), Positives = 224/505 (44%), Gaps = 53/505 (10%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +P                   +    R   +    +   + +   E L GI T+++F   
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAF--- 1249

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 378
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1250 GDERRFMQENLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1309

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPSISPTVGHK- 435
            L+   LT  + +TE        L   YS +     +  RL E    +++P    T  H  
Sbjct: 1310 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQST--HNP 1363

Query: 436  --YKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492
                P +G IE  D+S  Y P+ P  ++ K++ F + P   V IVG +G GKSTI   L 
Sbjct: 1364 PPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTIITALF 1421

Query: 493  RYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----- 547
            R+ +P +G I IDN DIT +  K LR+ I I+ Q+P L +GT++ N+     Y+      
Sbjct: 1422 RFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDKQIFE 1481

Query: 548  --------TKEEIRSVAK------QCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAI 593
                    T+EE+   A            N + KF    +  I   G+ LS GQ+Q + +
Sbjct: 1482 ALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFL-FLENEISEGGSNLSQGQRQLVCL 1539

Query: 594  ARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 653
            AR+L++ P V++LDEAT+++D +S+  I  T     +    TI++IAHRL +I   + ++
Sbjct: 1540 ARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLRSIIDYDKIL 1597

Query: 654  VLGHDGSVVEMGKFKELYSNPTSAL 678
            V+       + G+ KE Y +P S L
Sbjct: 1598 VM-------DAGEVKE-YDHPYSLL 1614

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 114/239 (47%), Gaps = 11/239 (4%)

Query: 440 RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 499
           R  I F++ +FS+  +      K++N     G    ++GP+G GK+++ + LL   +   
Sbjct: 686 RNKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLE 745

Query: 500 GTIM---IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EIRSV 555
           G +    +D ++   +    +   I    Q   L++ T+++NI +    +P  E    +V
Sbjct: 746 GKVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAV 802

Query: 556 AKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
            + C              T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D 
Sbjct: 803 IEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDS 862

Query: 616 ESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYS 672
            +   I  N   G LM+ ++  +VS  H ++   ++   +V   +G V + G+  ELY+
Sbjct: 863 HTALWIYENCISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELYN 919

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 119/476 (25%), Positives = 209/476 (43%), Gaps = 35/476 (7%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++ K +H    FFD+  +G +++R   D     + +T  +     +L+  V  V ++  +
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +PQ                  +    R   +    +   + +   E L G+ T+++F   
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRAF--- 1244

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQLSIG 382
            G+E       ++ I +                  +  +  L +   G +++L    +  G
Sbjct: 1245 GDESRFMRENLQKIDENNRPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLLNIDHIDSG 1304

Query: 383  DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS------ISPTVGHKY 436
                 + Y          L   YS +     +  RL E  D +        ++P V    
Sbjct: 1305 KAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQSILTPPVEW-- 1362

Query: 437  KPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 495
             P +G IE  D+S  Y P  P  ++ K+++F + P S V IVG +G GKSTI   L R+ 
Sbjct: 1363 -PQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAGKSTIITALFRFL 1419

Query: 496  NPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------- 547
            +P TG I IDN DIT ++ + LRR I I+ Q+P L +GTI+ N+     YT         
Sbjct: 1420 DPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTDQQIFEALK 1479

Query: 548  -----TKEEIR---SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIK 599
                 T+EE+    +          I KF +   + I   G  +S GQ+Q + +AR+L++
Sbjct: 1480 RVNLVTQEELDRRPTSESSSVSSENINKFLDL-SSEISEGGGNISQGQRQLVCLARSLLR 1538

Query: 600  KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
             P +++LDEAT+++D  S+  I  T  +       TI++IAHRL ++   + ++V+
Sbjct: 1539 SPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVIDYDKILVM 1592

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 102/479 (21%), Positives = 203/479 (42%), Gaps = 38/479 (7%)

Query: 206 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 265
           ++ ++ D E   +  +G +I+ +  DA+ VS  +   +   V+A++  +V   ++  L  
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHLLG 520

Query: 266 QXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN 325
                                  + +  K+    T +  +   E    I+ ++ F  E N
Sbjct: 521 FAAIVGAALIVAMMPLNFKLATWLGHLQKETLSVTDKRIQKLNEAFQAIRIIKFFSWENN 580

Query: 326 ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIGD 383
               +   IRD+ +                S +  ++   +T  A+  Y+ +Q ++    
Sbjct: 581 ----FEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEV---- 632

Query: 384 LTAFMLYTEYTGNAVF-----GLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK- 437
           LT  + +T  +  ++       LS   S ++Q   +  R+ E  + K +       KY  
Sbjct: 633 LTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDT------EKYNQ 686

Query: 438 ----PDRGVIEFKDVSFSYPT-RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492
                D+  I F++ + ++   RP  ++ K+LN     G    I+GP+G GK+++ + LL
Sbjct: 687 LSTAKDKKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPTGSGKTSLLMALL 745

Query: 493 RYYNPTTGTIMIDNQDITK---MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 549
              +  +G I++ + D  +   +    +   +    Q   L++ T+++NI +   Y   +
Sbjct: 746 GEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGR 805

Query: 550 EEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEA 609
            E  +V + C      +       T IG  G  LSGGQKQRI++AR+L      ++LD+ 
Sbjct: 806 YE--AVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDC 863

Query: 610 TSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            SA+D  +   I  N   G LM+ ++  +VS  H  +   R+  ++V   +G V   G+
Sbjct: 864 LSAVDSHTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 130/499 (26%), Positives = 225/499 (45%), Gaps = 44/499 (8%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++ K LH +  FFD+  +G +++R   D   V + +   +   +  +I     + ++  +
Sbjct: 1144 LLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLITYI 1203

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +P+                 ++    R   +        + +   E L G+ TV+++  E
Sbjct: 1204 TPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLVGVTTVRAYGDE 1263

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 378
                 R N+ + D  +                  +  +  L +   G +++L      S 
Sbjct: 1264 A-RFMRENLKMID--ENNKPFFYLWVSNRWLAFRIDVVGALVIFGSGVFVLLNIDKIDSG 1320

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPSISPTVGH-K 435
            L+   L+  + +TE    +   L   YS +     +  RL E    +++P  S ++    
Sbjct: 1321 LAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEVEQEPYKSSSLDVPS 1376

Query: 436  YKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 494
              P+ G IE  DVS  Y P  P  ++ K+  F + P   V IVG +G GKSTI   L R+
Sbjct: 1377 SWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVGRTGAGKSTIITALFRF 1434

Query: 495  YNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP------- 547
             +P TG+I IDN DI+ +  K LRR I I+ Q+P L SGTI+ N+     Y+        
Sbjct: 1435 LDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDPYDEYSEKQIFEAL 1494

Query: 548  ------TKEEIRS--VAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIK 599
                  T++E+ S    +Q        KF N  +  I   G+ LS GQ+Q + +AR+L++
Sbjct: 1495 KRVNLVTEKELASGNSDQQSIASGNANKFLNV-NNEISEGGSNLSQGQRQLVCLARSLLR 1553

Query: 600  KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 659
             P V++LDEAT+++D  S+  I  T     +    TI++IAHRL T+   + ++V+    
Sbjct: 1554 CPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRLRTVIDYDKILVM---- 1607

Query: 660  SVVEMGKFKELYSNPTSAL 678
               + G+ KE + +P S L
Sbjct: 1608 ---DAGEVKE-FDHPYSLL 1622

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 115/230 (50%), Gaps = 11/230 (4%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           I FK+ + ++         ++++     G    I+GP+G GK+++ + LL   +   G I
Sbjct: 703 IAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDGEI 762

Query: 503 MI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
           ++   D ++  K++   L   I    Q   L++ T+R+NI +    +P  EE  +   + 
Sbjct: 763 IVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFN---SPYCEERYNAVVEA 819

Query: 560 FCHNFITKFPNTYD-TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
                  +  N  D T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  + 
Sbjct: 820 SGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSHTA 879

Query: 619 GAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
             I  N   G LM++++  +VS  H ++   R+ + +V   +G +VE G+
Sbjct: 880 TWIYDNCISGPLMENRTCILVS--HNIALTLRNADYVVKLENGKIVEHGE 927

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 140/565 (24%), Positives = 248/565 (43%), Gaps = 74/565 (13%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + LY   SFF     +     F    ++ I++ +    L    +K+ LH    + D  
Sbjct: 934  FYMGLY---SFFVFGGYLFMNIQFTMLCMMGIMASK---WLNLKAVKRILHAPMSYLDTT 987

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXXXXXXXXX 278
             +G +++R   D   +   +T+ +   + +    ++GV ++C +  P             
Sbjct: 988  PLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLVF 1046

Query: 279  XXXASVF---GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 335
               A  +   G++I+     +Q +      +  E L G+ T++++ ++   +++ +  I 
Sbjct: 1047 VLIADHYQSAGREIKRLEA-IQRSFVYNNLI--EVLGGMDTIKAYKSQDRYMTKMDFLIN 1103

Query: 336  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDLTAFMLY 390
             + +V                ++  ++F  ++   S L +  Q      ++G L  ++L 
Sbjct: 1104 KMNEVSYMVVSVQRWVAIFLDMIA-VAFALII---SLLCVTRQFHISPSAVGVLLTYVLQ 1159

Query: 391  --------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 436
                          TE   N+   L T+ +E+ Q A           RK   SP      
Sbjct: 1160 LPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAY---------RKSDYSPPDNW-- 1208

Query: 437  KPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 495
             P  G + F+DVSF+Y P  P+V   K++N  IA G  + I G +G GKSTI   L R  
Sbjct: 1209 -PTNGEVIFEDVSFAYRPGLPTV--LKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 496  NPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------- 547
              T+G I ID  D  K+    LRR + I+ Q+PVL  GTIR N+     ++         
Sbjct: 1266 ELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLI 1325

Query: 548  -----TKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALI 598
                  K+++  +  Q       +N + KF    D ++  +G   S G++Q +A+ RAL+
Sbjct: 1326 RGGAIEKDDLEDIKHQKPDKNGSYNNMHKFH--LDQIVEEDGANFSLGERQVLALTRALV 1383

Query: 599  KKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 658
            ++  +LILDEATS++D E++G I        + +  TI+ IAHRL TI   + ++VL   
Sbjct: 1384 RQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EK 1440

Query: 659  GSVVEMGKFKELYSNPTSALSQLLN 683
            G V E  K + L++N  S    + +
Sbjct: 1441 GEVAEFDKPEILFNNEKSIFRSMCD 1465

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 111/211 (52%), Gaps = 20/211 (9%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F +LNF+I  G  + I GP G GKS++   +  +   TTG + I+              H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
           + ++   P + + T+RDNI +G  Y   +E+ + V + C     I   P    T IG  G
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFGSPYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 639
             LSGGQK RI +AR++ K   + + D+  SA+D    +  ++  F Q ++SK+  + + 
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT- 779

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            H+LS I +++ VIVL  +GS V++G  +EL
Sbjct: 780 -HQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 157/315 (49%), Gaps = 28/315 (8%)

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG----H 434
            LS G +   M Y     N +  +     ++     +  R+ E  D  P   P +      
Sbjct: 1230 LSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPE 1289

Query: 435  KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493
            K  P +G + FKD S  Y  R ++  + K LN +I P   + IVG +G GKST++L L R
Sbjct: 1290 KNWPAQGHVVFKDYSARY--RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFR 1347

Query: 494  YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
               P  GTI+ID  DITK+    LR H+ I+ Q+     G++R N+     Y  + +EI 
Sbjct: 1348 ILEPCGGTIVIDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQY--SDDEIW 1405

Query: 554  SVAKQCFCHNFITKFPNT---------YDTVIGPNGTLLSGGQKQRIAIARALIKKPTVL 604
               +       I K  N           +T I  NG+ LS GQ+Q + ++RAL+ +  +L
Sbjct: 1406 RALELSHLKPHILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRIL 1465

Query: 605  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 664
            +LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL       + 
Sbjct: 1466 VLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-------DQ 1516

Query: 665  GKFKELYSNPTSALS 679
            G+ KE + +P++ L+
Sbjct: 1517 GEVKE-FDSPSNLLA 1530

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 116/226 (51%), Gaps = 19/226 (8%)

Query: 466 FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN--CKSLRRHIGI 523
           F+   G  VC+VG  G GKST    LL      + +    +Q   KM+  C S    + +
Sbjct: 658 FQALKGQLVCVVGRVGAGKSTFLHALLGQLPCISSS---HDQATPKMHFRCDS----VAL 710

Query: 524 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLL 583
             Q+  +++ +++ N+ +G  Y   +   ++  + C     +    +  +T++G  G  L
Sbjct: 711 CSQQAWILNASVKYNVLFGHKYD--EASYKATIEACQLLPDLGILADGDETLVGEKGISL 768

Query: 584 SGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSI 639
           SGGQK RI++ARA+  +  V +LD+  SA+D E  +  I++   +   L+K+K  T++  
Sbjct: 769 SGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILT 826

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYS-NPTSALSQLLNE 684
            + +S ++ S+++  L  +G +VE G F E+ S +  S L  L+ E
Sbjct: 827 TNSISVLKHSQSIYAL-ENGEIVERGSFDEIMSKDAESKLKTLIAE 871

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 130/515 (25%), Positives = 232/515 (45%), Gaps = 56/515 (10%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++ K LH    FFD    G +++R   D   + + +T  +     +LI  +  V ++  +
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +PQ                  +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1201 TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQ 378
            G  +      I +  +                 ++G L    +   G +++     L S 
Sbjct: 1261 GRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNINNLDSG 1317

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK--- 435
            ++   LT  + +TE        L   YSE+     +  R+ E  + +    P   HK   
Sbjct: 1318 MAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNEHKEIP 1371

Query: 436  --YKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492
                P  G IE  D+S  Y P  P  ++ K+++F +   S + IVG +G GKSTI   L 
Sbjct: 1372 PPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALF 1429

Query: 493  RYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----- 547
            R+  P TG I IDN DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++      
Sbjct: 1430 RFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFE 1489

Query: 548  --------TKEEI-----RSVAKQCFCHNF--ITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
                    ++E++     R  + +    N   + KF +   + I   G+ LS GQ+Q + 
Sbjct: 1490 ALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDL-SSEISEGGSNLSQGQRQLMC 1548

Query: 593  IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
            +AR+L++ P +++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + +
Sbjct: 1549 LARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKI 1606

Query: 653  IVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTA 687
            +V+       + G+ KE Y +P S    LLN+++A
Sbjct: 1607 LVM-------DAGEVKE-YDHPYSL---LLNKQSA 1630

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 109/234 (46%), Gaps = 11/234 (4%)

Query: 438 PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
           P+     F++ + S+         K LN +   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 498 TTGTIMID----NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
             G +++      Q++  ++       I    Q   L++ T+++NI +   +   +   +
Sbjct: 749 LNGKVVVPALEPRQELI-VDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEAR--YK 805

Query: 554 SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
           +V + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 614 DVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
           D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 866 DSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 138/529 (26%), Positives = 242/529 (45%), Gaps = 51/529 (9%)

Query: 200  LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVG 256
            L  + + + LH    + D   +G +++R   D    + S+  ++++ V+ +   +  +V 
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRLMLFQVGNIVA 1002

Query: 257  VGMMCSLS-PQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATG-QLTRV---AEEQL 311
            V +MC +  P                A  +    ++TS++++     Q + V     E L
Sbjct: 1003 VIVMCIVYLPWFAIAVPFLFFMFVLIADHY----QSTSREIKRLDAIQRSFVYNNLNEVL 1058

Query: 312  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 371
             G+ T++S+  +    ++ +  I  + + G               ++  + F  ++A  S
Sbjct: 1059 GGMDTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVA-IIFALIIALLS 1117

Query: 372  Y--LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDR 424
               +   S  S+G L  ++L      N+V    T     M  A      A++L  E   +
Sbjct: 1118 VTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPLEAAYK 1177

Query: 425  KPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGK 484
            KP +SP    +  P +G I F DV F+Y +   V + K LN  I  G  + I G +G GK
Sbjct: 1178 KPELSPP---ESWPSKGEIRFLDVDFAYRSGLPV-VLKGLNLDIKSGEKIGICGRTGAGK 1233

Query: 485  STIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 544
            STI   L R    T+G I+ID+ DI+ +    LRR + I+ Q+PVL  GTIR N+     
Sbjct: 1234 STIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSN 1293

Query: 545  YTPT-------------KEEIRSVAKQCF----CHNFITKFPNTYDTVIGPNGTLLSGGQ 587
            Y  +             KE +  V  +       H  + KF    D ++   G+  S G+
Sbjct: 1294 YDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGE 1351

Query: 588  KQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 647
            +Q +A+ RAL+++  +LILDEATS++D E++G I     +  +  + TI+ IAHRL TI 
Sbjct: 1352 RQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAHRLKTIL 1409

Query: 648  RSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQ 696
            + + ++VL   G + E  +  +L+S+  S    +  ER+    S+ + Q
Sbjct: 1410 QYDRILVL-EKGVIAEFDQPFKLFSDKDSIFRSMC-ERSNITESDFKIQ 1456

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 117/237 (49%), Gaps = 21/237 (8%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F +L+F+I  G  + I GP G GKS++      + N T G I + N D+  + C      
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQV-NGDL--LFCGY---- 640

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
                  P + + T++DNI +G  +   KE+  +V + C     +   P    T IG  G
Sbjct: 641 -------PWIQNATVKDNILFGSPFI--KEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 639
             LSGGQK RI +ARA+ K   + + D+  SA+D    +  ++     L++ K+  + + 
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT- 750

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQ 696
            H+LS I +++ VIVLG DGS  ++G   EL       L+ LL+  T    +E + +
Sbjct: 751 -HQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLDYSTTERENENRDE 804

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 146/563 (25%), Positives = 240/563 (42%), Gaps = 79/563 (14%)

Query: 158  PIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD 217
            P F + LY   SFF  A  I     F     + I++ + +  LRA  +++ LH    + D
Sbjct: 931  PSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKCL-NLRA--VRRILHTPMSYID 984

Query: 218  NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXXXXXXX 276
               +G +++R   D   +   +T+ +   + +    +VGV +MC +  P           
Sbjct: 985  TTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAIPFLLV 1043

Query: 277  XXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 336
                 A  +    R   +        +     E L G+ T++++ ++   L++ +  I  
Sbjct: 1044 VFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINK 1103

Query: 337  IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----------SQLSIGDLTA 386
            + + G                     FL ++A    L++           S  S+G L  
Sbjct: 1104 MNEAGYLVVVLQRWVGI---------FLDMVAIAFALIITLLCVTRAFPISAASVGVLLT 1154

Query: 387  FMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYKPDRG 441
            ++L      N +    T     M  A      A++L  E   RKP ++P    +  P +G
Sbjct: 1155 YVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPP---ESWPSKG 1211

Query: 442  VIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500
             I F++V F+Y  RP + I  K+ N  I  G  + I G +G GKSTI   L R    T G
Sbjct: 1212 KIVFENVDFAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAG 1269

Query: 501  TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR--- 553
             I ID+ DI+++    LR+ + I+ Q+PVL  GTIR N+       P    T +E+    
Sbjct: 1270 QIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNL------DPFDERTDDELWDAL 1323

Query: 554  ----SVAKQCF------------CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARAL 597
                ++AK                H  + KF    D  +   G+  S G++Q +A+ RAL
Sbjct: 1324 VRGGAIAKNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRAL 1381

Query: 598  IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 657
            +++  +LILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL  
Sbjct: 1382 VRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-E 1438

Query: 658  DGSVVEMGKFKELYSNPTSALSQ 680
             G V E       Y  P +  SQ
Sbjct: 1439 KGEVAE-------YDTPWALFSQ 1454

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 106/217 (48%), Gaps = 20/217 (9%)

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514
           + S + FK LNF I  G  + I GP G GKS++   +        G I + N D+  + C
Sbjct: 598 KTSFRGFKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEV-NGDL--LMC 654

Query: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574
                        P + + T+RDNI +G  +   KE+   V   C     +   P    T
Sbjct: 655 GY-----------PWIQNATVRDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKS 633
            IG  G  LSGGQK RI +AR++ KK  + + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKT 761

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             + +  H+LS I R+  VIVLG DG  V++G  +EL
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGK-VDIGTVEEL 795

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 139/563 (24%), Positives = 244/563 (43%), Gaps = 62/563 (11%)

Query: 143  TLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRA 202
            TL T++ + F+ L I I    L   +S  TV +++  ++             +   ++  
Sbjct: 1115 TLSTTTRNTFYYLSIYILLGTLRALIS--TVKVILSYISGL-----------KASRKIFT 1161

Query: 203  HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 262
             ++KK L+    FFD+   G +++R   D   +   +         +L+  +  + ++  
Sbjct: 1162 LLLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGY 1221

Query: 263  LSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 322
            ++P                   +    R   +        + +   E L G+ T+++F  
Sbjct: 1222 ITPVFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRAFGD 1281

Query: 323  E----GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-S 377
            E     + LS+ +   R  F +               + +       +LA G +++L  +
Sbjct: 1282 ERRFLADNLSKVDTHNRPFFYLWVTNRWLAFRIDFIGAFV-------ILASGIFILLNVN 1334

Query: 378  QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTVGHK 435
             L  G     ++Y          L   YS +     +  RL E    +++PS        
Sbjct: 1335 SLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTGLYEPPP 1394

Query: 436  YKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 495
              PDRG IE  ++S  Y +    ++ K++ F + P S V IVG +G GKSTI   L R+ 
Sbjct: 1395 EWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVGRTGAGKSTIITALFRFL 1453

Query: 496  NPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY---------- 545
            +P TGTI +DN DIT +  K LR+ I I+ Q+PVL +GTI+ N+     Y          
Sbjct: 1454 DPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDRIFEALK 1513

Query: 546  ----------TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595
                      TPT  +I S +      N + KF +   + I   G+ LS GQ+Q + +AR
Sbjct: 1514 RVNLIVQEELTPT--DIPSSSSSLSFEN-VNKFLD-LTSEITEGGSNLSQGQRQLVCLAR 1569

Query: 596  ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
            +L++ P  ++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I   + V+  
Sbjct: 1570 SLLRNPKAILLDEATASIDYASDAKIQQTIRE--EFSGSTILTIAHRLRSIIDYDKVL-- 1625

Query: 656  GHDGSVVEMGKFKELYSNPTSAL 678
                 V++ G+  E Y +P + L
Sbjct: 1626 -----VIDSGELAE-YDHPYTLL 1642

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 106/217 (48%), Gaps = 9/217 (4%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITKMNCKSL 517
            K+LN     G    IVGP+G GK+++ + LL   N + G I +   + ++   ++   +
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGM 789

Query: 518 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 577
              IG   Q   L++ T+R+NI +   Y   +    +V   C     +        T +G
Sbjct: 790 TDSIGYCSQSAWLLNDTLRNNILFSAPYEANR--YNAVIHACGLTRDLEILNAGDQTEVG 847

Query: 578 PNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMT 635
             G  LSGGQKQR+++ARA+  +   ++LD+  SA+D  +   I  +   G LM+ ++  
Sbjct: 848 EKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRTCV 907

Query: 636 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYS 672
           +VS  H  +   ++ + +V+  +  V   G+  EL++
Sbjct: 908 LVS--HNTALTLKNADWVVILENAKVTAQGEPLELFN 942

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 143/558 (25%), Positives = 241/558 (43%), Gaps = 60/558 (10%)

Query: 158  PIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD 217
            P F + LY   SFF  A  I    N G++ +L ++       L    +K+ LH    + D
Sbjct: 931  PSFYMGLY---SFFVFAAFI--FMN-GQYTILCVMGIMASKWLNLKAVKRILHTPMSYID 984

Query: 218  NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMMCSLS-PQXXXXXXX 273
               +G +++R   D    + S+  ++++ ++ L      +VGV +MC +  P        
Sbjct: 985  TTPLGRILNRFTKD----TDSLDNELTESLRLLTSQFANIVGVCVMCIVYLPWFAIAIPF 1040

Query: 274  XXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 333
                    A  +    R   +        +     E L G+ T++++ ++   L++ +  
Sbjct: 1041 LLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFL 1100

Query: 334  IRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTE 392
            I  + + G               ++  + + +  L   +     S  S+G L  ++L   
Sbjct: 1101 INKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPISAASVGVLLTYVLQLP 1160

Query: 393  YTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYKPDRGVIEFKD 447
               N +    T     M  A      A+ L  E   RKP ++P    +  P +G I  ++
Sbjct: 1161 GLLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPP---ESWPSKGEIVLEN 1217

Query: 448  VSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 506
            V FSY  RP + +  K+LN  I  G  + I G +G GKSTI   L R    + G I+ID+
Sbjct: 1218 VCFSY--RPGLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDD 1275

Query: 507  QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR-------SV 555
             DI+K+    LRR + I+ Q+PVL  GTIR N+       P    T +E+        ++
Sbjct: 1276 VDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNL------DPFDERTDDELWDALVRGGAI 1329

Query: 556  AKQCF------------CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTV 603
            AK                H  + KF    D  +   G+  S G++Q +A+ RAL+++  +
Sbjct: 1330 AKNDLSEAKLQKPDKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKI 1387

Query: 604  LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 663
            LILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   G V E
Sbjct: 1388 LILDEATSSVDYETDGKIQARIVE--EFGDCTILCIAHRLQTIVNYDRILVL-EKGEVAE 1444

Query: 664  MGKFKELYSNPTSALSQL 681
                  L++   S    +
Sbjct: 1445 FDTPWTLFTQENSIFRNM 1462

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 107/217 (49%), Gaps = 20/217 (9%)

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514
           + S + FK LNF+I  G  + I GP G GKS++   +      T G I + N D+  + C
Sbjct: 598 KTSFRGFKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL--LMC 654

Query: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574
                        P + +  +RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 655 GY-----------PWIQNAPVRDNIIFGSPFI--KEKYNEVIRVCSLKADLDILPAGDMT 701

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKS 633
            IG  G  LSGGQK RI +AR++ K+  + + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKT 761

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             + +  H+LS I R+  VIVLG DG  V++G   EL
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGQ-VDIGTVDEL 795

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 129/493 (26%), Positives = 211/493 (42%), Gaps = 13/493 (2%)

Query: 198  ARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 257
            ARL   + K  L     FF+   VG +++R  +D Y V   + +  S     +   V  +
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTM 1074

Query: 258  GMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 317
             ++CS++ Q                  + +  R   +        +    +E L+G+ TV
Sbjct: 1075 IVICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTV 1134

Query: 318  QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 377
            +SF  +   +      I                       +G +  L       + + Q 
Sbjct: 1135 RSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQG 1194

Query: 378  QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS---ISPTVGH 434
            +L+ G L   + Y      ++  +     E+     +  R+ E TD KP    I PT   
Sbjct: 1195 KLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRP 1254

Query: 435  -KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492
             K  P  G I+F+  S  Y  RP +  I + +N  I P   V IVG +G GKS++ + L 
Sbjct: 1255 PKNWPANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLF 1312

Query: 493  RYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 552
            R      G I+ID+  I  +    LR  + I+ Q+  +  GT R+NI     +  T +EI
Sbjct: 1313 RLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPCNKF--TDDEI 1370

Query: 553  RSVAKQCFC-HNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             +  +      + +T      +T +   G+ LS GQ+Q + +ARAL+    +L+LDEAT+
Sbjct: 1371 WNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATA 1430

Query: 612  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 671
            A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL   G + E      L 
Sbjct: 1431 AIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVLDK-GRIAEFDTPCNLL 1487

Query: 672  SNPTSALSQLLNE 684
             + TS    L NE
Sbjct: 1488 KDETSIFYSLCNE 1500

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 114/238 (47%), Gaps = 18/238 (7%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D ++ +  +P  ++  K++NF+   G   CIVG  G GKS +   +L       G+    
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAMLGDLFRVKGS---- 674

Query: 506 NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 565
                     +L   +  V Q   +M+GTI+DNI +G  Y    E      K C     +
Sbjct: 675 ---------ATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKTIKACALSLDL 723

Query: 566 TKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 624
              P+   T +G  G  LSGGQK R+A+ARA+  K  V  LD+  +A+D   S+  + Y 
Sbjct: 724 NTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYV 783

Query: 625 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLL 682
            G     K+ T +   +++  +  ++++ +L  +G +V+ G + ++ SN  S L +L+
Sbjct: 784 IGPTGLLKTKTRILTTNKIHVLSVADSITLLD-NGVIVQQGSYDQVNSNKDSPLFKLI 840

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  135 bits (340), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 159/317 (50%), Gaps = 29/317 (9%)

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGH---- 434
            LS G +   M Y     N +  +     ++     +  R+ E  D  P   P +      
Sbjct: 1221 LSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPP 1280

Query: 435  KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493
            K  P +G+I FK+ S  Y  R ++  + + L+ +I P   + IVG +G GKST++L L R
Sbjct: 1281 KNWPSQGLIRFKNYSTRY--RANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFR 1338

Query: 494  YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
               P+ GTI ID  DI+K+  K LR ++ I+ Q+     GT+R N+     Y  + EEI 
Sbjct: 1339 ILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIW 1396

Query: 554  SVAKQCFCHNFITKFP----------NTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTV 603
               +       I K            +   T I  NG+ LS GQ+Q + ++RAL+ +  +
Sbjct: 1397 KALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRI 1456

Query: 604  LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 663
            L+LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL       +
Sbjct: 1457 LVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-------D 1507

Query: 664  MGKFKELYSNPTSALSQ 680
             G+ KE + +P++ L+Q
Sbjct: 1508 KGEVKE-FDSPSNLLAQ 1523

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 120/248 (48%), Gaps = 39/248 (15%)

Query: 466 FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI-MIDNQDITKMNCKSLRRH-IGI 523
           F++  G  VC+VG  G GKST    LL       G +  I N           R + + +
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVAL 701

Query: 524 VQQEPVLMSGTIRDNITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 578
             Q+  +M+ +++DN+ +G      TY  T E  + V         +    +  +T++G 
Sbjct: 702 CSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILADGDETLVGE 754

Query: 579 NGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES-----EGAINYTFGQLMKSKS 633
            G  LSGGQK R+++ARA+  +  V +LD+  SA+D E      E  ++   G L+K+K 
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTG-LLKNK- 812

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY-SNPTSALSQLLNE-------- 684
            T++   + +S ++ S+++  L  DG +VE G F ++   + +S L +L+ E        
Sbjct: 813 -TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVECESENTKA 870

Query: 685 RTAPVPSE 692
           +  PV SE
Sbjct: 871 KIEPVDSE 878

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 144/576 (25%), Positives = 248/576 (43%), Gaps = 55/576 (9%)

Query: 153  FDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQD 212
            F  K P F + LY   SFF  A  I     +     + I++ +    L    +K+ LH  
Sbjct: 927  FKNKSPSFYMGLY---SFFVFAAFIFMNGQYTILCAMGIMASK---WLNLKAVKRILHTP 980

Query: 213  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXX 271
              + D   +G +++R   D   +   +T+ +   + +    +VGV +MC +  P      
Sbjct: 981  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1039

Query: 272  XXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 331
                      A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1040 PFLLIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1099

Query: 332  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAFMLY 390
              I  + + G               ++  + + +  L   +     S  S+G +  ++L 
Sbjct: 1100 FLINKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLTYVLQ 1159

Query: 391  TEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYKPDRGVIEF 445
                 N +    T     M  A      A+ L  E   RKP ++P    +  P +G I F
Sbjct: 1160 LPGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPP---ESWPSKGEIAF 1216

Query: 446  KDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 504
            K+V FSY  RP + +  K+LN  I  G  + I G +G GKSTI   L R    + G I+I
Sbjct: 1217 KNVDFSY--RPGLPVVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILI 1274

Query: 505  DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR------- 553
            D+ +I+++    LRR + I+ Q+PVL  GTIR N+       P    T++E+        
Sbjct: 1275 DDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL------DPFNERTEDELWDALVRGG 1328

Query: 554  SVAKQCF------------CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKP 601
            ++AK                H  + KF    D  +   G+  S G++Q +A+ RAL+++ 
Sbjct: 1329 AIAKNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQS 1386

Query: 602  TVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
             +LILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   G V
Sbjct: 1387 KILILDEATSSVDYETDGKIQVRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEV 1443

Query: 662  VEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQV 697
             E      L+S   S    + + R+  V  + + ++
Sbjct: 1444 AEFDTPWALFSQEDSIFKNMCS-RSGIVEEDFENKI 1478

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 108/217 (49%), Gaps = 20/217 (9%)

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514
           + S + FK L+F+I  G  + I GP G GKS++   +      T G I + N D+  + C
Sbjct: 598 KTSFKGFKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL--LMC 654

Query: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574
                        P + + T++DNI +G  +   KE+   V   C     +   P    T
Sbjct: 655 GY-----------PWIQNATVKDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKS 633
            IG  G  LSGGQK RI +AR++ K+  + + D+  SA+D    +  ++     L+++K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKT 761

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             + +  H+LS I ++  VIVLG DG  V++G   EL
Sbjct: 762 RVLAT--HQLSLIEKASRVIVLGTDGD-VDIGTVDEL 795

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 132/544 (24%), Positives = 238/544 (43%), Gaps = 54/544 (9%)

Query: 168  LSFFTVALLIGCVANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 224
            + +  + L+IG   +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLILYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 225  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASV 284
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ                  
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYF 1221

Query: 285  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 344
            +    R   +    +   + +   E L G+ T+++F  EG  +      I +  +     
Sbjct: 1222 YMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYL 1281

Query: 345  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEYTGNAVF 399
                        ++G L    +   G +++     L S ++   LT  + +TE       
Sbjct: 1282 WVANRWLAFRIDMIGSL---VIFGAGLFILFNINHLDSGMAGISLTYAISFTE----GAL 1334

Query: 400  GLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFKDVSFSY-P 453
             L   Y+E+     +  R+ E  + +    P   HK       P  G IE  D+S  Y P
Sbjct: 1335 WLVRLYAEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDLSLRYAP 1392

Query: 454  TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
              P  ++ K+++F +   S + IVG +G GKSTI   L R+  P TG I IDN DI+ ++
Sbjct: 1393 NLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVD 1450

Query: 514  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSV------------AKQC 559
             + LRR I I+ Q+P L SGTI+ N+     ++  K  E ++ V             ++ 
Sbjct: 1451 LQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREA 1510

Query: 560  FCHNFITKFPNT-----YDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 614
               N  T   N        + +   G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D
Sbjct: 1511 DNDNSSTNSENVNKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASID 1570

Query: 615  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNP 674
              S+  I  T  +  + +  TI++IAHRL ++   + ++V+       + G+ KE Y +P
Sbjct: 1571 YGSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHP 1620

Query: 675  TSAL 678
             S L
Sbjct: 1621 YSLL 1624

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 110/234 (47%), Gaps = 11/234 (4%)

Query: 438 PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
           P+     F++ + S+         K LN +   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 498 TTGTIMID----NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
            +G +++      Q++  ++       I    Q   L++ T+++NI +   +   +   +
Sbjct: 749 LSGKVVVPALEPRQELV-VDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEAR--YK 805

Query: 554 SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
           +V + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 614 DVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
           D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 866 DSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 133/543 (24%), Positives = 240/543 (44%), Gaps = 60/543 (11%)

Query: 170  FFTVALLIGCVA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 225
            F  +  LIG  +    N    ILL   + R   +L  ++    ++   +FF+   +G ++
Sbjct: 1006 FVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRIL 1065

Query: 226  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVF 285
            +R  +D   V  ++        K++   ++ V ++    P                  +F
Sbjct: 1066 NRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFLVFCLFLMVIYIYYQKLF 1125

Query: 286  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQ 339
              Q R   +    +   +  +  E L G+  +++      F    NE  ++N  I  +F 
Sbjct: 1126 IVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQFN--INCVFD 1183

Query: 340  VGXXXXXXXXXXXXXXSLL----GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 395
                            +L+    G LS  T+ +          L+ G +   M Y     
Sbjct: 1184 YRSTNRWLSIRLQTIGALMVLITGMLSLSTISS-------SKPLTAGMVGLLMSYVLQVT 1236

Query: 396  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP-----DRGVIEFKDVSF 450
             ++  +      I  G  +  R+ E  +  PS +  +   Y+P      +G I+FK+ S 
Sbjct: 1237 TSLMWIVRSSVMIETGIVSVERIMEYCEL-PSEAEQIVDDYRPASNWPSKGAIQFKNYST 1295

Query: 451  SYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 509
             Y  R ++  + K+++  I PG  V IVG +G GKST+ L L R   P  GTI+ID  DI
Sbjct: 1296 RY--RANLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDI 1353

Query: 510  TKMNCKSLRRHIGIVQQEPVLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQ 558
            +K+    LR H+ I+ Q+     GT+R N           +   +T +  K  ++ + ++
Sbjct: 1354 SKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEE 1413

Query: 559  CFCHNFITKFP-NTY-DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616
                   ++ P N Y +  I  +G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+++DVE
Sbjct: 1414 SG-----SELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVE 1468

Query: 617  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
            ++  I  T  +    +  TI++IAHR+ T+  S+ ++VL       E G+ KE +++P S
Sbjct: 1469 TDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-------EQGEVKE-FNSPAS 1518

Query: 677  ALS 679
             L+
Sbjct: 1519 LLA 1521

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 133/311 (42%), Gaps = 50/311 (16%)

Query: 374 VLQSQLSIGDLTAFMLYTEYTGNAV-----------FGLSTFYSEIMQGAGAASRLFELT 422
           ++++ +SIG +  F+L  E   + +           F +    +  +  + A+ +  + T
Sbjct: 576 IIETNVSIGRVKKFLLGEELDRSFIEEIADKHDESPFAVEILNATFLWKSKASLQAGDGT 635

Query: 423 DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGR 482
           D + SI  TV          +  KD+ F               F+       C+VG  G 
Sbjct: 636 DEETSIGSTV----------VALKDIDF---------------FRAKKNVLTCVVGRVGS 670

Query: 483 GKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 542
           GK+T+   +L     T+G+     Q             +    QE  +M+ +I++NI +G
Sbjct: 671 GKTTLLKSILGQLPCTSGS-----QKAIPPKLIIRGESVAYCPQEAWIMNDSIKENILFG 725

Query: 543 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPT 602
             Y  T   +    K C         P+  +T++G  G  LSGGQK R+++ARA+  +  
Sbjct: 726 HRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQKARLSLARAVYSRSD 783

Query: 603 VLILDEATSALDVESEGAINYTF----GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 658
           + +LD+  SA+D     +I +        L+K+K+  I+   + +S +  S+ + VL  D
Sbjct: 784 IYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKA--IILTTNDISVLEHSDRIYVL-QD 840

Query: 659 GSVVEMGKFKE 669
           G ++E   + E
Sbjct: 841 GRIIEESTYAE 851

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 151/285 (52%), Gaps = 15/285 (5%)

Query: 407  EIMQGAGAASRLFELTDRKPSISPTVGHKYKP-----DRGVIEFKDVSFSYPTRPSVQ-I 460
            E+     +  R+ E +D K S +P V   ++P     D G I+F+  S  Y  RP +  I
Sbjct: 1230 EVETNIVSVERIKEYSDLK-SEAPAVIEDHRPAETWPDEGDIKFEHYSTRY--RPELDLI 1286

Query: 461  FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
             K +N  I P   V IVG +G GKS++ L L R    ++G I+IDN  I ++    LR  
Sbjct: 1287 LKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSGRIVIDNVPINEIGLYDLRHK 1346

Query: 521  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVIGPN 579
            + I+ Q+  +  GT+R+NI     Y  T E+I +V       + I    +   +  +   
Sbjct: 1347 LSIIPQDSQVFEGTVRENIDPTNEY--TDEQIWNVLALSHLKDHIISMGDEGLNNQLTEG 1404

Query: 580  GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 639
            G  LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++  I  T     K +  TI++I
Sbjct: 1405 GNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDKVIQETIRTAFKDR--TILTI 1462

Query: 640  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
            AHR++TI  S+ +IVL  +G++ E    ++L  NP+S    L  E
Sbjct: 1463 AHRINTIMDSDRIIVLD-NGTIKEFDSPEKLLENPSSLFYSLCQE 1506

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 124/243 (51%), Gaps = 24/243 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L             
Sbjct: 628 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSIL------------- 674

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    ++  ++  V Q   +M+GT+++NI +G  Y   ++  +   K C     
Sbjct: 675 -GDLFRVKGFATIHGNVAYVSQVAWIMNGTVKENILFGHKYD--EDFYQKTIKACALTID 731

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   + +
Sbjct: 732 LAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEH 791

Query: 624 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+ +K+  + +  +++S +  +++V +L  +G +V+ G + E+  + +S LS+L
Sbjct: 792 VLGPNGLLHTKTKVLAT--NKVSVLSIADSVSLL-ENGEIVQQGTYDEIMKDDSSPLSKL 848

Query: 682 LNE 684
           + E
Sbjct: 849 ITE 851

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 143/552 (25%), Positives = 243/552 (44%), Gaps = 62/552 (11%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + +Y F  F     +     N  +F LL  L  R    L    +++ LH    + D  
Sbjct: 899  FYMGMYSFFVFGAYLFM-----NL-QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTT 952

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGV---VGVGMMCSLS-PQXXXXXXXXX 275
             +G +++R   D    + S+  ++++ ++ ++  V   +GV +MC +  P          
Sbjct: 953  PLGRILNRFTKD----TDSLDNELTESIRLMLSQVGNLIGVIVMCIVYLPWFAIAVPFLL 1008

Query: 276  XXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 335
                     +    R   +        +     E L G+ T++++ ++   L++ +  I 
Sbjct: 1009 IIFVLICDHYQSTGREIKRLEAVQRSFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLIN 1068

Query: 336  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----SQLSIGDLTAFMLYT 391
             + + G               LL  ++ +  L      V +    S  S+G L  ++L  
Sbjct: 1069 KMNEAGYLIVAVQRWVAI---LLDSVAVVFALIITLLCVTRAFPISAGSVGVLLTYVLQL 1125

Query: 392  EYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKPSISPTVGHKYKPDRGVIEFK 446
                N +    T     M  A      A     E   RKP +SP    +  P++G I+F 
Sbjct: 1126 PGLLNTILRALTQTENDMNSAERLVTYATELPLEAAYRKPEVSPP---ESWPEKGDIDFI 1182

Query: 447  DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
            DV+F+Y  RP + +  K++N KI  G  + I G +G GKSTI   L R    + G I+ID
Sbjct: 1183 DVNFAY--RPGLPVVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVID 1240

Query: 506  NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE---------EIRS-V 555
              DI K+    LR+ + I+ Q+PVL  GTIR N+       P KE          IR+ V
Sbjct: 1241 GVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNL------DPFKECSDDLLWDALIRTGV 1294

Query: 556  AKQCFCHNFITKFP---NTY--------DTVIGPNGTLLSGGQKQRIAIARALIKKPTVL 604
             ++   ++   + P   N+Y        D ++   G+  S G++Q +A+ RAL++   +L
Sbjct: 1295 VERENLNDIKLEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKIL 1354

Query: 605  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 664
            ILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   G + E 
Sbjct: 1355 ILDEATSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEY 1411

Query: 665  GKFKELYSNPTS 676
             K  EL+++  S
Sbjct: 1412 EKPWELFNDKNS 1423

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 108/224 (48%), Gaps = 24/224 (10%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F  LN +I  G  + + GP G GK+++   +  +   T+G + ++ +             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTVIGP 578
             ++   P +++ T+RDNI +G  Y    EE R   + + C     +   P    T IG 
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 579 NGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIV 637
            G  LSGGQK RI +ARA+ K   + + D+  SA+D    +  ++     ++K K+  + 
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILA 742

Query: 638 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
           +  H+LS I R++ +IV+G +GS  + G   EL     + +S L
Sbjct: 743 T--HQLSVIERADRIIVVGPNGS-FDFGTLDELKGRNQTLVSLL 783

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 138/570 (24%), Positives = 254/570 (44%), Gaps = 59/570 (10%)

Query: 138  GIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVAL---LIGCVANFGRFILLRILSE 194
             I+L++  + S S++   K+   +   Y  + +F + L   ++G +     F  + I + 
Sbjct: 1072 NILLNSCDSKSASEYVTQKVNNHTTKYY-LIIYFAIGLAHSILGSIKTMLSF-YVGINAS 1129

Query: 195  RVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGV 254
            R + +L   ++ K LH    FFD+  +G +++R   D   + + +T  V   V   +  +
Sbjct: 1130 RKIFKL---LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLI 1186

Query: 255  VGVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGI 314
              V ++  ++                    +    R   +        + +   E L G+
Sbjct: 1187 ATVLLITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGV 1246

Query: 315  KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV 374
             T++++   G+E+      +  I +                  +  +  L +   G  ++
Sbjct: 1247 TTIRAY---GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFGAGVLVL 1303

Query: 375  LQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKPS 427
            +      S L+   LT  + +TE    +   L   YS +     +  R+ E  D  ++P 
Sbjct: 1304 MNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQEPY 1359

Query: 428  ISPTVG-HKYKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 485
             +  V   K  P  G IE  D+S  Y P+ P  ++ K+++F + P   V +VG +G GKS
Sbjct: 1360 SAGIVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGKS 1417

Query: 486  TIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 545
            TI   L R+ +P TG I IDN DIT ++ K LR+ I I+ Q+P L +GTI+ N+     Y
Sbjct: 1418 TIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEY 1477

Query: 546  TPTK-----------------EEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQK 588
               +                  ++ SV+ +      + KF N   + I   G+ LS GQ+
Sbjct: 1478 NDDQIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLNL-QSEISEGGSNLSQGQR 1531

Query: 589  QRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 648
            Q + +AR+L++ P +++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++  
Sbjct: 1532 QLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVID 1589

Query: 649  SENVIVLGHDGSVVEMGKFKELYSNPTSAL 678
             + ++V+       + G+ KE Y +P S L
Sbjct: 1590 YDKILVM-------DAGEVKE-YDHPYSLL 1611

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 111/229 (48%), Gaps = 11/229 (4%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           I  ++V+ S+  +      ++LN     G    ++GP+G GK+++ + LL   +   G I
Sbjct: 698 ISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEGKI 757

Query: 503 MIDNQD---ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
            + + D       +   L   +    Q   L++ T+++NI +   Y   +E   +V   C
Sbjct: 758 TVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEYN--EERYLAVISAC 815

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                         T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +  
Sbjct: 816 ALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHTAA 875

Query: 620 AI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHDGSVVEMG 665
            I  N   G LM++++  +VS  H ++ T++ +E VI++  +G +  +G
Sbjct: 876 WIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMI-DNGKISHIG 921

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 132/508 (25%), Positives = 217/508 (42%), Gaps = 57/508 (11%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++   LH    FFD   +G +++R   D   V + +T  +      L+  V  + ++  +
Sbjct: 1164 LLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTMLLIAFI 1223

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +PQ                  +    R   +        + +   E L GI T++++  E
Sbjct: 1224 TPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTIRAYGDE 1283

Query: 324  G----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ--- 376
                   L + +   +  F +               SL+       V   G +++L    
Sbjct: 1284 KRFMLENLHKIDENNKPFFYLWAFNRWLSFRIDMIGSLV-------VFGAGVFIILNIDN 1336

Query: 377  --SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP-----S 427
              S L+   LT  + +TE    A   L  FY+++     +  RL E    D++P      
Sbjct: 1337 LDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQEPYEEHLE 1392

Query: 428  ISPTVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKST 486
             S  +     P  G IE  ++S  Y P  P  ++ K++ F + P   V +VG +G GKST
Sbjct: 1393 RSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVVGRTGAGKST 1450

Query: 487  IALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN-------- 538
            I   L R+ +  TG I ID+ DIT +N   LRR I I+ Q+P L SGTIR N        
Sbjct: 1451 IITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDPYNEFS 1510

Query: 539  ---ITYGLTYTPTKEEIRSVAKQCFCHNF-----ITKFPNTYDTVIGPNGTLLSGGQKQR 590
               I   L       E  S        +      + KF N  +  I   G  LS GQ+Q 
Sbjct: 1511 DDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNE-ITEGGNNLSHGQRQL 1569

Query: 591  IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 650
            + +AR+L++ P +++LDEAT+++D  S+  I  T  +  + K  TI++IAHRL ++   +
Sbjct: 1570 VCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAHRLRSVCDYD 1627

Query: 651  NVIVLGHDGSVVEMGKFKELYSNPTSAL 678
             ++V+       + G+ KE Y +P S L
Sbjct: 1628 KILVM-------DAGEVKE-YDHPYSLL 1647

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 115/229 (50%), Gaps = 11/229 (4%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           I F++ + ++  + S    + LN    PG    ++GP+G GKS++ L LL   +   G I
Sbjct: 731 IAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNI 790

Query: 503 MI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
           ++   D +D   ++   +   I    Q   L++ T+R+NI +   Y   +     V   C
Sbjct: 791 IVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEARYN-AVVEACC 849

Query: 560 FCHNF-ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
              +F I K  +   T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 850 LKRDFEILKAGDM--TEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTA 907

Query: 619 GAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
             I  N   G LM++++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 908 LWIYDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 140/548 (25%), Positives = 240/548 (43%), Gaps = 51/548 (9%)

Query: 170  FFTVALLIG----CVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 225
            F  V  LIG       N    ++L   S R   +L  ++ K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLIGVGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRII 1079

Query: 226  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVF 285
            +R  SD   V  S+    S   K+++  +V V ++    P                 + +
Sbjct: 1080 NRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQTFY 1139

Query: 286  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQ 339
                R   + +  +   +  +  E L+G   +      + F+    E  +YN+     F+
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFR 1199

Query: 340  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAV 398
                             +L      T +   + +  + QLS G +   M Y+ E TG+  
Sbjct: 1200 STNRWLSVRLQTIGATIVLA-----TAMLALTTMNTKKQLSSGMVGLLMSYSLEVTGSLT 1254

Query: 399  FGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD-----RGVIEFKDVSFSYP 453
            + + T    I     +  R+ E  +  PS + ++  + +PD     +G IEFK+ S  Y 
Sbjct: 1255 WIVRTTVM-IETNIVSVERIVEYCEL-PSEARSINPENRPDESWPSKGSIEFKNYSTKY- 1311

Query: 454  TRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKM 512
             R ++  + K +N +I P   + IVG +G GKST++L L R   PT G+I+ID+ +I+ +
Sbjct: 1312 -RENLDPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDL 1370

Query: 513  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK-------------------EEIR 553
                LR H+ I+ Q+     GT+R N+     Y+  +                    EIR
Sbjct: 1371 GLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIR 1430

Query: 554  SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
                    +  ++   N     I  NGT LS GQ+Q + +ARAL+ +  +L+LDEAT+++
Sbjct: 1431 GADGAAEENGNVSDVLNVK---INENGTNLSVGQRQLLCLARALLNRSKILVLDEATASV 1487

Query: 614  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL  +G+V E     +L S+
Sbjct: 1488 DMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLSD 1544

Query: 674  PTSALSQL 681
              S    L
Sbjct: 1545 KASIFYSL 1552

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 159/336 (47%), Gaps = 44/336 (13%)

Query: 395 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTVGHKYKPDRGVIEFKD 447
            +A++ + +  + I++ + +  RL  F L+D         I P++  +  P   VIE  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP---VIEMNN 619

Query: 448 VSFSYPTRPSV--------------------QI-FKSLN-FKIAPGSSVCIVGPSGRGKS 485
           ++F + ++ ++                    QI  K+++ F+   G  VC+VG  G GKS
Sbjct: 620 ITFLWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKS 679

Query: 486 TIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 545
           T    +L      +G+         K+  ++    +    QE  +M+ ++R+NI +G  +
Sbjct: 680 TFLKGILGQLPCMSGS---KGSIPPKLIIRA--SSLAYCSQESWIMNSSVRENILFGHKF 734

Query: 546 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI 605
                ++    K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  + +
Sbjct: 735 DKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYL 792

Query: 606 LDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 663
           LD+  SA+D E S+  + Y   G+    K+ TI+   + +  ++ S+ +  L  +G ++E
Sbjct: 793 LDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYAL-ENGEIIE 851

Query: 664 MGKFKELYS--NPTSALSQLLNERTAPVPSEQQQQV 697
            G ++ + +  N  S L +LL E  +P+ +  +  +
Sbjct: 852 QGNYEGVMNRENTNSKLKKLLEEFDSPIDNGSKSDI 887

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 128/506 (25%), Positives = 222/506 (43%), Gaps = 53/506 (10%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++ K LH    FFD    G +++R   D   + + +T  +     +LI  +  V ++  +
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +PQ                  +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1201 TPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQ 378
            G  +      I +  +                 ++G L    +   G +++     + S 
Sbjct: 1261 GRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNIDHIDSG 1317

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK--- 435
            ++   LT  + +TE        L   YSE+     +  R+ E    K    P   HK   
Sbjct: 1318 MAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYM--KIEQEPYNQHKEVP 1371

Query: 436  --YKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492
                P  G IE  D+S  Y P  P  ++  +++F +   S + IVG +G GKSTI   L 
Sbjct: 1372 PSQWPQDGKIEVNDLSLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAGKSTIITALF 1429

Query: 493  RYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--E 550
            R+  P TG I IDN DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++  K  E
Sbjct: 1430 RFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKKIFE 1489

Query: 551  EIRSV---------------AKQCFCHNF---ITKFPNTYDTVIGPNGTLLSGGQKQRIA 592
             ++ V               A      N    I KF +   + +   G+ LS GQ+Q + 
Sbjct: 1490 ALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFLDL-SSEVSEGGSNLSQGQRQLMC 1548

Query: 593  IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 652
            +AR+L++ P +++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + +
Sbjct: 1549 LARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKI 1606

Query: 653  IVLGHDGSVVEMGKFKELYSNPTSAL 678
            +V+       + G+ KE Y +P S L
Sbjct: 1607 LVM-------DAGEVKE-YDHPYSLL 1624

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 100/211 (47%), Gaps = 11/211 (5%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID----NQDITKMNCKS 516
            K LN +   G    ++GP+G GK+++ + LL       G I++      Q++  ++   
Sbjct: 712 LKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKIVVPALEPRQELV-VDANG 770

Query: 517 LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVI 576
               I    Q   L++ TI+ NI +   +   +   ++V + C              T I
Sbjct: 771 TTNSIAYCSQGAWLLNDTIKHNILFNSPFNEAR--YKAVVEACGLKRDFEILKAGDLTEI 828

Query: 577 GPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSM 634
           G  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  N   G LM+ ++ 
Sbjct: 829 GEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTC 888

Query: 635 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
            +VS  H ++   R+  ++VL  DG + + G
Sbjct: 889 ILVS--HNIALTLRNAELVVLLEDGRIKDQG 917

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 136/509 (26%), Positives = 223/509 (43%), Gaps = 56/509 (11%)

Query: 208  TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQX 267
             LH    FFD   VG +++R   D   + + +   +   V  LI     + ++  ++P+ 
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILLLIVVITPRF 1141

Query: 268  XXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNEL 327
                             + K  R+  +        + +   E L G+ T+++F   G+E 
Sbjct: 1142 FSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVCTIRAF---GDEK 1198

Query: 328  SRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIG 382
                  +  I Q                  +  +    VL  GS+++     + S L+  
Sbjct: 1199 RFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFILFNIDNIDSGLAGI 1258

Query: 383  DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY------ 436
             LT  +L+T+    +   L   YS       +  RL E        S  V  KY      
Sbjct: 1259 SLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEY-------SSIVQEKYLGYDED 1307

Query: 437  ---------KPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI 487
                      P  G IE +++S  Y +   + + K++ FK+ P S V IVG +G GKSTI
Sbjct: 1308 HIQALNDSSWPKHGKIEVENLSLRYASNLPL-VLKNVCFKVDPQSKVGIVGRTGAGKSTI 1366

Query: 488  ALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
               L R   P TG I ID+QDI+K++  +LRR I I+ Q+PVL +GTI+ NI     Y  
Sbjct: 1367 IAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSNIDPHDEYDE 1426

Query: 548  TK--------EEIRSVA-KQCF----CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIA 594
             +          I S+  KQ F      N   KF N    ++   G  LS G++Q + IA
Sbjct: 1427 RRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIV-EGGLNLSQGERQLLFIA 1485

Query: 595  RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSENV 652
            R+L+++  +++LDEATS++D +S+  I      +++SK    TI++IAHRL ++   + +
Sbjct: 1486 RSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIAHRLRSVIYYDKI 1541

Query: 653  IVLGHDGSVVEMGKFKELYSNPTSALSQL 681
            +V+   G + E G   EL  N  S   ++
Sbjct: 1542 LVMDA-GEIKEYGHPYELLKNERSTFYRM 1569

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 114/242 (47%), Gaps = 14/242 (5%)

Query: 438 PDRGVIEFKDVSFSYPTRPS-VQIFK--SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 494
           PDR  IEFK  +  +    + +  FK   LN   + G    ++G +G GKS + + LL  
Sbjct: 659 PDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGE 718

Query: 495 YNPTTGTIMIDN----QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 550
            +  +G I+I       D+   +   L        Q   L+S TI++NI +  +Y   K 
Sbjct: 719 LDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYD--KS 775

Query: 551 EIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEAT 610
             + V   C  +  +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  
Sbjct: 776 RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCL 835

Query: 611 SALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 668
           SA+D  +   I  N   GQLMK++  T + + H +    R+ +  ++  DG V   G  K
Sbjct: 836 SAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTIK 893

Query: 669 EL 670
           EL
Sbjct: 894 EL 895

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 133/249 (53%), Gaps = 9/249 (3%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 496
            P  G I+F++ S  Y  RP +  + K++N  I P   V IVG +G GKS++ L L R   
Sbjct: 1266 PTEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIE 1323

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
             T G I+ID   I ++    LR  + I+ Q+  +  GT+R+NI    T   T EEI  V 
Sbjct: 1324 ATAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVL 1381

Query: 557  KQCFCHNFITKF-PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
            +       +     +  D  +   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+DV
Sbjct: 1382 ELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1441

Query: 616  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT 675
            E++  +  T     K +  TI++IAHRL+TI  S+ +IVL   G +VE     EL + P 
Sbjct: 1442 ETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-KGEIVEFDTPDELLAKPE 1498

Query: 676  SALSQLLNE 684
            S    L NE
Sbjct: 1499 SLFYSLCNE 1507

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 141/286 (49%), Gaps = 24/286 (8%)

Query: 406 SEIMQGAGAASRLFE-LTD---RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI- 460
           +  ++ + + +RLF  LT+   +K SI      + K D  +    + +F +  +P  ++ 
Sbjct: 583 TSFVEASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINLGDNATFLWKRKPEYKVA 642

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN-CKSLRR 519
            K++NF+   G   CIVG  G GKS +   +L               D+ ++    ++  
Sbjct: 643 LKNINFQAKKGDLTCIVGKVGSGKSALIQSIL--------------GDLFRVKGFATVHG 688

Query: 520 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPN 579
           ++  V Q P +M+GT+++NI +G  Y   +E      K C     +    +   T++G  
Sbjct: 689 NVAYVSQVPWIMNGTVKENILFGHKYD--QEFYEKTIKACALTIDLGILVDGDQTLVGEK 746

Query: 580 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 638
           G  LSGGQK R+++ARA+  +    +LD+  +A+D   S+  + +  G      S T V 
Sbjct: 747 GISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSKTKVL 806

Query: 639 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
             +++S +  ++++ +L  +G +V+ G ++E+ S+  S L +L+ E
Sbjct: 807 CTNKISVLSIADSITLL-ENGEIVQQGSYEEVNSDEDSPLFKLIKE 851

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 156/310 (50%), Gaps = 37/310 (11%)

Query: 393  YTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP----SISPTVGHKYKPDRGVIEFK 446
            +T  A++ L  FYSE+     +  R+ E    +++P     +S +      P+ G IE  
Sbjct: 1322 FTEGALW-LVRFYSEVEMNMNSVERVHEYMTIEQEPYDEVQVSDSKVPADWPEEGRIEVS 1380

Query: 447  DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 506
            D+S  Y      ++ K++ F + P + V +VG +G GKSTI   L R+    TG I ID 
Sbjct: 1381 DLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGRTGAGKSTIITALFRFLEAETGYIKIDG 1439

Query: 507  QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEIR 553
             DIT +N   LRR I I+ Q+P L SGTI+ N+     Y               T+EE+ 
Sbjct: 1440 LDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDEYKDEEVFEALRRVNLVTEEELS 1499

Query: 554  SVAKQ-----CFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDE 608
            S  +            I +F +  ++ I   GT  S GQ+Q I +AR+L++ P +L+LDE
Sbjct: 1500 SRTENNNDEASVSSKNINRFLDL-ESEIAEGGTNFSQGQRQLICLARSLLRSPKILLLDE 1558

Query: 609  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 668
            AT+++D +S+  +  T     +    TI++IAHRL ++   + ++V+G        G+ K
Sbjct: 1559 ATASIDYDSDAKVQETIRT--EFSESTILTIAHRLRSVIDYDKILVMG-------AGEVK 1609

Query: 669  ELYSNPTSAL 678
            E Y +P S L
Sbjct: 1610 E-YDHPYSLL 1618

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 115/234 (49%), Gaps = 13/234 (5%)

Query: 439 DRGVIEFKDVSFSYP-TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
           ++  I FK+ + ++  +R S ++ ++LN     G    I+GP+G GK+++ + LL   N 
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKL-RNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNL 755

Query: 498 TTGTIMI----DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
             G I++       D+  +        I    Q   L++ T+R+NI +   Y  T+    
Sbjct: 756 LEGQIVVPALNARHDLI-VESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YH 812

Query: 554 SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
           +V + C              T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+
Sbjct: 813 NVVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAV 872

Query: 614 DVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
           D  +   +  N   G LM+ ++  +VS  H ++   R+ +++V+  DG V + G
Sbjct: 873 DAHTALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 100/337 (29%), Positives = 164/337 (48%), Gaps = 34/337 (10%)

Query: 359  GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 418
            G +  +T L   + +  + Q++ G +   M Y     N++  +    + I     +  R+
Sbjct: 1222 GAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERI 1281

Query: 419  FELTDRKPSISPTVGHKYKPDR-----GVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGS 472
            +E   + PS +P +    +P++     G I FKD S  Y  RP +  + K +N  I P  
Sbjct: 1282 YEYC-QLPSEAPAIIESSRPEKSWPSMGEIIFKDYSTKY--RPELDPVLKKINLSIKPRE 1338

Query: 473  SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMS 532
             + +VG +G GKS+++L L R    T G+I ID  DI+K+    LR H+ I+ Q+     
Sbjct: 1339 KIGVVGRTGAGKSSLSLALFRLLESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFE 1398

Query: 533  GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-----PN---------TYDTVIGP 578
            GT+R N+     Y+   +EI    +       I K      P+           D  I  
Sbjct: 1399 GTVRSNLDPFNQYSV--QEIWKAVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISE 1456

Query: 579  NGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 638
            NG  +S GQ+Q + ++RAL+ K  VL+LDEAT+A+D+E++  I  T     + K  TI++
Sbjct: 1457 NGNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILT 1514

Query: 639  IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT 675
            IAHR+ T+  S+ ++VL       + G+ KE  S  T
Sbjct: 1515 IAHRIDTVLDSDKILVL-------DKGEVKEFESPDT 1544

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 117/238 (49%), Gaps = 17/238 (7%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIV 524
           +F+   G+  C+VG  G GKST+   +L      +G      ++          R +   
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGP-----KEFISPEILVRARSVAYC 715

Query: 525 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
            Q P +M+ +I+DNI +G  Y  T   +    K C     +       +T++G  G  LS
Sbjct: 716 PQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISLS 773

Query: 585 GGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIA 640
           GGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G+   L+K K  TI+   
Sbjct: 774 GGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTT 831

Query: 641 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYS-NPTSALSQLLNE--RTAPVPSEQQQ 695
           + +S ++ S N+I     G +VE G +++  S    S L +L+ E    A  PS++++
Sbjct: 832 NAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAENPSDKKK 888

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 129/508 (25%), Positives = 227/508 (44%), Gaps = 59/508 (11%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++ + LH    FFD+  +G +++R   D      S+ Q++   ++++    + V     L
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFATLLL 1184

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQS 319
                               S+ G     TS++L+     +   + +   E L G+ T+++
Sbjct: 1185 ISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRA 1244

Query: 320  FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ--- 376
            F  +     + N+++ D  Q                  +  +  L + + G +++L    
Sbjct: 1245 F-GDEQRFIKENLSMID--QNSMPFFYLWVVNRWLSFRIDLIGALVIFSSGVFILLNINN 1301

Query: 377  --SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTV 432
              + L+   LT  + +TE    A   L   YSE+     +  R+ E    +++P I+   
Sbjct: 1302 IDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPA 1357

Query: 433  GH----KYKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI 487
                     PD G +E  ++S  Y P  P V   K + F I P   V IVG +G GKSTI
Sbjct: 1358 NAVTPPPQWPDSGKVEVNNLSLKYAPHLPYV--IKDVTFTIEPLEKVGIVGRTGAGKSTI 1415

Query: 488  ALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
               L R+    TG+I +D  +I  ++ K LRR I I+ Q+P L +G+IR N+     Y  
Sbjct: 1416 ITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPYDEY-- 1473

Query: 548  TKEEIRSVAK-----------------QCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQR 590
            + EEI +  K                 Q      + KF N  ++ I   G+  S GQ+Q 
Sbjct: 1474 SDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLNL-ESEIAEGGSNFSQGQRQL 1532

Query: 591  IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 650
            + +AR+L++ P V++LDEAT+++D  S+  I  T  Q  +  + T+++IAHRL +I   +
Sbjct: 1533 MCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHRLRSIVDYD 1590

Query: 651  NVIVLGHDGSVVEMGKFKELYSNPTSAL 678
             ++V+       + G+ KE + +P S L
Sbjct: 1591 KILVM-------DAGEVKE-FDHPYSLL 1610

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 110/233 (47%), Gaps = 9/233 (3%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           + F++V+  + +     + ++L+ +   G    IVG +G GK++I + LL     + G I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 503 MIDN---QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
           ++ +   +   +     +   I    Q   L++ T+R+NI +   +   + +  +V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEAC 823

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                         T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 620 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            I      G LM+ +  T + + H ++   ++ + +V+  DG V E G   EL
Sbjct: 884 WIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIEL 934

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 143/270 (52%), Gaps = 28/270 (10%)

Query: 420  ELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGP 479
            E T  KP  SP  GH + P+ G I+FKD +F Y     + I K+ N  +  G  + I G 
Sbjct: 782  ERTSSKPETSP--GHIW-PENGKIQFKDANFRYKEGLPL-ILKNFNMLVQSGEKIGICGR 837

Query: 480  SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 539
            +G GKSTI   L R    T G I ID+ DI+ +    LR+++ I+ Q+P+L  GTIR N+
Sbjct: 838  TGAGKSTIMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNL 897

Query: 540  ---TYGLTYTPTKEEIRS--VAKQCFCH--------NFITKFPNTYDTVIGPNGTLLSGG 586
               +Y    T  +  I S  + +  F H          +TKF  T    +  +GT  S G
Sbjct: 898  DPFSYFDDATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKFHLT--AHVEEDGTNYSLG 955

Query: 587  QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM---TIVSIAHRL 643
            +KQ +A  RA+I    V++LDEA+S++D E++  I     Q + SK     TI+ IAHRL
Sbjct: 956  EKQLLAFTRAIIHHSKVVVLDEASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRL 1010

Query: 644  STIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            +TI + + ++VL H G+++     + L+ N
Sbjct: 1011 NTILKYDRILVLDH-GNIIGFENPRVLFEN 1039

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 108/220 (49%), Gaps = 27/220 (12%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F +LNF I  G  + I GP G GK+++   +        GTI ID               
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEID--------------- 248

Query: 521 IGIVQ--QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 578
            G +Q    P + + T+RDNI +G  Y   KE+   V + C     +  F     T IG 
Sbjct: 249 -GNLQLCGYPWVQNTTVRDNIIFGSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGE 305

Query: 579 NGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTI 636
            G  LSGGQK RI +ARA+ K   + + D+  SA+D      I  N   G L   K+  I
Sbjct: 306 LGITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXI 364

Query: 637 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY-SNPT 675
           ++  H+LS I++++ ++VLG+D S  E+G +KEL  SN T
Sbjct: 365 LA-THQLSLIKKADRIVVLGNDNS-FEIGPYKELIQSNKT 402

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 131/249 (52%), Gaps = 9/249 (3%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 496
            P +G I+F++ S  Y  RP +++  K +N  I P   + IVG +G GKS++ L L R   
Sbjct: 1253 PSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1310

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
              +G I ID   I  +  + LR H+ I+ Q+  L  GTIR+NI     Y  T E+I    
Sbjct: 1311 AASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEY--TDEQIWRAL 1368

Query: 557  KQCFCHNFITKF-PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
            +     + +        D  +   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+DV
Sbjct: 1369 ELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1428

Query: 616  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT 675
            E++  I  T     K++  TI++IAHR++TI  S+ ++VL   G V E      L  NP 
Sbjct: 1429 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPE 1485

Query: 676  SALSQLLNE 684
            S    L  E
Sbjct: 1486 SLFYSLCYE 1494

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 124/242 (51%), Gaps = 24/242 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF    G   C+VG  G GKS +   +L             
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL------------- 667

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    S+   I  V Q P +M+GT++DNI +G  Y  +   +    K C     
Sbjct: 668 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVD 724

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           +   P    T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + +
Sbjct: 725 LAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEH 784

Query: 624 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+ SK+  + +  ++++ +  ++++ +L  +G +++ G + ++ S  +SALS++
Sbjct: 785 VLGPNGLLASKTKVLAT--NKITVLSIADHIALL-ENGEIIQQGSYDDVTSAKSSALSKI 841

Query: 682 LN 683
           ++
Sbjct: 842 IS 843

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 136/256 (53%), Gaps = 15/256 (5%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
            P RG IEFK+ + +Y    S  + K+++  I P   V IVG +G GKST++L L R    
Sbjct: 1281 PQRGSIEFKNYTTTYRANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEA 1339

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 557
              GTI ID  DI+++    LR ++ I+ Q+     GT+R N+     +T    E+ +V +
Sbjct: 1340 AEGTIFIDGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV--ELWNVIE 1397

Query: 558  QCFCHNFITKFPNT---------YDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDE 608
                   + +              D  I  NG+ LS GQ+Q + +ARAL+ +  VL+LDE
Sbjct: 1398 LSHLKPHVLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDE 1457

Query: 609  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 668
            AT+A+DVE++  I  T     K +  TI++IAHRL TI  ++ ++VL   G V E    K
Sbjct: 1458 ATAAVDVETDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVLDA-GGVKEFDSPK 1514

Query: 669  ELYSNPTSALSQLLNE 684
             L S+ ++   QL ++
Sbjct: 1515 NLLSDESTLFYQLCDK 1530

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 116/230 (50%), Gaps = 22/230 (9%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT-KMNCKSLRRHIGI 523
           +F  +P S  C++G  G GK+T+   +L      +G+     + I+ K++ +     I  
Sbjct: 646 HFTASPKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG--ESIAY 699

Query: 524 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLL 583
             QE  +M+ TI++NI +G  +  T   +   A +      I   P+   T++G  G  L
Sbjct: 700 CPQEAWIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGEKGISL 757

Query: 584 SGGQKQRIAIARALIKKPTVLILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIVS 638
           SGGQK R+++ARA+  +  + +LD+  SA+D        E  ++   G L+++K  T++ 
Sbjct: 758 SGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK--TVIL 814

Query: 639 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY----SNPTSALSQLLNE 684
             + +S ++ S+ +  L  +G +VE G + ++     S+  S +S LL +
Sbjct: 815 STNTVSVLKHSQLIYAL-ENGIIVERGNYNDIIESANSDDESKISALLKQ 863

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  129 bits (323), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 145/562 (25%), Positives = 232/562 (41%), Gaps = 92/562 (16%)

Query: 153 FDLKIPIFSLPLYEFLSF---------FTVALLIGCVANFGRFILLRILSERVVARLRAH 203
           F  + P F + LY F  F         FTV   +G  A+  +F+ L+             
Sbjct: 441 FKNRSPSFYMGLYSFFVFGQYMFMNIQFTVLCFLGVTAS--KFLNLK------------- 485

Query: 204 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMM 260
            +K  LH    F D   +G +++R   D    + SM  ++++ ++ +   +  ++GV +M
Sbjct: 486 AVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDIRLMMFQLGNIIGVIVM 541

Query: 261 CSLS-PQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 319
           C +  P                A  +    R   +        +     E L G+ T+++
Sbjct: 542 CIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLDTIRA 601

Query: 320 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 379
           + ++   L + +  I  + + G               +L  +  L +    + L +  Q 
Sbjct: 602 YRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFALII----TLLCVTRQF 657

Query: 380 SI-----GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF--------ELTDRKP 426
            I     G L  ++L      N V    T   +   G  +A RL         E   R+P
Sbjct: 658 KISPSSTGVLLTYVLQLPGLLNTVLRALT---QAENGMNSAERLVTYALDLPQEAEYRRP 714

Query: 427 SISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKS 485
            +SP    +  PDRG I+F+ VSF+Y  RPS+  + K+ +  I  G  + I G +G GKS
Sbjct: 715 EMSPP---ENWPDRGEIKFEGVSFAY--RPSLPPVLKNFSLNIGSGEKIGICGRTGAGKS 769

Query: 486 TIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI------ 539
           TI   L R      G I IDN +I  +    LR  + I+ Q+PVL  GTI+ N+      
Sbjct: 770 TIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEK 829

Query: 540 ---------TYGLTYTPTKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPNGTLLSGG 586
                      G    P  E+I     Q       H+ + KF    +  +   G   S G
Sbjct: 830 TDQELWESLVRGGAIAP--EDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLG 885

Query: 587 QKQRIAIARALIKKPTVLILDEATSALDVESEGAIN----YTFGQLMKSKSMTIVSIAHR 642
           +KQ +A+ RAL++   +LILDEATS++D E++  I       FG        TI+ IAHR
Sbjct: 886 EKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG------DCTILCIAHR 939

Query: 643 LSTIRRSENVIVLGHDGSVVEM 664
           L+TI   + ++VL   G V E 
Sbjct: 940 LNTILNYDRILVL-EQGEVAEF 960

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 122/245 (49%), Gaps = 22/245 (8%)

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514
           + S + F++LNF I  G  + + GP G GK+++   +  +   + G++ ++ +    ++C
Sbjct: 100 KTSFKGFQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGR---LLSC 156

Query: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574
                        P + + T+RDNI +G  Y   K   R V K C   + +   P    T
Sbjct: 157 GY-----------PWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILPAGDMT 203

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKS 633
            IG  G  LSGGQK RI +AR + K   + + D+  SA+D    +  ++     L+  K+
Sbjct: 204 EIGERGINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKT 263

Query: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS--ALSQLLNERTAPVPS 691
             + +  H+L+ I ++  +IVLG+DGS   +G ++EL  + +    L Q  ++++    +
Sbjct: 264 RILAT--HQLALIEKATRLIVLGNDGSFT-IGTYEELQKSNSQLKKLLQFTSDKSEEDDN 320

Query: 692 EQQQQ 696
           +Q+Q 
Sbjct: 321 DQKQN 325

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  129 bits (324), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 115/479 (24%), Positives = 212/479 (44%), Gaps = 41/479 (8%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            ++ + ++    FFDN  +G +++R   D  V+   +   +       I  V  + ++  +
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323
            +P+                 ++    R   +    +   + +   E LSG+ T+++F   
Sbjct: 1199 TPKFLIIAIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRAF--- 1255

Query: 324  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ----- 378
            GNE+      +  I +                  +  L  +TV   G++++L +      
Sbjct: 1256 GNEIKFLKENLDFIDENNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILLNADKIDAG 1315

Query: 379  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP-------SISPT 431
            L+   LT  + +TE+       +  FYS +     +  RL E  + +        +I+P+
Sbjct: 1316 LAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALADPGAITPS 1371

Query: 432  VGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALL 490
               +  P +G I F + S  Y P  P V   K LN KI  GS + +VG +G GKSTI   
Sbjct: 1372 ---ENWPVQGAITFANYSLRYAPKLPDV--LKQLNLKIDGGSKIGVVGRTGAGKSTIISA 1426

Query: 491  LLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 550
            L R+ + ++G I+ID+ DI+++N + LR  + I+ Q+P L  GTIR N+     Y     
Sbjct: 1427 LFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYENKDI 1486

Query: 551  EIRSVAKQCFCHNFITKF-----------PNTY---DTVIGPNGTLLSGGQKQRIAIARA 596
                V       +++               N +   D+ I   G  LS GQ+Q I +AR+
Sbjct: 1487 YDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLICLARS 1546

Query: 597  LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655
            ++    +++LDEAT+++D +S+  +  T       K  TI++IAHR+ ++   + ++VL
Sbjct: 1547 ILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKILVL 1603

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 115/221 (52%), Gaps = 16/221 (7%)

Query: 454 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
            + S Q+ +++N +   G    ++GP+G GK+++ + LL   +  +G + + N + +K N
Sbjct: 726 NKKSFQL-RNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFN 783

Query: 514 C----KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFP 569
                 +L   I    Q P + + TIR+NI + + Y   K+   +V   C          
Sbjct: 784 LIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVVIACGLERDFQILN 841

Query: 570 NTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF---G 626
               T++G  G+ LSGGQKQRI++ARAL  K   LILD+  SA+D  S   I Y     G
Sbjct: 842 LGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWI-YNVCITG 900

Query: 627 QLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHDGSVVEMGK 666
            LM+ ++  +VS  H +S TI+++  V ++  +G +V  G+
Sbjct: 901 PLMQGRTCILVS--HNVSLTIKKASKVFMI-ENGYIVASGR 938

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  129 bits (323), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 139/572 (24%), Positives = 236/572 (41%), Gaps = 76/572 (13%)

Query: 164  LYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGD 223
             + F+++F ++L         +F +L  +       L    +K+ LH    F D   +G 
Sbjct: 901  FFVFVNYFFMSL---------QFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPLGR 951

Query: 224  LISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXXXXXXXXXXXXA 282
            +++R   D   +   +T+ V   V      + GV +MC +  P                A
Sbjct: 952  VLNRFTKDTDTLDNELTESVRLFVYQ-TANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVA 1010

Query: 283  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 342
              +    R   +        +     E LSG+ T++++ +E   L + +  I  + + G 
Sbjct: 1011 DHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINRMSEAGY 1070

Query: 343  XXXXXXXXXXXXXSLLG----------------DLSFLTVLAYGSYLVLQSQLSIGDLTA 386
                          ++                 D+S  +V    +Y VLQ    +  L  
Sbjct: 1071 LVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTY-VLQLPGLLNGLLR 1129

Query: 387  FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFK 446
             M   E   N+V  +  + +E+ Q A           RKP ++P    +  P  G + F 
Sbjct: 1130 AMTQAENDMNSVERIVNYATELPQEAAY---------RKPEMTP---QEPWPSNGEVVFD 1177

Query: 447  DVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
            +VS SY  RP +  + K ++  I  G  + I G +G GKSTI   L R      G ++ID
Sbjct: 1178 NVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNEGRVLID 1235

Query: 506  NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YG------------LTYTPTKEEI 552
              D +K+    LRR + I+ Q+PVL  G+IR N+  +G             + T   EE+
Sbjct: 1236 GVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGTIEAEEV 1295

Query: 553  RSVAKQ--------CFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVL 604
              V  Q           H F        D  +  +GT  S G++Q +A+ RAL+++  +L
Sbjct: 1296 EKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNFSLGERQLLALTRALVRQSKIL 1349

Query: 605  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 664
            ILDEATS++D E++  I     Q  +    TI+ IAHRL TI   + ++VL  +G+V E 
Sbjct: 1350 ILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVL-DNGTVKEF 1406

Query: 665  GKFKELYSNPTSALSQLLNE---RTAPVPSEQ 693
               + L+    +   ++ ++   +    P EQ
Sbjct: 1407 DTPRSLFRIKDTIFREMCDKSGIKAEDFPGEQ 1438

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 118/250 (47%), Gaps = 21/250 (8%)

Query: 449 SFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 508
           +F+   + S   FK+LNF+I  G  V I G  G GKS++   L  +   T G I    ++
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIF---KN 615

Query: 509 ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 568
            + + C             P + + T+RDNI +G ++   +   + V + C     +   
Sbjct: 616 GSLLLCGY-----------PWIQNTTVRDNILFGSSFDDVR--YKEVIRVCALQADLDIL 662

Query: 569 PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ 627
           P    T IG  G  LSGGQK RI +AR++ K   + + D+  SA+D    +  ++     
Sbjct: 663 PAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMG 722

Query: 628 LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTA 687
           ++  K+  + +  H+LS I R+  VI LG  GS  ++G  +EL     S   +L+   T 
Sbjct: 723 MLDGKTRILAT--HQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLMEFSTQ 778

Query: 688 PVPSEQQQQV 697
              + Q+++V
Sbjct: 779 TKSANQREEV 788

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 146/284 (51%), Gaps = 13/284 (4%)

Query: 407  EIMQGAGAASRLFELTDRKPSISPTV-GH---KYKPDRGVIEFKDVSFSYPTRPSVQ-IF 461
            E+     +  R+ E  D K     T+ GH   K  P +G I+F + S  Y  RP +  + 
Sbjct: 1233 EVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPELDLVL 1290

Query: 462  KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHI 521
            K +N  I P   + IVG +G GKS++ L L R    + G I+ID   I ++    LR  +
Sbjct: 1291 KHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYDLRHRL 1350

Query: 522  GIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTYDTVIGPNG 580
             I+ Q+  +  G++R+NI     Y  T E I R++       + ++   +  D  +   G
Sbjct: 1351 SIIPQDSQVFEGSLRENIDPTNQY--TDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGG 1408

Query: 581  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 640
              LS GQ+Q + +ARA++    +LILDEAT+A+DVE++  +  T     K +  TI++IA
Sbjct: 1409 GNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQETIRTAFKDR--TILTIA 1466

Query: 641  HRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
            HRL+TI  S+ +IVL  +G+V E     +L SN  S    L  E
Sbjct: 1467 HRLNTIMDSDRIIVLD-NGTVAEFDSPSQLLSNSESLFHSLCAE 1509

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 120/243 (49%), Gaps = 24/243 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G   C+VG  G GK+ +   +L             
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCML------------- 678

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    ++   +  V Q P +M+GT+ +NI +G  Y    E      K C     
Sbjct: 679 -GDLFRVKGFATVHGSVAYVSQVPWIMNGTVMENILFGHKYDV--EFYEKTIKACALTID 735

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +
Sbjct: 736 LAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEH 795

Query: 624 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+ +K+  + +  +++S +  +++V +L  +G +++ G + E+  +  S L +L
Sbjct: 796 VLGPNGLLHTKTRLLAT--NKVSALSIADSVALLD-NGEIIQKGTYDEITKDADSPLWKL 852

Query: 682 LNE 684
           LN+
Sbjct: 853 LND 855

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 132/557 (23%), Positives = 235/557 (42%), Gaps = 49/557 (8%)

Query: 166  EFLSFFTVALLIGCVA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 221
            +FL F T+  +IG ++    N    I+L   S R   +L   +    +     FF+   +
Sbjct: 1019 DFLKFVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPI 1078

Query: 222  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXX 281
            G +++R  SD   +   +    S   ++++  VV + ++    P                
Sbjct: 1079 GRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYY 1138

Query: 282  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 341
             + +    R   +    +   +  +  E L G   + +F    +  SR+N    +  Q  
Sbjct: 1139 QAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFNFFNFETVQYN 1194

Query: 342  XXXXXXXXXXXXXXSL-LGDLSFLTVLAYG--SYLVL--QSQLSIGDLTAFMLYTEYTGN 396
                          S+ L  +  L +LA G  S+  L  + QLS G +   M Y+    +
Sbjct: 1195 IDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTS 1254

Query: 397  AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD----RGVIEFKDVSFSY 452
            ++  +     +I     +  R  E  + KP     + +   P+     G IEF + +  Y
Sbjct: 1255 SLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKY 1314

Query: 453  PTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 511
              R ++  + K +N  I P   + IVG +G GKST+ L L R    T G+I ID  DI+K
Sbjct: 1315 --RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISK 1372

Query: 512  MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 568
            +  + LR ++ I+ Q+     GTIR N+     +  + EE+    +       I +    
Sbjct: 1373 IGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQH--SDEELWRAVELSHLKQHILRMNEE 1430

Query: 569  ---------------PNTYD------TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
                           P++++      T I  NG+ +S GQ+Q + ++RAL+    VLILD
Sbjct: 1431 ANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILD 1490

Query: 608  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 667
            EAT+A+D+E++  +  T     K +  TI++IAHR+ T+   + ++VL   G V E    
Sbjct: 1491 EATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVLDK-GEVAEFDTV 1547

Query: 668  KELYSNPTSALSQLLNE 684
              L S+  +   +L  +
Sbjct: 1548 SNLLSDKNTMFYKLCEQ 1564

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 116/228 (50%), Gaps = 20/228 (8%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI-MIDNQDITKMNCKSLR-RHIG 522
           NF +  GS  CIVG  G GKSTI   +L       G +  I   D T+    ++R   I 
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIA 702

Query: 523 IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL 582
              QE  +M+ ++++NI +G  +      +  V + C   + ++  P+  +T++G  G  
Sbjct: 703 YCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGIS 760

Query: 583 LSGG-QKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIV 637
           L GG QK RI++ARA+  +  V +LD+  SA+D   S+  I Y   +   L+++K  TI+
Sbjct: 761 LVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TII 818

Query: 638 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE-LYSNPTSALSQLLNE 684
              + ++ ++ S+ +  +   G +VE   ++  + S+  S + +L+ E
Sbjct: 819 LSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEE 865

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 133/554 (24%), Positives = 230/554 (41%), Gaps = 56/554 (10%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + LY   SFF     I   + F     + I + +    L    +K+ +H    F D  
Sbjct: 934  FYMGLY---SFFVFGAYIFMTSQFTILCYIGIGASK---NLNIQALKRIIHTPMSFMDTT 987

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXXXXXXXXX 278
             +G +++R   D   +   + + V   V      +VGV +MC +  P             
Sbjct: 988  PIGRILNRFTKDTDSLDNELIENVRLTVSQF-ANIVGVCVMCIVYLPWFAIAVPFLVFIF 1046

Query: 279  XXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 338
                + +    R   +        +     E L G+ T++ + +E   +++ +  I  + 
Sbjct: 1047 VFIQNHYQSAGREIKRLEAIQRSFVYNNFNEILGGMDTIKFYKSEERYIAKSDYLIDKMN 1106

Query: 339  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDLTAFMLYTEY 393
            + G               ++  ++F  ++   + L +  Q      S+G L  ++L    
Sbjct: 1107 EAGYLTVCVQRWVAILVDMIA-VAFALII---TLLCVTRQFHISASSVGVLLTYVLQLPG 1162

Query: 394  TGNAVFGLSTFYSEIMQGAGAASRL--------FELTDRKPSISPTVGHKYKPDRGVIEF 445
              N    L    S++     +  RL         E    KP  +P    +  P+ G I+F
Sbjct: 1163 LFNT---LLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPETAPP---ESWPEEGTIKF 1216

Query: 446  KDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 504
            ++V F+Y  RP + I  K++N +I     + I G +G GKSTI   L R    T+G+I+I
Sbjct: 1217 ENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLNELTSGSILI 1274

Query: 505  DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN---------------ITYGLTYTPTK 549
            D+ DI K+    LR+ + I+ Q+PVL  G IR N               +  G    P  
Sbjct: 1275 DDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEELWDVLVRGGAIAP-- 1332

Query: 550  EEIRSVAKQCFCHNFITKFPNTY--DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
            E++     Q    +  +   + +  D V+  +G   S G++Q +A+ RAL++   +LILD
Sbjct: 1333 EDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILALTRALVRNTKILILD 1392

Query: 608  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 667
            EATS++D E++  I             TI+ IAHRL TI   + ++VL H G V E    
Sbjct: 1393 EATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRILVLEH-GEVAEFDTP 1449

Query: 668  KELYSNPTSALSQL 681
              L+ + T+    +
Sbjct: 1450 MNLFKDETTIFHNM 1463

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 117/227 (51%), Gaps = 22/227 (9%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F +LNF+I  G  V I GP G GK+++      +   T+GTI I N D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQI-NGDL----------- 659

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
             ++   P + + T+RDNI +G  Y   K   + V + C   + +   P    T IG  G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEEDK--YKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 639
             LSGGQK RI +AR + K+  + +LD+  SA+D    +  ++    +L+ +K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERT 686
            H+LS I ++  +IVLG+DGS VE+G  +  Y   T+   ++L E T
Sbjct: 775 -HQLSLIDKASRIIVLGNDGS-VEIGDVQ--YMKETNKTLKVLLENT 817

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 133/254 (52%), Gaps = 17/254 (6%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 496
            P+RG I+F++ S  Y  RP +  + K+++  I P   V IVG +G GKS++ L L R   
Sbjct: 1275 PERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIE 1332

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
               G+I++D  +I+++    LR  + I+ Q+  +  GTIR+NI     Y  T E+I +  
Sbjct: 1333 AAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNIY--TDEQIWNAL 1390

Query: 557  KQCFCHNFITKF---------PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
            +       I +           N   T +   G  LS GQ+Q + +ARAL+    +LILD
Sbjct: 1391 ELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILD 1450

Query: 608  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 667
            EAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL   G V E    
Sbjct: 1451 EATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVLD-KGEVAEFDTP 1507

Query: 668  KELYSNPTSALSQL 681
            + L  N  S    L
Sbjct: 1508 QNLLKNTESLFYSL 1521

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 98/398 (24%), Positives = 180/398 (45%), Gaps = 44/398 (11%)

Query: 304 TRVAEEQLSGIKTVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 358
           TRV  E L+ IK+++ +  E       E  R    ++++ ++G               L+
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLV 544

Query: 359 GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 418
              +F  V  Y     L + L    LT F L T      +  L    +  ++ + + SRL
Sbjct: 545 SCSTF-AVFVYIEDKPLTTDLVFPALTLFNLLTF----PLAALPIVITAFIEASVSMSRL 599

Query: 419 FEL-------TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAP 470
           F         TD    + P    K + D  V    + +F +  +P  ++  K++ F+   
Sbjct: 600 FSFMTNEELQTDAIQRLPPV---KKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKK 656

Query: 471 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN-CKSLRRHIGIVQQEPV 529
           G   CIVG  G GKS     +L               D+ ++    ++  ++  V Q P 
Sbjct: 657 GELACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFATIHGNVAYVSQLPW 702

Query: 530 LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQ 589
           +M+GT++DNI +G  Y   +E      + C     ++  P+   T++G  G  LSGGQK 
Sbjct: 703 IMNGTVKDNILFGHKYN--QEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKA 760

Query: 590 RIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFG--QLMKSKSMTIVSIAHRLSTI 646
           R+++ARA+  +  V +LD+  +A+D   S+  I +  G   L+ +K+  + +  +++S +
Sbjct: 761 RLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTKTRVLAT--NKISVL 818

Query: 647 RRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
             ++N+ +L  DG +V+ G + E+  N  S L +L++E
Sbjct: 819 SIADNITLLD-DGEIVQQGTYNEVTDNINSPLCKLISE 855

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  119 bits (299), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 138/261 (52%), Gaps = 32/261 (12%)

Query: 438 PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
           P  G +E K++S  Y    S +   +++FK+  G+ V IVG +G GKS+I   + R  + 
Sbjct: 28  PQTGDVELKNLSLRYSPHSS-KALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 86

Query: 498 TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV-- 555
             GTI IDN+DI  +  + LR  I  + Q+P L  GT+R N+     Y+    +I  V  
Sbjct: 87  ENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDV--QIYGVLS 144

Query: 556 ----AKQC--FCHNFITKFPN-----------TYDTVIGPNGTLLSGGQKQRIAIARALI 598
                ++C   C  F  + PN             +TV+   G+ LS GQ+Q + +AR+++
Sbjct: 145 KVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQRQLLCLARSML 204

Query: 599 KKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 658
               ++++DEAT+++D  S+  I  T  + M  K+ TI++IAHRL ++   + ++V+   
Sbjct: 205 GARNIMLIDEATASIDYISDAKIQKTIRETM--KNTTILTIAHRLRSVIDYDKILVM--- 259

Query: 659 GSVVEMGKFKELYSNPTSALS 679
               EMG+ KE Y +P + +S
Sbjct: 260 ----EMGRVKE-YDHPYTLIS 275

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 138/549 (25%), Positives = 236/549 (42%), Gaps = 66/549 (12%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + LY F  F       G +    +F ++  +      +L    +++ LH    F D  
Sbjct: 918  FYMGLYSFFVFG------GYIFMTSQFTIVCFIGVNASKKLNLSAVRRILHTPMAFLDTT 971

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXXXXXXXXX 278
             +G +++R   D   +   +T+ V   + A    ++GV +MC +  P             
Sbjct: 972  PLGRILNRFTKDTDSLDNELTENVR-LMLAQFANIIGVCVMCIIYLPWFAIAIPFILLIF 1030

Query: 279  XXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 338
               ++ +    R   +        +     E L G+ T++ + +E   +++ +  I  + 
Sbjct: 1031 VLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGMDTIRFYNSEERFMAKSDYLIDKMN 1090

Query: 339  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDLTAFMLY--- 390
            + G               ++  + F  ++A    L +  Q      S+G L  ++L    
Sbjct: 1091 EAGYLVVCVQRWVAVLLDMIA-VCFALIIAL---LCVTRQFHISASSVGVLLTYVLQLPG 1146

Query: 391  -----------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD 439
                       TE   N+V  L ++ +E+   A           RKP  SP       P 
Sbjct: 1147 LLNTVLRALTQTENDMNSVERLVSYATELPTEAAY---------RKPESSPDPSW---PQ 1194

Query: 440  RGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 498
             G I+F++VSF+Y P  P+V   K+L+  I  G  + I G +G GKSTI   L R     
Sbjct: 1195 EGKIDFEEVSFAYRPGLPAV--LKNLSMSINGGEKIGICGRTGAGKSTIMSALYRLNELE 1252

Query: 499  TGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YGLTY------------ 545
            +G I+ID  +I+ +    LRR + I+ Q+PVL  GTIR N+  +G               
Sbjct: 1253 SGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERSDDELWDALSRGG 1312

Query: 546  TPTKEEIRSVAKQCFCHNFITKFPNTY--DTVIGPNGTLLSGGQKQRIAIARALIKKPTV 603
            +  KE +  V  Q    N   +  + +  D  +   G+  S G++Q +A+ARAL++   V
Sbjct: 1313 SIDKESLEEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQLLALARALVRNSKV 1372

Query: 604  LILDEATSALDVESEGAINYTFGQLMKSKS-MTIVSIAHRLSTIRRSENVIVLGHDGSVV 662
            LILDEATS++D E++  I     +++++ S  TI+ IAHRL TI   + ++VL   G + 
Sbjct: 1373 LILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNYDRILVL-EKGEIA 1428

Query: 663  EMGKFKELY 671
            E      LY
Sbjct: 1429 EFDSPYNLY 1437

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 102/211 (48%), Gaps = 20/211 (9%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           FK +N +I  G  + I GP G GK+++   +      T G++ I+ +             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
             ++   P + + T+RDNI +G  +  +K  +  V K C     +   P    T IG  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-NYTFGQLMKSKSMTIVSI 639
             LSGGQK RI +AR + K   + + D+  SA+D      I +     L+  K+  + + 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLAT- 766

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            H+LS +  +  VIVLG+DGS V++G  +EL
Sbjct: 767 -HQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  126 bits (317), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 148/285 (51%), Gaps = 15/285 (5%)

Query: 407  EIMQGAGAASRLFELTDRKPSISPTV--GH---KYKPDRGVIEFKDVSFSYPTRPSVQ-I 460
            E+     +  R+ E  D K S +P +  GH   K  P +G I+F + S  Y  RP +  +
Sbjct: 1232 EVETNIVSVERIKEYADLK-SEAPLIVEGHRPPKEWPSQGDIKFNNYSTRY--RPELDLV 1288

Query: 461  FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
             K +N  I P   V IVG +G GKS++ L L R    + G I+IDN  I ++    LR  
Sbjct: 1289 LKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHK 1348

Query: 521  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTYDTVIGPN 579
            + I+ Q+  +  GT+R+NI     Y  T E I R++       + ++   +  D  +   
Sbjct: 1349 LSIIPQDSQVFEGTVRENIDPINQY--TDEAIWRALELSHLKEHVLSMSNDGLDAQLTEG 1406

Query: 580  GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 639
            G  LS GQ+Q + +ARA++    +L+LDEAT+A+DVE++  +  T     K +  TI++I
Sbjct: 1407 GGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTI 1464

Query: 640  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
            AHRL+TI  S+ +IVL  +G V E     +L S+  S    L  E
Sbjct: 1465 AHRLNTIMDSDRIIVLD-NGKVAEFDSPGQLLSDNKSLFYSLCME 1508

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 120/242 (49%), Gaps = 24/242 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G+  CIVG  G GK+ +   +L             
Sbjct: 631 DATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCML------------- 677

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    ++   +  V Q P +M+GT+++NI +G  Y    E      K C     
Sbjct: 678 -GDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDA--EFYEKTIKACALTID 734

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +
Sbjct: 735 LAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEH 794

Query: 624 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+ +K+  + +  +++S +  ++++ +L  +G + + G + E+  +  S L +L
Sbjct: 795 VLGPNGLLHTKTKVLAT--NKVSALSIADSIALLD-NGEITQQGTYDEITKDADSPLWKL 851

Query: 682 LN 683
           LN
Sbjct: 852 LN 853

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 93/284 (32%), Positives = 148/284 (52%), Gaps = 13/284 (4%)

Query: 407  EIMQGAGAASRLFELTDRKPSISPTV--GH---KYKPDRGVIEFKDVSFSYPTRPSVQ-I 460
            E+     +  R+ E  D K S +P V  GH   K  P +G I+F   S  Y  RP +  +
Sbjct: 1233 EVETNIVSVERIKEYADIK-SEAPLVIEGHRPPKEWPGQGDIKFNQYSTRY--RPELDLV 1289

Query: 461  FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
             K ++  I P   + IVG +G GKS++ L L R    + G I+ID   I ++    LR  
Sbjct: 1290 LKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLYDLRHK 1349

Query: 521  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
            + I+ Q+  +  GT+R+NI     YT  +   R++       + ++   +  D+ +   G
Sbjct: 1350 LSIIPQDSQVFEGTVRENIDPINQYTD-EAMWRALELSHLKEHILSMSNDGLDSQLTEGG 1408

Query: 581  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 640
            + LS GQ+Q + +ARA++ +  +L+LDEAT+A+DVE++  I  T     K +  TI++IA
Sbjct: 1409 SNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFKDR--TILTIA 1466

Query: 641  HRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
            HRL+TI  S+ +IVL  +G V E     +L +N  S    L  E
Sbjct: 1467 HRLNTIMDSDRIIVLD-NGKVAEFDSPAQLLTNTKSLFYSLCAE 1509

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 123/243 (50%), Gaps = 24/243 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G   C+VG  G GK+  ALL     + T G     
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKT--ALL-----SSTLG----- 679

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    S+   +  V Q P +M+GT+++NI +G  Y    E      K C     
Sbjct: 680 --DLFRVKGFASVHGSVAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTID 735

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   + +
Sbjct: 736 LAILMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEH 795

Query: 624 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+ +K+  + +  +++S +  ++++ +L  +G +++ G + ++  +  S L +L
Sbjct: 796 VLGSNGLLHTKTKLLAT--NKVSALSVADSIALLD-NGEIIQQGTYDDITKDADSPLWKL 852

Query: 682 LNE 684
           + +
Sbjct: 853 IKD 855

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 139/565 (24%), Positives = 229/565 (40%), Gaps = 78/565 (13%)

Query: 151  DFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLH 210
            D F  + P F + LY F  F +   +       G++ LL  +       L    + K LH
Sbjct: 933  DKFHNRSPSFYMGLYSFFVFGSYIFM------NGQYTLLCYMGVVASKTLNLQALHKILH 986

Query: 211  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXX 269
                F D + +G +++R   D   +   +T+ +   +   I  ++GVG MC +  P    
Sbjct: 987  TPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQ-IANIIGVGAMCIIYLPWFAI 1045

Query: 270  XXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 329
                        A  +    R   +        +     E L+G+ T++++ A+    ++
Sbjct: 1046 AIPFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQDRFATK 1105

Query: 330  YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL-------QSQLSIG 382
                I  + +                       FL ++A    L++       Q  +S  
Sbjct: 1106 SEFLIDKMNEAAYISIAVQRWAGI---------FLDLVAVAFALIITLLCVTRQFHISGA 1156

Query: 383  DLTAFMLY-----------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 425
            D    + Y                 TE   N+   L ++ +++ Q         E   RK
Sbjct: 1157 DTGVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ---------EAQYRK 1207

Query: 426  PSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGK 484
            P  SP +     P  G I F++++F+Y  RP + I  K+ N  I P   + I G +G GK
Sbjct: 1208 PECSPPIDW---PQNGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRTGAGK 1262

Query: 485  STIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN------ 538
            STI   L R    TTG I+ID+ DI+ +    LR  + I+ Q+PVL  G IR N      
Sbjct: 1263 STIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDE 1322

Query: 539  ----------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQK 588
                      +  G   +   E ++S  K     N + KF    +  +  +G   S G++
Sbjct: 1323 YQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGER 1379

Query: 589  QRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 648
            Q +A+ RAL+++  +LILDEATS++D E++  I             TI+ IAHRL TI  
Sbjct: 1380 QVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILN 1437

Query: 649  SENVIVLGHDGSVVEMGKFKELYSN 673
             + ++VL   G V E      L++N
Sbjct: 1438 YDRILVL-EKGEVAEFDTPWNLFNN 1461

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 100/214 (46%), Gaps = 21/214 (9%)

Query: 460 IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRR 519
           +  ++NF I  G  V + GP G GK+++   L       +G          +MN      
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSG----------EMNHSGDLL 673

Query: 520 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPN 579
             GI    P + + TIRDNI +G  Y PT    + V   C   + +   P    T +G  
Sbjct: 674 LCGI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 580 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 638
           G  LSGGQK RI++ARA+ K   + + D+  SA+D       ++Y     +  K+  + +
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRILAT 787

Query: 639 IAHRLSTIRRSENVIVL--GHDGSVVEMGKFKEL 670
             H+LS + +++ +IVL    D    E+G FKEL
Sbjct: 788 --HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 145/277 (52%), Gaps = 15/277 (5%)

Query: 407  EIMQGAGAASRLFELTDRKPSISPTV--GH---KYKPDRGVIEFKDVSFSYPTRPSVQ-I 460
            E+     +  R+ E  D K S +P +  GH   K  P +G I F + S  Y  RP +  +
Sbjct: 1233 EVETNIVSVERIKEYADLK-SEAPLIIEGHRPPKQWPAQGDIRFNNYSTRY--RPELDLV 1289

Query: 461  FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
             K +N  I P   V IVG +G GKS++ L L R    + G I+ID   I ++    LR  
Sbjct: 1290 LKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLYDLRHK 1349

Query: 521  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTYDTVIGPN 579
            + I+ Q+  +  GT+R+NI     Y  + E I R++       + ++   +  D  +   
Sbjct: 1350 LSIIPQDSQVFEGTVRENIDPINQY--SDEAIWRALELSHLKEHVLSMSNDGLDAQLSEG 1407

Query: 580  GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 639
            G+ LS GQ+Q + +ARA++    +L+LDEAT+A+DVE++  +  T     K +  TI++I
Sbjct: 1408 GSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTI 1465

Query: 640  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
            AHRL+TI  S+ +IVL  +G V E     +L SN  S
Sbjct: 1466 AHRLNTIMDSDRIIVL-DNGKVAEFDTPGQLLSNSKS 1501

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 125/254 (49%), Gaps = 22/254 (8%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K+++F+   G+  CIVG  G GK+ +   +L       G +   
Sbjct: 632 DATFLWQRKPEYKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCML-------GDLFRV 684

Query: 506 NQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 565
               T   C      I  V Q P +M+GT+++NI +G  Y    E      K C     +
Sbjct: 685 KGFATVHGC------IAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDL 736

Query: 566 TKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 624
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 625 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLL 682
            G   L+ +K+  + +  +++S +  ++++ +L  +G +++ G + ++  +  S L +LL
Sbjct: 797 LGPNGLLHTKTRILAT--NKVSALSIADSIALL-DNGEIIQQGAYSDITKDADSPLWKLL 853

Query: 683 NERTAPVPSEQQQQ 696
           N+      ++Q ++
Sbjct: 854 NDYGKKNNNKQSEE 867

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 135/513 (26%), Positives = 226/513 (44%), Gaps = 59/513 (11%)

Query: 204  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263
            V+ K LH    FFD    G +++RL  D   V + +         A++  +  + ++  +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 264  SPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQ 318
            +PQ                ++ G     TS++L+     +TR        E L GI +++
Sbjct: 1174 TPQFLIMAIFIGFLY----ALIGYFYVTTSRELKRFE-SITRSPIYQHFSETLVGITSIR 1228

Query: 319  SFVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSY 372
            ++  E       LSR +   R  F +                LLG L   F  +  Y + 
Sbjct: 1229 AYGDERRFMLENLSRIDDNNRPFFYLWIANRWLAFRV----DLLGALVTFFSGLFIYLNI 1284

Query: 373  LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL---FELTDRKPSIS 429
              L + L+   LT  + +TE            YS +     +  RL    E+     + +
Sbjct: 1285 GKLDAGLAGISLTYAIFFTE----GALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNEN 1340

Query: 430  PTVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIA 488
              +     P  G I+  D+S  Y P  P  ++ K++NF + P   V IVG +G GKSTI 
Sbjct: 1341 AQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTII 1398

Query: 489  LLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT 548
              + R+ +P TG + IDN DIT +    LR+ I I+ Q+P L +GT++  +     Y+  
Sbjct: 1399 TAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDK 1458

Query: 549  K--EEIRSV-------------AKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAI 593
            +  E ++ V                      I KF +  + V    G  LS GQ+Q + +
Sbjct: 1459 QIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLDLNNEVT-EGGANLSQGQRQLVCL 1517

Query: 594  ARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 653
            AR+L++ P +++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL +I   + V+
Sbjct: 1518 ARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVL 1575

Query: 654  VLGHDGSVVEMGKFKELYSNPTSALSQLLNERT 686
            V+       + G+ KE Y +P S    LLN+ T
Sbjct: 1576 VM-------DAGEVKE-YDHPYSL---LLNKNT 1597

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 105/229 (45%), Gaps = 9/229 (3%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           + F++ + ++   PS    ++++ +   G      GP+G GKS++ L LL       G I
Sbjct: 672 LAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKI 731

Query: 503 MI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
            +   D ++   +    L   I    Q   L++ T R NI +   Y   ++    V + C
Sbjct: 732 YVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYN--EQRYNDVLEAC 789

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                         T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +  
Sbjct: 790 GLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTAL 849

Query: 620 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            I  N   G LM+ ++  +VS  H ++   R+ + +V+  +G V   G+
Sbjct: 850 LIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 130/251 (51%), Gaps = 9/251 (3%)

Query: 436  YKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 494
            + PD G I F   S  Y  RP +  + + +N  I P   + IVG +G GKS++ L L R 
Sbjct: 1270 HWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRI 1327

Query: 495  YNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 554
               ++G I+ID   I ++    LR ++ I+ Q+  +  GTIR+N+    TY  T +EI  
Sbjct: 1328 VEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY--TDDEIWR 1385

Query: 555  VAKQCFCHNFITKF-PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
            V +    +  +    P      +   G+ LS GQ+Q + +ARAL+    +LILDEAT+A+
Sbjct: 1386 VLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAV 1445

Query: 614  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            DVE++  I  T     + +  TI++IAHR++TI  S+ ++VL   G V E      L  N
Sbjct: 1446 DVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVLD-GGRVTEFDTPTNLLRN 1502

Query: 674  PTSALSQLLNE 684
              S    L  E
Sbjct: 1503 EGSQFHSLCQE 1513

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 120/250 (48%), Gaps = 38/250 (15%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G   C+VG  G GKS +   L              
Sbjct: 630 DATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSALIQSL-------------- 675

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
           + D+ ++    ++   +  V Q   +M+GT+++NI +G  Y P  E      K C     
Sbjct: 676 SGDLFRVKGFATVHGSVAYVSQVAWIMNGTVKENILFGHRYDP--EFYDKTIKACALTID 733

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           +    +  +T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D    +  + +
Sbjct: 734 LAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVGKHLLEH 793

Query: 624 TFG---------QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNP 674
             G         +++ +  ++++SIA R          I L  +G +VE G + E+ ++ 
Sbjct: 794 VLGPTGLLRTKTKILATNKISVLSIADR----------IALLENGEIVEQGSYDEVTADG 843

Query: 675 TSALSQLLNE 684
            SALS+L+ +
Sbjct: 844 DSALSKLIRD 853

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 135/519 (26%), Positives = 231/519 (44%), Gaps = 68/519 (13%)

Query: 203  HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 262
            +++   LH +  FFD   VG +++R   D   V + +   +   +  LI  +  + ++  
Sbjct: 1078 NMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSIIFLITI 1137

Query: 263  LSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 322
            ++P+                  +    R   +        + +   E L+G+ T+++F  
Sbjct: 1138 ITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGVCTIRAF-- 1195

Query: 323  EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQ----- 376
             G+E  R+ +   D                   +   D+     VL  GS+++L      
Sbjct: 1196 -GDE-KRFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFIVLGSGSFILLNIGDID 1253

Query: 377  SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT-----DRKPSISPT 431
            S L+   LT  +L+T+        L   YS       +  RL E +     +   +    
Sbjct: 1254 SSLAGISLTYSILFTD----GALWLVRLYSTFEMNMNSVERLKEYSGIEQENYNENHIQA 1309

Query: 432  VGHKYKPDRGVIEFKDVSFSYPTR-PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALL 490
            + +   P+ G IE  ++S  Y +  P V   K+++F + P + + IVG +G GKSTI   
Sbjct: 1310 LQNSLWPEHGKIEVDNLSLRYASNLPPV--IKNVSFTVDPQTKIGIVGRTGAGKSTIITA 1367

Query: 491  LLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 550
            L R   P TG I ID  DI+K++  +LRR I I+ Q+P+L +GTI+ N+       P  E
Sbjct: 1368 LFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNL------DPYDE 1421

Query: 551  -EIRSVAKQCFCHNFIT------------KFPNTYD------TVIGPNGTLLSGGQKQRI 591
             + R + K     N I+             F   ++      T I   G  LS G+KQ +
Sbjct: 1422 YDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVEGGLNLSQGEKQLL 1481

Query: 592  AIARALIKKPTVLILDEATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIR 647
             IAR+L+++P +++LDEATS++D +S    +G I   F     S+S TI++IAHRL ++ 
Sbjct: 1482 FIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEF-----SRS-TILTIAHRLRSVI 1535

Query: 648  RSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERT 686
              + V+V+       + G+ KE Y +P   L    NER+
Sbjct: 1536 DYDKVLVM-------DAGEVKE-YDHPYELLK---NERS 1563

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 116/246 (47%), Gaps = 22/246 (8%)

Query: 438 PDRGVIEFKDVSFSYPTRPS-VQIFK----SLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492
           PD+  I+FK  +  +    + +  F+    ++NF+I  G    I+G +G GKS + + LL
Sbjct: 657 PDKNKIKFKKATLVWNENDNDINKFRLCDLNINFRI--GKLNLILGSTGSGKSALLMGLL 714

Query: 493 RYYNPTTGTIMIDNQD-----ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
                 +G+I++   +     I  +N   L        Q   L++GT+R+NI +   Y  
Sbjct: 715 GELYLLSGSIIVPGLEPRHDMIPDLN--GLTNSFAYCSQSAWLLNGTVRNNIIFNGVYDE 772

Query: 548 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
            +   ++V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD
Sbjct: 773 NR--YKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLD 830

Query: 608 EATSALDVESEGAINYTF---GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 664
           +  SA+D  +   I Y     G LMK+++  +V+  H +S   R     V+  +G V   
Sbjct: 831 DCLSAVDSHTAIWI-YEICITGLLMKNRTCILVT--HNISLAIRKAYFAVILENGKVKSQ 887

Query: 665 GKFKEL 670
           G   EL
Sbjct: 888 GTITEL 893

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 11/245 (4%)

Query: 443  IEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
            I F  V   Y P  P V   K+++F + P S V IVG +G GKST+ + L R    T GT
Sbjct: 1238 ISFDHVYVRYAPHLPDV--LKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGT 1295

Query: 502  IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ--C 559
            I I   DI  +N ++LRR + ++ Q+P L SGTI+ NI     Y  + +E+   A++   
Sbjct: 1296 IRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRY--SDQELTHFARRIGL 1353

Query: 560  FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
            F      +  N+  +++   G  +S GQ+Q + +ARAL++K  +LILDEAT+++D E++ 
Sbjct: 1354 FSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHETDA 1413

Query: 620  AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALS 679
             I         S    ++++AHR+STI   + VIVL  D  +V+      L      A  
Sbjct: 1414 TIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQNGAFH 1469

Query: 680  QLLNE 684
            Q+  E
Sbjct: 1470 QMCKE 1474

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 149/332 (44%), Gaps = 38/332 (11%)

Query: 362 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT-----GNAVFGLSTFYSEIMQGAGAAS 416
           + +T   +G+ + LQ Q     +T    YT  T      N +  L+T    I+Q   +  
Sbjct: 556 TLVTAATFGASIYLQKQ----KITVASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQ 611

Query: 417 RLFELTDRKPSISPTVGHKYKPDRGV-IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 475
           R+ +  +R    S T  H+   D    + F++ S ++    +  + K+L           
Sbjct: 612 RIEKFLNR----SNTKKHEILKDSFTEMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNV 667

Query: 476 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTI 535
           I+GPSG GKS++ L LL   +   G+I +    +    C           Q P + + T+
Sbjct: 668 IIGPSGSGKSSVLLALLGELDLIEGSIRVPRGYMHDDRCS-----FAFCSQTPWITNATV 722

Query: 536 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595
           ++NI +   +   + +   V   C     I +     +TV+G  G  LSGGQ+QR+A+AR
Sbjct: 723 KENIVFSSQFNTKRYQ--EVLHACGLEEDILEMQEGDETVVGDKGMTLSGGQRQRLALAR 780

Query: 596 ALIKKPTVLILDEATSALDVESEGAINYTF-----GQLMKSKSMTIVSIAHRLSTIRRSE 650
           A+      L+LD+  SA+D    G   + F     G LMK K  T +   H ++ +++  
Sbjct: 781 AVYSGAEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMKGK--TCILATHNIALVQKHA 835

Query: 651 NVIVLGHDGSVVEMGKFKEL-------YSNPT 675
           ++I+L  +G V ++GK ++        YS P+
Sbjct: 836 DMIILLDNGRVSKIGKARDFNFDSEFDYSKPS 867

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 144/545 (26%), Positives = 242/545 (44%), Gaps = 46/545 (8%)

Query: 170  FFTVALLIGCVA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 225
            F  V  LIG  +    N    ++L   S R   +L   + K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRII 1079

Query: 226  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVF 285
            +R  SD   V  ++    S   K+++  +V V ++    P                 + +
Sbjct: 1080 NRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFY 1139

Query: 286  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQ 339
                R   + +  +   +  +  E L+G   +      + F+    E  +YNV     F+
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFR 1199

Query: 340  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAV 398
                             +L       +LA  + +  + QLS G +   M Y+ E TG+  
Sbjct: 1200 STNRWLSVRLQTIGATIVLAT----AILALAT-MNTKRQLSSGMVGLLMSYSLEVTGSLT 1254

Query: 399  FGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYKPDRGVIEFKDVSFSYPT 454
            + + T  + I     +  R+ E  +  P   SI+P     +  P +G IEFK+ S  Y  
Sbjct: 1255 WIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKY-- 1311

Query: 455  RPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
            R ++  +  ++N KI P   V IVG +G GKST++L L R   PT G I+ID  DI+ + 
Sbjct: 1312 RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIG 1371

Query: 514  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-- 571
               LR H+ I+ Q+     GT++ N+     Y  +++E++   +Q      + K  ++  
Sbjct: 1372 LFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKRAVEQAHLKPHLEKMLHSKP 1429

Query: 572  ---------------YDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616
                            D  I  NG+ LS GQ+Q + +ARAL+ +  +L+LDEAT+++D+E
Sbjct: 1430 RGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDME 1489

Query: 617  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
            ++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL   GSV E     +L S+ TS
Sbjct: 1490 TDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDQ-GSVREFDSPSKLLSDKTS 1546

Query: 677  ALSQL 681
                L
Sbjct: 1547 IFYSL 1551

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 122/237 (51%), Gaps = 12/237 (5%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIV 524
           +F+   G  VC+VG  G GKST    +L      +G+    +    K+  +S    +   
Sbjct: 659 HFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGS---RDSIPPKLIIRS--SSVAYC 713

Query: 525 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
            QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G  G  LS
Sbjct: 714 SQESWIMNASVRENILFGHKFDQDYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLS 771

Query: 585 GGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHR 642
           GGQK R+++ARA+  +  + +LD+  SA+D E S+  I Y   G+    K+ TI+   + 
Sbjct: 772 GGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNT 831

Query: 643 LSTIRRSENVIVLGHDGSVVEMGKFKELYS--NPTSALSQLLNERTAPVPSEQQQQV 697
           +S ++ S+ +  L  +G +VE G ++++ +  N TS L +LL E  +P+ +  +  V
Sbjct: 832 VSILKHSQMIYAL-ENGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDV 887

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 142/290 (48%), Gaps = 22/290 (7%)

Query: 405  YSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKS 463
            YSEI      A  L E  DR+PS  P       P  G I+F+  S  Y  RP +  I K 
Sbjct: 1253 YSEI---PSEAPYLIE--DRRPS--PN-----WPTDGAIQFQHYSTRY--RPGLDLILKD 1298

Query: 464  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGI 523
            +N  I P   + IVG +G GKS++ L L R      G I+ID   I +M    LR  + I
Sbjct: 1299 INLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSI 1358

Query: 524  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVIGPNGTL 582
            + Q+  +  G++R+NI     Y  + EEI  V       N +    N    T +   G  
Sbjct: 1359 IPQDSQVFEGSVRENIDPTEQY--SDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGN 1416

Query: 583  LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++  +  T       +  TI++IAHR
Sbjct: 1417 LSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTAFADR--TILTIAHR 1474

Query: 643  LSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERT-APVPS 691
            L+TI  S+ ++VL   G V E    + L  NP +    L  +    P PS
Sbjct: 1475 LNTIMDSDRILVL-DAGRVAEFDTPENLLKNPGTMFYGLCQDAGFVPRPS 1523

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 125/243 (51%), Gaps = 24/243 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           + +F +  +P  ++  K++NF+   G   C+VG  G GKS +   LL             
Sbjct: 635 NATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLL------------- 681

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    ++  +I  V Q   +M+GT++DNI +G  Y P  E      K C     
Sbjct: 682 -GDLFRVKGFATVHGNIAYVSQVAWIMNGTVKDNILFGHKYDP--EFYEKTIKACALTID 738

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           +   P+   T++G  G  LSGGQK R+++ARA+  +  + +LD+  +A+D   S   I++
Sbjct: 739 LAILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDH 798

Query: 624 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+K+K+  + +  +++S +  +++V +L  +G +++ G F E+     S LS+L
Sbjct: 799 VLGPNGLLKTKTKILAT--NKISALSIADSVTLL-ENGEIIQQGTFCEITKAADSPLSKL 855

Query: 682 LNE 684
           + E
Sbjct: 856 IKE 858

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 143/558 (25%), Positives = 239/558 (42%), Gaps = 74/558 (13%)

Query: 159  IFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDN 218
            ++ L +Y  + F  +  L+G + N   F    I + R   ++  +++   LH    FFD 
Sbjct: 1045 LYYLGMYFAIGF--IQALLGGIKNIATF-FSGIQASR---KIFDNMLDLVLHAKIRFFDV 1098

Query: 219  HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXX 278
              +G +++R   D   V + +T  +   +  LI     + ++  ++P             
Sbjct: 1099 TPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIFLITIITPHFLIVAVVVFILY 1158

Query: 279  XXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG----NELSRYNVAI 334
                  +    R   +        + +   E L G+ T+++F  E       L + +   
Sbjct: 1159 YFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFGDEKRFILENLDKIDQNN 1218

Query: 335  RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQLSIGDLTAFML 389
            R  F +               + +       VLA GS++++      S L+   LT  +L
Sbjct: 1219 RAFFYLSVAVKWFAFRVDIIGAFI-------VLASGSFILINIGNIDSGLAGISLTYAIL 1271

Query: 390  YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--------DRKPSISPTVGHKYKPDRG 441
            +T+        L   YS       +  RL E +        D        +     P+ G
Sbjct: 1272 FTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYNKDHIQELQQSSWPEHG 1327

Query: 442  VIEFKDVSFSYPTR-PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500
             IE  ++S  Y +  P V   K+++F I P S V IVG +G GKSTI   L R   P TG
Sbjct: 1328 QIEVDNLSLRYASNLPPV--IKNVSFTIEPQSKVGIVGRTGAGKSTIITALFRLLEPETG 1385

Query: 501  TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 560
             I ID  DI++++  +LRR I I+ Q+P+L +GTI+ N+     Y   K  I  V  Q  
Sbjct: 1386 HIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCDEYDNKK--IFKVLSQV- 1442

Query: 561  CHNFIT-------------------KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKP 601
              N I+                   KF N   T I   G  +S G++Q + IAR+L+++P
Sbjct: 1443 --NLISTGEMEAAQNMGDDSNTARNKFVNL-QTEITEGGQNISQGERQLLFIARSLLREP 1499

Query: 602  TVLILDEATSALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 660
             +++LDEATS++D ES+  I      +  KS   TI++IAHRL ++   + V+V+     
Sbjct: 1500 KIILLDEATSSIDYESDHLIQGIIRNEFNKS---TILTIAHRLRSVIDYDRVLVM----- 1551

Query: 661  VVEMGKFKELYSNPTSAL 678
              + G+ KE Y +P + L
Sbjct: 1552 --DAGEIKE-YDHPYNLL 1566

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 110/242 (45%), Gaps = 14/242 (5%)

Query: 438 PDRGVIEFKDVSFSY-PTRPSVQIFK--SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 494
           PD   IEFK+ + ++        IFK   LN     G    I+G +G GKS + + LL  
Sbjct: 661 PDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGE 720

Query: 495 YNPTTGTIMIDN----QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 550
            +  +G+I +       D+   +   L        Q   L++ T+++NI +   Y   + 
Sbjct: 721 LHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR- 778

Query: 551 EIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEAT 610
             + V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  
Sbjct: 779 -YKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCL 837

Query: 611 SALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 668
           SA+D  +   I  N   G +M++++  +V+  H +S   R     V+  +G V   G  K
Sbjct: 838 SAVDSHTAVWIYENCITGPIMENRTCILVT--HNVSLTIREAYFAVILENGKVKNQGTIK 895

Query: 669 EL 670
           +L
Sbjct: 896 QL 897

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 133/543 (24%), Positives = 220/543 (40%), Gaps = 52/543 (9%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + +Y F  FF             +F L+  +      RL    +++ LH    F D  
Sbjct: 942  FYMGMYTFFVFFNY------FVTTSQFSLICYIGLSAAKRLNLKAVQRLLHTPMSFLDTT 995

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQXXXXXXXXXXXX 278
             +G +++R   D   V   +T+ V   V  L   +VGV +MC +  P             
Sbjct: 996  PIGRVLNRFTKDTDTVDTELTESVRLFVFQL-SNIVGVIVMCIIYLPWFAIAVPFLMLVF 1054

Query: 279  XXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 338
               A  +    R   +        +     E L G+ T++++  E   L++ +     + 
Sbjct: 1055 VGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERRFLTKSDFLTNKMN 1114

Query: 339  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 398
            + G               ++  ++F  ++   + L +  Q  I   +  +L T Y     
Sbjct: 1115 EAGYLVVAIQRWVAIALDMIA-MAFALIV---TLLCVTRQFHISAASVGVLLT-YVLQLP 1169

Query: 399  FGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTVGHKYKPDRGVIEFKD 447
              L+     + QG     +  RL         E   R+P +SP       P  G IEF  
Sbjct: 1170 GLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAEW---PTDGRIEFDH 1226

Query: 448  VSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 506
            VS +Y  RP +  + K +   +A G  + I G +G GKSTI   L R      G+I ID 
Sbjct: 1227 VSLAY--RPGLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELHDGSITIDG 1284

Query: 507  QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK-------------EEIR 553
             DI+ +    LR  + I+ Q+PV+  G +R N+      T  +             E + 
Sbjct: 1285 VDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHALVRGGAIPAESLA 1344

Query: 554  SVAKQCFCHNFITKFPNTY----DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEA 609
            +V  Q   H       N +       +  +GT  S G++Q +A+ RAL+++  +LILDEA
Sbjct: 1345 TVRAQ--THENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRALVRQSKILILDEA 1402

Query: 610  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 669
            TS++D E++  I     +     + TI+ IAHRL+TI   + ++VL   G V E      
Sbjct: 1403 TSSVDYETDAKIQTRIVEAF--SNCTILCIAHRLNTILDYDRILVLDQ-GRVCEFDTPAA 1459

Query: 670  LYS 672
            LY+
Sbjct: 1460 LYA 1462

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 98/212 (46%), Gaps = 22/212 (10%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F +LN +I  G  V + G  G GKS++   L  +   T G I    +D T + C      
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIY---KDGTMLLCGY---- 655

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
                  P + + T+RDNI +G  Y   +     + + C     +   P    T IG  G
Sbjct: 656 -------PWIQNATVRDNILFGSPYNEAR--YNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVS 638
             LSGGQK RI +ARA+ KK  + + D+  SA+D      I      G+L  S   T V 
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRVL 763

Query: 639 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             H+LS I R+  VI +  DGS V++G  +EL
Sbjct: 764 ATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 131/249 (52%), Gaps = 9/249 (3%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 496
            P  G I+F++ S  Y  RP + +  +++N  I P   + IVG +G GKS++ L L R   
Sbjct: 1247 PTHGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1304

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
               G I+ID      +  + LR H+ I+ Q+  +  GT+R+NI     Y  T EEI    
Sbjct: 1305 AAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEY--TDEEIWHAL 1362

Query: 557  KQCFCHNFITKF-PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
            +     + I     +  ++++   G  LS GQ+Q + +ARAL+    +L+LDEAT+A+DV
Sbjct: 1363 ELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDV 1422

Query: 616  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT 675
            E++  I  T     K++  TI++IAHR++TI  S+ ++VL   G + E    + L  N  
Sbjct: 1423 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRE 1479

Query: 676  SALSQLLNE 684
            S    L  E
Sbjct: 1480 SLFYSLCQE 1488

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 127/241 (52%), Gaps = 24/241 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L             
Sbjct: 616 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGIL------------- 662

Query: 506 NQDITKM-NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    S+   I  V Q P +M+GT+++NI +G  Y     +  +  + C     
Sbjct: 663 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKENILFGHKYDADFYD--TTLRACALAVD 719

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           ++  P   +T++G  G  LSGGQK RI++ARA+  +    +LD+  +A+D   ++  I +
Sbjct: 720 LSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEH 779

Query: 624 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+ SK   + +  +++S +  ++++ +L  +G +++ G ++E+ S+ +SALS++
Sbjct: 780 VLGSQGLLSSKVKVLAT--NKISVLSIADHISLL-ENGEIIQQGSYEEVTSDKSSALSKI 836

Query: 682 L 682
           +
Sbjct: 837 I 837

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  123 bits (309), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 128/536 (23%), Positives = 221/536 (41%), Gaps = 54/536 (10%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + LY F  FF         A   +F +L  +       L    +K+ LH    F D  
Sbjct: 927  FYMGLYTFFVFFNY------FATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTT 980

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQXXXXXXXXX 275
             +G +++R   D    + ++  ++++ V+  +     +VGV +MC +  P          
Sbjct: 981  PIGRVLNRFTKD----TDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAVPFLL 1036

Query: 276  XXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 335
                  A  +    R   +        +     E LSG+ T++++  E   L++ +  I 
Sbjct: 1037 LIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSDFLIN 1096

Query: 336  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 395
             + + G               ++  ++F  ++   + L +  Q SI   +  +L T Y  
Sbjct: 1097 KMNEAGYVVVAIQRWVSIALDMIA-MAFALII---TLLCVTRQFSISAASVGVLLT-YVL 1151

Query: 396  NAVFGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTVGHKYKPDRGVIE 444
                 L+T    + QG     +A RL         E   R+P  SP    +  P  G I+
Sbjct: 1152 QLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPP---ESWPSEGAID 1208

Query: 445  FKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 503
            F  VS +Y  RP +  +   ++  +  G  + I G +G GKSTI   L R      G+I 
Sbjct: 1209 FDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHDGSIT 1266

Query: 504  IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT--------------YGLTYTPTK 549
            ID  DI ++    LR  + I+ Q+PVL  G +R N+                      T+
Sbjct: 1267 IDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGAIATE 1326

Query: 550  EEIRSVAKQCFCHNFITKFPNTY-DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDE 608
            +E  + A        +T     + +  +  +G+  S G++Q +A+ RAL++   +LILDE
Sbjct: 1327 DEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDE 1386

Query: 609  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 664
            ATS++D E++  I             T++ IAHRL+TI   + ++VL   G V E 
Sbjct: 1387 ATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVLDQ-GRVCEF 1439

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/273 (29%), Positives = 116/273 (42%), Gaps = 44/273 (16%)

Query: 447 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 506
           D S S   + + + FK+LN +IA G  V + G  G GKS++   +  +    +G      
Sbjct: 580 DTSSSNEPKVNFKGFKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSG------ 633

Query: 507 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT--KEEIRSVAKQCFCHNF 564
            DI K     L  +       P + + T++DNI +G  +     KE IR     C     
Sbjct: 634 -DIYKNGSLLLCGY-------PWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQAD 681

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--N 622
           +   P    T IG  G  LSGGQK RI +AR++ KK  + + D+  SA+D      I   
Sbjct: 682 LDLLPAGDKTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDE 741

Query: 623 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL------------ 670
              G L      T V   H+LS I R+  VI +  DG+ V+ G   EL            
Sbjct: 742 CMMGAL---DGKTRVLATHQLSLIARASKVIFIDLDGT-VDSGTLDELKSRHAGFVKLME 797

Query: 671 YSNPTSALS------QLLNERTAPVPSEQQQQV 697
           YSN TS         ++ +E   P P   Q ++
Sbjct: 798 YSNHTSTDEEEGQDGEVEHEENRPGPHRSQSEI 830

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  122 bits (307), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 99/330 (30%), Positives = 166/330 (50%), Gaps = 32/330 (9%)

Query: 376 QSQLSIGDLTAFMLYT-EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPT 431
           ++QLS G +   M Y+ E T +  + + T    I     +  R+ E  +  P   SI+P 
Sbjct: 660 KNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVM-IETNIVSVERIVEYCELPPEAQSINPE 718

Query: 432 VG-HKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 489
               +  P  G IEFK+ S  Y  R ++  + K +N  I P   + IVG +G GKST++L
Sbjct: 719 KRPDENWPSEGRIEFKNYSTKY--RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSL 776

Query: 490 LLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 549
            L R   P+ G I+ID+ +I+++    LR ++ I+ Q+     GT+R N+     Y  ++
Sbjct: 777 ALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SE 834

Query: 550 EEIRSVAKQCFCHNFITKF------------------PNTYDTVIGPNGTLLSGGQKQRI 591
           +E++   +     + + K                    +  D  I  NG+ LS GQ+Q +
Sbjct: 835 DELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLL 894

Query: 592 AIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 651
            +ARAL+    +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ 
Sbjct: 895 CLARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDK 952

Query: 652 VIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
           +IVL   G+V E     +L S+  S    L
Sbjct: 953 IIVLDK-GNVKEFDSPSKLLSDKGSIFYSL 981

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 116/233 (49%), Gaps = 16/233 (6%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRR--HIG 522
           +F+   G  +C+VG  G GKST    +L      +G+          +  K + R   + 
Sbjct: 88  HFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGSK-------ESLAPKLIIRASSLA 140

Query: 523 IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL 582
              QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G  G  
Sbjct: 141 YCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGIS 198

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIA 640
           LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I +   G+    K+ TI+   
Sbjct: 199 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 258

Query: 641 HRLSTIRRSENVIVLGHDGSVVEMGKFKELY--SNPTSALSQLLNERTAPVPS 691
           + +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P+ +
Sbjct: 259 NTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDN 310

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 134/557 (24%), Positives = 233/557 (41%), Gaps = 80/557 (14%)

Query: 160  FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 219
            F + +Y F  F ++  L G      +F LL  +  R    L    + + +H    F ++ 
Sbjct: 839  FYMGMYSFFVFGSIVFLTG------QFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMEST 892

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQXXXXXXXXX 275
             +G +++R   D    + S+  ++ D ++ ++   C +VG+ ++C +  P          
Sbjct: 893  PMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGLG 948

Query: 276  XXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE------------ 323
                   S +    R   +        +     + L G+ T++++ AE            
Sbjct: 949  LILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLID 1008

Query: 324  -GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG 382
              NE S    A++    +               SLL       +    + +VL   L I 
Sbjct: 1009 KTNEASYLYTAVQR--WINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIP 1066

Query: 383  DLT----AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP 438
            DL       +  TE   N+V  L T+ +E+ Q A     +       PS       K  P
Sbjct: 1067 DLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHGEEV-------PS-------KTWP 1112

Query: 439  DRGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
            + G I+F++V +++    P+V        KIA G  V I G +G GKST+   L R    
Sbjct: 1113 ENGEIKFENVRYTHRDGLPAV--LDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREV 1170

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 557
             +G +MID+ D++K+N  +LR  + I+ Q+PVL  G++R N+       P  E    V K
Sbjct: 1171 ESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNL------DPFGEYDDDVLK 1224

Query: 558  QCFCHNFITKFPNT---------------------YDTVIGPNGTLLSGGQKQRIAIARA 596
                   + KF  T                      D  +  NG   S G++Q +A+ARA
Sbjct: 1225 NALMRCTVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARA 1284

Query: 597  LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656
            LI+  ++L+LDEAT+A+D  ++  +     +  K +  T++ +AHRL TI   + ++VL 
Sbjct: 1285 LIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVL- 1341

Query: 657  HDGSVVEMGKFKELYSN 673
             +G ++ +   K L  N
Sbjct: 1342 ENGKIIGLDTPKSLLDN 1358

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 114/216 (52%), Gaps = 28/216 (12%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKST----IALLLLRYYNPTTGTIMIDNQDITKMNCKS 516
           F  LNF+I  G  + IVGP G GK++    I  L+ +Y N   G + +D   ++   C  
Sbjct: 531 FHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGNE--GELEVDGSLVS---CGY 585

Query: 517 LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD-TV 575
                      P + + T+RDNI +G  Y  +K   + V + C     + K  + YD T 
Sbjct: 586 -----------PWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKL-SAYDMTE 631

Query: 576 IGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSM 634
           IG  G  LSGGQK RI +AR+L K+  + + D+  SA+D    +  +     + +K+K+ 
Sbjct: 632 IGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNKTR 691

Query: 635 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            + +  H+LS I +++ +IVLG+DG   +MG++++L
Sbjct: 692 VLAT--HQLSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 126/229 (55%), Gaps = 9/229 (3%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 496
            P+ G I+F  V++S   RP ++ I K ++  I P   + IVG +G GKS++ L L R   
Sbjct: 1270 PESGEIKF--VNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIE 1327

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
              +G I+ID   I  +    LR  + I+ Q+  +  GT+R+NI     Y  T EEI +  
Sbjct: 1328 AASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENIDPTNRY--TDEEIWNAL 1385

Query: 557  KQCFCHNFITKF-PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
                  + I     N  +T++   G+ LS GQ+Q + +ARAL+    +LILDEAT+A+DV
Sbjct: 1386 ALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDV 1445

Query: 616  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 664
            E++  I  T     K +  TI++IAHR++TI  S+ +IVL   G V E 
Sbjct: 1446 ETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTEF 1491

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 130/269 (48%), Gaps = 42/269 (15%)

Query: 439 DRGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
           D GV +  D +F +  +P  ++  K++NF    G   CIVG  G GKS +   LL     
Sbjct: 621 DEGV-KVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGKVGSGKSALIQSLL----- 674

Query: 498 TTGTIMIDNQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
                     D+ ++    ++   +  V Q P +M+GT++DNI +G  Y P  E  +   
Sbjct: 675 ---------GDLIRVKGFATVHGDVANVSQVPWIMNGTVKDNILFGHKYDP--EFYQLTI 723

Query: 557 KQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616
           K C     ++  P+   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D  
Sbjct: 724 KACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEH 783

Query: 617 -SEGAINYTFG---------QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            ++  I +  G         +++ +  +T++SIA          + I L  +G +++ G 
Sbjct: 784 VAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA----------DSITLMENGEIIQQGS 833

Query: 667 FKELYSNPTSALSQLLNE---RTAPVPSE 692
           + ++  +  S LS+L+ E   +  P PS+
Sbjct: 834 YDQVNESTNSPLSKLIAEFGKKGKPTPSQ 862

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 141/283 (49%), Gaps = 11/283 (3%)

Query: 407  EIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPT---RPSVQ-IFK 462
            E+     +  R+ E  + KP  +P +    +P +G     D+ F + +   RP +Q I +
Sbjct: 1217 EVETNIVSVERIKEYAELKPE-APAIIESSRPPKGWPSQGDIRFEHYSTRYRPELQLILR 1275

Query: 463  SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIG 522
             +N  I     V IVG +G GKS++ L L R      G I ID      +    LR  + 
Sbjct: 1276 DVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGLSTDTIGLADLRHKLS 1335

Query: 523  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVIGPNGT 581
            I+ Q+  + +GT+R+N+    T   T EEI    +       +    N    T++   G+
Sbjct: 1336 IIPQDSQVFAGTLRENVDP--TEEFTDEEIWHALELSHLKEHVMSMGNDGLQTMLTECGS 1393

Query: 582  LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
             LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++  I  T     K++  TI++IAH
Sbjct: 1394 NLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIRTAFKNR--TILTIAH 1451

Query: 642  RLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
            R++TI  S+ +IVL ++G V E    + L   P S    L  E
Sbjct: 1452 RINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLCKE 1493

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 129/263 (49%), Gaps = 24/263 (9%)

Query: 424 RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGR 482
           R+PS++       K D  V    D +F +  +P  ++  K++NF+   G   CIVG  G 
Sbjct: 606 REPSVTS------KGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVGS 659

Query: 483 GKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 542
           GKS +   +L       G   I                +  V Q P +M+GT+++NI +G
Sbjct: 660 GKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKENILFG 706

Query: 543 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPT 602
             Y P+  E     K C  +  ++  P    T++G  G  LSGGQK R+++ARA+  +  
Sbjct: 707 HKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRAD 764

Query: 603 VLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
             +LD+  +A+D   ++  ++   G      S T V   ++++ +  ++++ +L  +G +
Sbjct: 765 TYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADSIALL-ENGEI 823

Query: 662 VEMGKFKELYSNPTSALSQLLNE 684
           V+ G + E+  +  SALS+L++E
Sbjct: 824 VQQGSYDEVVRDDGSALSKLIHE 846

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 132/548 (24%), Positives = 240/548 (43%), Gaps = 42/548 (7%)

Query: 164  LYEFLSFFTVALLIGCVA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 221
            ++ F+  +++ L +G  A  N    I+L   S R   +L  ++ K  +     FF+   V
Sbjct: 1017 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 222  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXX 281
            G +I+R  SD   V  S+    S   K+++  +V + ++    P                
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 1135

Query: 282  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ-- 339
             + +    R   + +  +   +  +  E L+G   + ++    N   R+     D  Q  
Sbjct: 1136 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSN 1191

Query: 340  ---VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 396
               V               ++   +   T L   + +  ++QLS G +   M Y+    +
Sbjct: 1192 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 1251

Query: 397  AVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYKPDRGVIEFKDVSFSY 452
            ++  +      I     +  R+ E  +  P   SI+P     +  P  G IEFK+ S  Y
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY 1311

Query: 453  PTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 511
              R ++  + K +N  I P   + IVG +G GKST++L L R   P+ G I+ID+ +I++
Sbjct: 1312 --RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISE 1369

Query: 512  MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 568
            +    LR ++ I+ Q+     GT+R N+     Y  +++E++   +     + + K    
Sbjct: 1370 LGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLGN 1427

Query: 569  ---------------PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
                            +  D  I  NG+ LS GQ+Q + +ARAL+    +L+LDEAT+++
Sbjct: 1428 EAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASV 1487

Query: 614  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL   G+V E     +L S+
Sbjct: 1488 DMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDK-GNVKEFDSPSKLLSD 1544

Query: 674  PTSALSQL 681
              S    L
Sbjct: 1545 KGSIFYSL 1552

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 115/229 (50%), Gaps = 12/229 (5%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIV 524
           +F+   G  +C+VG  G GKST    +L      +G+         K+  ++    +   
Sbjct: 659 HFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGS---KESLAPKLIIRA--SSLAYC 713

Query: 525 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
            QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G  G  LS
Sbjct: 714 SQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLS 771

Query: 585 GGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHR 642
           GGQK R+++ARA+  +  + +LD+  SA+D E S+  I +   G+    K+ TI+   + 
Sbjct: 772 GGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNT 831

Query: 643 LSTIRRSENVIVLGHDGSVVEMGKFKELY--SNPTSALSQLLNERTAPV 689
           +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P+
Sbjct: 832 VSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTPI 879

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 7/251 (2%)

Query: 435  KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493
            K  P  G I+F+     Y  R  +  + K +N +I P   + IVG +G GKS++ L L R
Sbjct: 1286 KEWPVAGEIKFEHYYTRY--REDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFR 1343

Query: 494  YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553
                T+G I+ID   I ++    LR H+ I+ Q+  +  GTIR+NI     +T   +  R
Sbjct: 1344 IIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQFTDA-DIWR 1402

Query: 554  SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613
            ++       + +    +   T++   G+ LS GQ+Q + +ARAL+    VL+LDEAT+A+
Sbjct: 1403 ALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAV 1462

Query: 614  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
            DVE++  I  T     K +  TI++IAHR++TI  ++ +IVL   G VVE    + L  N
Sbjct: 1463 DVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVLD-KGKVVEFDTPEALLKN 1519

Query: 674  PTSALSQLLNE 684
              S    L  E
Sbjct: 1520 TNSIFYSLSKE 1530

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 134/287 (46%), Gaps = 26/287 (9%)

Query: 406 SEIMQGAGAASRLFE-LTD---RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI- 460
           + I++ + + SRLF  LT+   +K ++      K   D  V    + +F +  +P  ++ 
Sbjct: 605 TAIIESSVSVSRLFNFLTNEELQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVA 664

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
            K++N++   G   CIVG  G GKS     LL       G   I                
Sbjct: 665 LKNINYQAKKGELSCIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGS------------- 711

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
           +  V Q   +M+GT+RDN+ +G  Y P  E      K C     +    +   T++G  G
Sbjct: 712 VAYVSQVAWIMNGTVRDNVLFGHKYDP--EFYEKTIKACALTIDLATLVDGDQTLVGEKG 769

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFG--QLMKSKSMTIV 637
             LSGGQK R+++ARA+  +    +LD+  +A+D   S   + +  G   L+ SK+  + 
Sbjct: 770 ISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILA 829

Query: 638 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
           +  +++S +  ++++ +L  +G + + G + +   +  SAL +LL E
Sbjct: 830 T--NKISVLSAADSITLL-ENGEITQQGTYADCRKDEESALGKLLKE 873

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 141/287 (49%), Gaps = 33/287 (11%)

Query: 414  AASRLFELTDRKPSISPTVGH----KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKI 468
            +  R+ E  +  P     +      K  P RG I F++ S  Y  R ++  + K +  +I
Sbjct: 1264 SVERILEYCNLPPEADAIIEESRPPKEWPSRGAITFQNYSTKY--RENLDPVLKDITVEI 1321

Query: 469  APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEP 528
             P   + IVG +G GKST++L L R   P+ G+I+ID  DI K+    LR ++ I+ Q+ 
Sbjct: 1322 KPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDA 1381

Query: 529  VLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-----Y 572
                GTI+ N           I   L  +  K  I  +A +    N  T    T      
Sbjct: 1382 QAFEGTIKSNLDPFGQYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELL 1441

Query: 573  DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
               I  NG  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++  I  T     K +
Sbjct: 1442 SARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR 1501

Query: 633  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALS 679
              TI++IAHR+ T+  S+ ++VL       + G+ KE +  PT+ L+
Sbjct: 1502 --TILTIAHRIDTVMDSDKIMVL-------DKGEVKE-FDTPTNLLA 1538

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 115/226 (50%), Gaps = 17/226 (7%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIV 524
           +F+   G   CIVG  G GKST    +L      +G   +D     K+  ++  + I   
Sbjct: 650 HFEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYC 704

Query: 525 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLS 584
            Q+P +M+ +++DN+ +G  +   ++  ++  ++C     +   P+   T++G  G  LS
Sbjct: 705 PQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLS 762

Query: 585 GGQKQRIAIARALIKKPTVLILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIVSI 639
           GGQK R+++ARA+  +  V +LD+  SA+D E      E  +N   G L   K+ T++  
Sbjct: 763 GGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGIL---KNKTVILT 819

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYS-NPTSALSQLLNE 684
            + +S ++ S+N+  L  DG +VE   + +  S + +S L  L+ E
Sbjct: 820 TNAVSVLKHSQNIYAL-LDGEIVENKSYADAMSCDDSSILKTLIQE 864

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 128/244 (52%), Gaps = 14/244 (5%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
            P +G I+F+  S  Y    ++ + K +N  + P   + IVG +G GKS++ L L R    
Sbjct: 1269 PSKGDIKFEHYSTRYRENMNL-VLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEA 1327

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 557
              G I+ID   I ++    LR  + I+ Q+  +  GT+R+NI     Y  + EEI  V +
Sbjct: 1328 AEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQY--SDEEIWRVLE 1385

Query: 558  QCFCHNFITKF-PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616
                 N +     +   T +   G  LS GQ+Q + +ARAL+    +LILDEAT+A+DVE
Sbjct: 1386 LSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVE 1445

Query: 617  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
            ++  I  T     K +  TI++IAHRL+TI  S+ ++VL       + G+ +E +  P +
Sbjct: 1446 TDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL-------DAGEVRE-FDTPEN 1495

Query: 677  ALSQ 680
             L Q
Sbjct: 1496 LLKQ 1499

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 139/311 (44%), Gaps = 48/311 (15%)

Query: 397 AVFGLSTF--------YSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR-GVIEFK- 446
           A+F L +F         +  ++ + + +RL+     +      V H  K  + G +  K 
Sbjct: 574 ALFNLLSFPLNVVPMVLTAFIEASVSVNRLYSFLTNEELQKDAVHHLPKAQKAGDVAIKI 633

Query: 447 --DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 503
             D +F +  +P  Q+  K++N ++  G   C+VG  G GKS +   LL       G   
Sbjct: 634 SDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGDLYRVKGYAA 693

Query: 504 IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563
           +                   V Q P +M+GT++DNI +G  Y P   ++    K C    
Sbjct: 694 VHGST-------------AYVSQVPWIMNGTVKDNILFGHKYDPVFYDL--TIKACALTI 738

Query: 564 FITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAIN 622
            +   P+   T++G  G  LSGGQK R+++ARA   +    +LD+  +A+D   ++  I 
Sbjct: 739 DLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEHVAQHLIE 798

Query: 623 YTFG--QLMKSKS-------MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673
           +  G   L+KSK+       +T++SIA  +S +            G +++ G ++++  +
Sbjct: 799 HVLGPRGLLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQHGSYEDISKD 848

Query: 674 PTSALSQLLNE 684
             S LS L+ E
Sbjct: 849 LDSPLSNLVKE 859

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 142/259 (54%), Gaps = 31/259 (11%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
            P  G IEFK++S  Y    S +   +++FK+  G+ V IVG +G GKS+I   + R  + 
Sbjct: 1301 PQTGEIEFKNLSLRYSPHSS-KALDNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDW 1359

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 557
             +GTI+IDN+DI  ++ + LR  I  + Q P L  GTIR N+     Y+  K+   ++AK
Sbjct: 1360 ESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSD-KQVFDALAK 1418

Query: 558  -------QCFCHNFITK-------FPNTY---DTVIGPNGTLLSGGQKQRIAIARALIKK 600
                   +  C   +T         PN +   ++V+   G+ LS GQ+Q + +AR+++  
Sbjct: 1419 VGLIERNEVLC--LVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGS 1476

Query: 601  PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 660
              ++++DEAT+++D  S+  I  T  + M++   TI++IAHRL ++     ++V+     
Sbjct: 1477 RKIMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM----- 1529

Query: 661  VVEMGKFKELYSNPTSALS 679
              +MG+ KE Y +P + +S
Sbjct: 1530 --DMGRVKE-YDHPYNLIS 1545

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 112/229 (48%), Gaps = 9/229 (3%)

Query: 443 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 502
           + FKD +  +    +    K+++ +    S   I+GP+G GKS++ L LL   N  +G I
Sbjct: 664 VGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQI 723

Query: 503 MI---DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559
            +   D++D  ++    +   +    Q P L+SGTI DNI +G    P +    +V K C
Sbjct: 724 YVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKAC 781

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                +        T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D E+  
Sbjct: 782 CLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPETAL 841

Query: 620 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            I      G +MK ++  I S  H +S I +    +V+  +G V   GK
Sbjct: 842 NIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGK 888

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 138/584 (23%), Positives = 241/584 (41%), Gaps = 63/584 (10%)

Query: 136  VIGIVLDTLKTSSGSDFF-DLKIPIFSLPLYEFL-SFFTVALLIGCVANFGRFILLRILS 193
            VIG    +L +S    F+ + K P  S   Y  L SFF      G +   G++ L+  + 
Sbjct: 895  VIGTTFLSLFSSVWLSFWTEQKFPNRSTSFYMGLYSFFVFG---GYLFMNGQYTLICYMG 951

Query: 194  ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI-- 251
                  L    +++ LH    + D   +G +++R   D    + S+  ++++ ++  +  
Sbjct: 952  VTASKVLNLKAVERVLHTPMAYMDTTPIGRILNRFTKD----TDSLDNELTESLRLFMTQ 1007

Query: 252  -CGVVGVGMMCSLS-PQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVAEE 309
               ++GV +MC +  P                A  +    R   +        +     E
Sbjct: 1008 FANIIGVCVMCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNE 1067

Query: 310  QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAY 369
             L G+ T++++ ++   L + +  I  + + G               ++  ++F  ++  
Sbjct: 1068 VLGGMDTIKAYGSQERFLVKTDFLINKMNEAGYLLVALQRWVAIFLDMIA-VAFALII-- 1124

Query: 370  GSYLVLQSQL-----SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG----AASRL-F 419
             S L +  Q      S+G L  ++L      N +    T     M  A      A+ L  
Sbjct: 1125 -SLLCVTRQFHISPASVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVYCANELPL 1183

Query: 420  ELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVG 478
            E   ++P ++P    +  P +G I F+DVSF+Y  RP + +  K ++  I     + I G
Sbjct: 1184 EADYKRPELAPP---ESWPSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICG 1238

Query: 479  PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 538
             +G GKSTI   L R    + G I ID+ DI ++    LR+ + I+ Q+PVL  GTIR N
Sbjct: 1239 RTGAGKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKN 1298

Query: 539  ----------------ITYGLTYTPTKEEIR-----SVAKQCFCHNFITKFPNTYDTVIG 577
                            ++ G       E ++     S+      H F        D  + 
Sbjct: 1299 LDPFQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKF------HLDQKVE 1352

Query: 578  PNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 637
              G   S G++Q +A+ RAL+++  +LILDEATS++D E++  I             TI+
Sbjct: 1353 EEGANFSLGERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTIL 1410

Query: 638  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             IAHRL TI   + ++VL   G + E    + LY        Q+
Sbjct: 1411 CIAHRLKTILTYDRILVL-EQGEIEEFDTPRSLYEKKDGIFRQM 1453

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 103/218 (47%), Gaps = 22/218 (10%)

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514
           + S   FK+LN  I  G  V I GP G GKS++   +  +   T+GT+ +D      + C
Sbjct: 590 KKSFHGFKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDGD---LLMC 646

Query: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574
                        P + + T+RDNI +G  Y   KE    V + C     I   P    T
Sbjct: 647 GY-----------PWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELT 693

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSK 632
            IG  G  LSGGQK RI +AR++ K   + + D+  SA+D      I      G+L   K
Sbjct: 694 EIGERGITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---K 750

Query: 633 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             T +   H+LS I ++  VIVLG DGS  E GK ++L
Sbjct: 751 GKTRILATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 87/264 (32%), Positives = 135/264 (51%), Gaps = 13/264 (4%)

Query: 407  EIMQGAGAASRLFELTDRKPS----ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IF 461
            E+     +  R+ E  + +P     I+ +V     P  G I+F++ S  Y  RP +  I 
Sbjct: 1210 EVETNIVSVERIKEYAELEPEAPQFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLIL 1267

Query: 462  KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHI 521
            + +N  I P   V IVG +G GKS++AL L R      G I ID   I  +    LR+ +
Sbjct: 1268 RGINLHIKPHERVGIVGRTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKL 1327

Query: 522  GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-PNTYDTVIGPNG 580
             I+ Q+  +  GT+RDNI     Y  T E+I    +     + +     +  DT +   G
Sbjct: 1328 SIIPQDSQVFEGTVRDNIDPTKQY--TDEQIWKALELSHLADHVKGMGSDGLDTPLTEGG 1385

Query: 581  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 640
              LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++  I  T       +  TI++IA
Sbjct: 1386 KNLSVGQRQLMCLARALLIPFRILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIA 1443

Query: 641  HRLSTIRRSENVIVLGHDGSVVEM 664
            HR++TI  S+ ++VL   G+V E 
Sbjct: 1444 HRINTIMDSDKIVVL-DKGTVAEF 1466

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 129/241 (53%), Gaps = 24/241 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           + +F +  +P  ++  K++NF+       CI+G  G GKS +   +L             
Sbjct: 613 NATFLWQRKPEYKVALKNINFRAKKSELTCIIGKVGSGKSALIQAML------------- 659

Query: 506 NQDITKMNCKSL-RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++N  ++ R ++  V Q   +M+GT+RDNI +G  Y    +  +   K C     
Sbjct: 660 -GDLFRVNGSAVVRGNVAYVSQVAWIMNGTVRDNILFGHKYDA--KFYQQTIKACALTVD 716

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           ++  P+  +T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  +  
Sbjct: 717 LSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQN 776

Query: 624 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
            FG   L+KSK+  + +  ++++ +  ++++++L  +G +V+ G F E+ S+  SA+S+L
Sbjct: 777 VFGPNGLLKSKARVLTT--NKITALEIADHIVLL-ENGEIVQQGTFSEVISDEDSAISKL 833

Query: 682 L 682
           +
Sbjct: 834 V 834

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 89/279 (31%), Positives = 132/279 (47%), Gaps = 23/279 (8%)

Query: 414  AASRLFELTDRKPS----ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKI 468
            +  R+ E  D KP     I  +   K  P RG I F+  +  Y  R ++  + K ++ +I
Sbjct: 1282 SVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHYTTKY--RENLDPVLKDIDLRI 1339

Query: 469  APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEP 528
                 + +VG +G GKST+ L L R   P  G I ID  DI+ +    LRR + I+ Q+ 
Sbjct: 1340 KHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQDA 1399

Query: 529  VLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 577
                GT+R N           I   L  +  K  I  +  +        K  +  DT I 
Sbjct: 1400 QAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSELPDDE--NKPTDLLDTQIS 1457

Query: 578  PNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 637
             NG  LS GQ+Q + ++RAL+    +LILDEAT+A+D E++  I  T     K +  TI+
Sbjct: 1458 DNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR--TIL 1515

Query: 638  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676
            +IAHR+ T+  S+ ++VL   G V E      L  N  S
Sbjct: 1516 TIAHRIDTVLDSDKIMVLDK-GEVKEFDTPDNLLKNKES 1553

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 106/223 (47%), Gaps = 13/223 (5%)

Query: 454 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
           + P V +    NF        CIVG  G GKST    +L    P   +   D+    K  
Sbjct: 636 SSPGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQL-PCVSS---DSASGVKPK 691

Query: 514 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 573
                 ++    Q+P +M+ +++DNI +G  Y   +   +   K C     +   P+   
Sbjct: 692 VVIRADNLAYCPQQPWIMNASLKDNILFGYKYD--EAMYKKTIKACQLLPDLEILPDGDQ 749

Query: 574 TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LM 629
           T++G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+    +   L+
Sbjct: 750 TLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLL 809

Query: 630 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYS 672
           K+K  T++   + ++ +  S+ +I L  +G +VE   ++E+ S
Sbjct: 810 KNK--TVILTTNAVNVLVHSD-MIYLLKNGKIVESNSYEEVMS 849

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 124/535 (23%), Positives = 228/535 (42%), Gaps = 37/535 (6%)

Query: 173  VALLIGCVA-NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 231
            +  ++G +A  F +FI + +L       L    +++ LH    F D   +G +++R   D
Sbjct: 916  ILFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKD 975

Query: 232  AYVVSRSMTQKVSDGVKALICGVVGV----GMMCSLSPQXXXXXXXXXXXXXXXASVFGK 287
                + ++  ++++ V+ LI  +  +     +     P                A  +  
Sbjct: 976  ----TDTLDNEITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQA 1031

Query: 288  QIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXX 347
              R   +        +     E L G+ T++++ +E   L + +  I  + + G      
Sbjct: 1032 SGREIKRMDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGYLVTSI 1091

Query: 348  XXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSE 407
                     +L  + F  ++A    +  Q  +S G +   + Y       +  L    ++
Sbjct: 1092 QRWVAISLDMLA-VIFALIIALLC-VTRQFHVSAGSVGVMVTYVLQLPGLLNALLRSQTQ 1149

Query: 408  IMQGAGAASRLFELT-----DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-F 461
                  +A RL         + K  I  T   +  P  G I+F++VS +Y  RP + +  
Sbjct: 1150 TENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAY--RPELPVAL 1207

Query: 462  KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHI 521
            K+++  I     + I G +G GKSTI   L R     TG I ID+ DI+ +    LR  +
Sbjct: 1208 KNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELRSKL 1267

Query: 522  GIVQQEPVLMSGTIRDNITYGLTYTPT-------------KEEIRSVAKQCFCHNFIT-- 566
             I+ Q+PVL  G IR N+      T               ++++ S+  Q    N ++  
Sbjct: 1268 AIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDANGLSGD 1327

Query: 567  KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 626
             F    D ++  +G+  S G++Q +A+ RAL++   +LILDEATS++D  ++  I     
Sbjct: 1328 MFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKIQSRIV 1387

Query: 627  QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
            +  +  + TI+ IAHRL TI     ++VL   G VVE    K+LY++  S  +++
Sbjct: 1388 E--EFSNCTILCIAHRLKTILAYNRILVLDQ-GQVVEFDTPKKLYNDRDSIFNEM 1439

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 108/229 (47%), Gaps = 20/229 (8%)

Query: 461 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           F  LNF +     + I GP G GKS++   L  +   ++G++ I   D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 521 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNG 580
             ++   P + + T++DNI +G  +   K + + V + C     +   P    T IG  G
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFD--KPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 639
             LSGGQK RIA+AR++ K   + + D+  SA+D    +  ++      +K K+  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 640 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAP 688
            H+LS I ++  VI LG DGS  ++G   EL    T     +  + +AP
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQFQNSAP 801

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 137/260 (52%), Gaps = 30/260 (11%)

Query: 438  PDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 497
            P  G IEF++++  Y    S +    ++FK+  G+ V IVG +G GKS+I   + R  + 
Sbjct: 1314 PQTGDIEFENLTLRYSPHSS-KALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 1372

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSV 555
              GTI+IDN+DI  +  + LR  I  + Q P L  GTIR N+     Y+  +  E +  V
Sbjct: 1373 EDGTIIIDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKV 1432

Query: 556  A----KQCFC------------HNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIK 599
                  +  C            H    +F +  +TV+   G+ +S GQ+Q + +AR+++ 
Sbjct: 1433 GLIEQSEGLCSLPGQKLSYPSNHKLRNRFIDL-NTVVKSGGSNISQGQRQLLCLARSMLG 1491

Query: 600  KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 659
               ++++DEAT+++D  S+  I  T  + M++   T+++IAHRL ++   + ++V+    
Sbjct: 1492 ARNIMLIDEATASIDYVSDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM---- 1545

Query: 660  SVVEMGKFKELYSNPTSALS 679
               +MG+ +E Y +P + +S
Sbjct: 1546 ---DMGRVEE-YDHPYNLIS 1561

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 81/165 (49%), Gaps = 6/165 (3%)

Query: 504 IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563
           + ++D  ++    +   +    Q P L+SGTI+DNI +G  +   +++   V K C    
Sbjct: 729 VHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEFFN--QQKFDDVIKCCCLEK 786

Query: 564 FITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-- 621
            I        T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+D E+   I  
Sbjct: 787 DIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHIYE 846

Query: 622 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
               G +MK ++  + S  H +S I +    +V+  +G V   GK
Sbjct: 847 ECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDNGEVKAQGK 889

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 134/547 (24%), Positives = 222/547 (40%), Gaps = 48/547 (8%)

Query: 170  FFTVALLIGCVA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 225
            F  V  LIG ++    N    ++L   S R   +L  ++    ++    FF+   +G +I
Sbjct: 1016 FVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRII 1075

Query: 226  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVF 285
            +R   D   V   +    S   ++L+  +V V ++    P                 + +
Sbjct: 1076 NRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQAYY 1135

Query: 286  GKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 341
                  TS++L+  T      +  +  E L+G   + ++    N   R++    +  Q  
Sbjct: 1136 IV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESVQFN 1187

Query: 342  XXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGN 396
                          S+ L  +  L VLA G    S +    QL+ G +   M Y+    N
Sbjct: 1188 IDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTN 1247

Query: 397  AVFGLSTFYSEIMQGAGAASRLFEL----TDRKPSISPTVGHKYKPDRGVIEFKDVSFSY 452
            ++  +     +I     +  R+ E      +    I  T   K  P  G I+F D S  Y
Sbjct: 1248 SLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY 1307

Query: 453  PTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 511
              R ++  +   +N +I P   + IVG +G GKST+ L L R    T G I+ID  DI+ 
Sbjct: 1308 --RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDIST 1365

Query: 512  MNCKSLRRHIGIVQQEPVLMSGTIRDNI--------------TYGLTYTPTKEEI---RS 554
            +    LR ++ I+ Q+     GTIR N+                     P  E I   R 
Sbjct: 1366 LGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRD 1425

Query: 555  VAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 614
               +    N   K  N  +  I  NG+ LS GQ+Q + ++RAL+    +L+LDEAT+++D
Sbjct: 1426 DNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVD 1485

Query: 615  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNP 674
            +E++  I  T       +  TI++IAHR+ T+   + ++VL   G V E      L  N 
Sbjct: 1486 METDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLLENK 1542

Query: 675  TSALSQL 681
             S    L
Sbjct: 1543 NSIFYNL 1549

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 120/243 (49%), Gaps = 16/243 (6%)

Query: 461 FKSLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRR 519
           FK++N F++  GS  CIVG  G GK+T+   +L      +G      Q+           
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGA-----QESIPPKLIIRGN 698

Query: 520 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPN 579
            I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G  
Sbjct: 699 SIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGEK 756

Query: 580 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMT 635
           G  LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I     +   L+KSK  T
Sbjct: 757 GISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--T 814

Query: 636 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE-LYSNPTSALSQLLNERTAPVPSEQQ 694
           I+   + +S ++ S+ +  L  +  ++E G + + + S+  S L  L+NE      +  +
Sbjct: 815 IILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNSK 873

Query: 695 QQV 697
           ++V
Sbjct: 874 EEV 876

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 134/547 (24%), Positives = 222/547 (40%), Gaps = 48/547 (8%)

Query: 170  FFTVALLIGCVA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 225
            F  V  LIG ++    N    ++L   S R   +L  ++    ++    FF+   +G +I
Sbjct: 1044 FVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRII 1103

Query: 226  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQXXXXXXXXXXXXXXXASVF 285
            +R   D   V   +    S   ++L+  +V V ++    P                 + +
Sbjct: 1104 NRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQAYY 1163

Query: 286  GKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 341
                  TS++L+  T      +  +  E L+G   + ++    N   R++    +  Q  
Sbjct: 1164 IV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESVQFN 1215

Query: 342  XXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGN 396
                          S+ L  +  L VLA G    S +    QL+ G +   M Y+    N
Sbjct: 1216 IDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTN 1275

Query: 397  AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP----TVGHKYKPDRGVIEFKDVSFSY 452
            ++  +     +I     +  R+ E  +  P        T   K  P  G I+F D S  Y
Sbjct: 1276 SLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY 1335

Query: 453  PTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 511
              R ++  +   +N +I P   + IVG +G GKST+ L L R    T G I+ID  DI+ 
Sbjct: 1336 --RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDIST 1393

Query: 512  MNCKSLRRHIGIVQQEPVLMSGTIRDNI--------------TYGLTYTPTKEEI---RS 554
            +    LR ++ I+ Q+     GTIR N+                     P  E I   R 
Sbjct: 1394 LGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRD 1453

Query: 555  VAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 614
               +    N   K  N  +  I  NG+ LS GQ+Q + ++RAL+    +L+LDEAT+++D
Sbjct: 1454 DNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVD 1513

Query: 615  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNP 674
            +E++  I  T       +  TI++IAHR+ T+   + ++VL   G V E      L  N 
Sbjct: 1514 METDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLLENK 1570

Query: 675  TSALSQL 681
             S    L
Sbjct: 1571 NSIFYNL 1577

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 120/243 (49%), Gaps = 16/243 (6%)

Query: 461 FKSLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRR 519
           FK++N F++  GS  CIVG  G GK+T+   +L      +G      Q+           
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGA-----QESIPPKLIIRGN 726

Query: 520 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPN 579
            I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G  
Sbjct: 727 SIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGEK 784

Query: 580 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMT 635
           G  LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I     +   L+KSK  T
Sbjct: 785 GISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--T 842

Query: 636 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE-LYSNPTSALSQLLNERTAPVPSEQQ 694
           I+   + +S ++ S+ +  L  +  ++E G + + + S+  S L  L+NE      +  +
Sbjct: 843 IILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNSK 901

Query: 695 QQV 697
           ++V
Sbjct: 902 EEV 904

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 122/536 (22%), Positives = 215/536 (40%), Gaps = 79/536 (14%)

Query: 200  LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVV 255
            L + ++   L     FF+   +G +++R  +D Y    ++ R+ +Q  S+ VK     VV
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVV 1068

Query: 256  GVGMMCSLSPQXXXXXXXXXXXXXXXASVFGKQIRNTSKDLQEATGQLTRVA-----EEQ 310
                +C  + Q                  + +    TS++L+     +TR       +E 
Sbjct: 1069 ----ICVSTWQFIFFIVPMSFLYIYYQQYYMR----TSRELRR-LDSVTRSPTISHFQET 1119

Query: 311  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 370
            L GI T++ +  E   +      + +                     LG +  L     G
Sbjct: 1120 LGGISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLG 1179

Query: 371  SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 430
             Y + Q  ++ G +   + Y      ++  +     E+     +  R+ E ++   S +P
Sbjct: 1180 IYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEL-ASEAP 1238

Query: 431  TVGHKYKPDRGVIEFKDVSFS-YPTRPSVQ---IFKSLNFKIAPGSSVCIVGPSGRGKST 486
            ++    +PD    +   V F+ Y TR       + K +   I P   + IVG +G GKS+
Sbjct: 1239 SIVEDKRPDVNWPQDGAVKFNHYYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKSS 1298

Query: 487  IALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 546
            + L L R    + G I +D  +  ++    LR  + I+ Q+  +  GT+RDNI     YT
Sbjct: 1299 LTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNIDPTGQYT 1358

Query: 547  PTKEEIRSVAKQCFCHNFITKFP------------------------------------- 569
               EEI    +     + I                                         
Sbjct: 1359 --DEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSSDGLTSS 1416

Query: 570  -------NTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 622
                   N  +T +   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++  I 
Sbjct: 1417 GLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQ 1476

Query: 623  YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSAL 678
             T     K++  TI++IAHRL+TI  S+ ++VL       + G+ KE + +P + L
Sbjct: 1477 ETIRSAFKNR--TILTIAHRLNTIMDSDRILVL-------DKGEIKE-FDSPQTLL 1522

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 121/243 (49%), Gaps = 24/243 (9%)

Query: 447 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 505
           D +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L             
Sbjct: 615 DATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSGKSALIQSIL------------- 661

Query: 506 NQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564
             D+ ++    ++   +  V Q P +M+GT+++NI +G  +   K+      K C     
Sbjct: 662 -GDLFRVKGFATVHGDVAYVSQVPWIMNGTVKENILFGHKFD--KKFYEKTIKACALTID 718

Query: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINY 623
           ++  P+   T++G  G  LSGGQK R+++ARA+  +    + D+  +A+D    +  I +
Sbjct: 719 LSILPDGDSTLVGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEH 778

Query: 624 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQL 681
             G   L+ SK+     +A    T+    + I L  +G +++ GK++E+ S+P S L +L
Sbjct: 779 VLGPNGLLHSKTKV---LATNKITVLNIADYITLLDNGEIIQRGKYEEVTSDPGSPLCKL 835

Query: 682 LNE 684
           +NE
Sbjct: 836 INE 838

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 118/242 (48%), Gaps = 19/242 (7%)

Query: 443  IEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
            I F++VSF+Y  RP + +    ++F +  G  + I G +G GK+++   L R     +G+
Sbjct: 1145 IVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESGS 1202

Query: 502  IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
            I ID  DI  +    LR  + I+ Q+P+L  GT+R N+       P  E           
Sbjct: 1203 IKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNL------DPFAEHTDGTLWSALV 1256

Query: 562  HNFITK---FPNTY----DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 614
             + +      P ++    D  +   G   S G++Q +A+ARAL++   +LILDEATS++D
Sbjct: 1257 RSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALARALVRSTRILILDEATSSVD 1316

Query: 615  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNP 674
              ++  +        + +  T++ +AHRL TI   + ++VL   G V E      L++  
Sbjct: 1317 YATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRILVLDQ-GRVAEFDTPYRLFARK 1373

Query: 675  TS 676
             S
Sbjct: 1374 DS 1375

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 106/218 (48%), Gaps = 22/218 (10%)

Query: 461 FKSLN---FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSL 517
           F  LN   F I  G  + ++G  G GK+++   +  Y   TTG++ ++    + + C   
Sbjct: 548 FTGLNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---SLLFC--- 601

Query: 518 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 577
               G+    P + + TIRDNI +G ++  T+ +   V   C        FP    T +G
Sbjct: 602 ----GV----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVG 651

Query: 578 PNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 637
             G  LSGGQK RI++ARA+ K   + + D+  SA+D      I      L + ++ T +
Sbjct: 652 ERGITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRI 710

Query: 638 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYS-NP 674
              H+L+ ++ +  VI LG DGS  +MG   EL+  NP
Sbjct: 711 LATHQLALVQEASRVIFLGQDGS-FDMGTPAELHEKNP 747

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 104/220 (47%), Gaps = 24/220 (10%)

Query: 454 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513
           ++ S   F  L+F++  G  + I G  G GK+++   L  + + T G I  + +    + 
Sbjct: 583 SKTSFSGFSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR---MLF 639

Query: 514 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTY 572
           C +           P + + TIRDNIT+G   +P  E + R V + C     ++  P   
Sbjct: 640 CGA-----------PWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGD 685

Query: 573 DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMK 630
            T +G  G  LSGGQK RI +AR + K   + + D+  SA+D     +I  +   G+L  
Sbjct: 686 KTEVGERGITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL-- 743

Query: 631 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
               T +   H++S   ++  VI LG DGS  ++G   EL
Sbjct: 744 -GDKTRILATHQISLTEQASRVIYLGTDGS-FDIGTVDEL 781

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 66/117 (56%), Gaps = 6/117 (5%)

Query: 424  RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGR 482
            R P ++P    K  P+RG I F +V+ +Y  RP +  + + ++F I+ G  + I G +G 
Sbjct: 1184 RIPEMAPP---KAWPERGAITFDNVALAY--RPGLPLVLQDVSFHISSGEKIGICGRTGA 1238

Query: 483  GKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 539
            GKSTI   L R    + G++ ID  DI  +   +LR  + I+ Q+P+L  GTIR N+
Sbjct: 1239 GKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 3/112 (2%)

Query: 573  DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
            D  +  +G+  S G++Q +A+ARAL+++  +LILDEATS++D E++  I     Q  + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQ 1475

Query: 633  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
              TI+ +AHRL TI   + ++V+   G V E      LY+   S    + ++
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGSIFRSMCDQ 1526

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 112/232 (48%), Gaps = 19/232 (8%)

Query: 445 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL--------RYYN 496
           F+D S  +    +    K+++      S   I+GP+G GKS++ L LL        + Y 
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 497 PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
           PT     ++++D  ++    +   +    Q P L+SGTI+DN+ +G  +   K++   V 
Sbjct: 713 PT-----VESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFN--KQKFDDVM 765

Query: 557 KQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616
           K C     I        T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA+D E
Sbjct: 766 KSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPE 825

Query: 617 SEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
           +   I      G +MK ++  I S  H +S + +  + +V+   G V   GK
Sbjct: 826 TALYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGK 875

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 93/193 (48%), Gaps = 19/193 (9%)

Query: 468 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQE 527
           + PGSS+ I+GP+  GKS+I  +L   +     T ++     + + C        I Q+ 
Sbjct: 595 LGPGSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAESDLMC--------IAQRP 646

Query: 528 PVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPN-TYDTVIGPNG 580
             +  GT RD I Y ++     E      E+  + K+      + +    +Y   +    
Sbjct: 647 YFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWK 706

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 640
            +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +    +SI+
Sbjct: 707 DILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISIS 762

Query: 641 HRLSTIRRSENVI 653
            R S I+  + ++
Sbjct: 763 QRPSLIKYHDYLL 775

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 110/232 (47%), Gaps = 31/232 (13%)

Query: 464 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTIMIDNQDITKMNCKSLRRH 520
           L F    GSS+ I+GP+G GKS+I  ++      YN   G + I +++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 521 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 572
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTY 738

Query: 573 DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
              I     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 633 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
               +SI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 101/237 (42%), Gaps = 48/237 (20%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y       + K +N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 531 IIQLQDVSFGYEENSP--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGY 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             F  K    Y   +G  G           LLSGGQK R+A A   +  P +L+LDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 663
            LD     A+     N+T G LM S  +++  I H  S I  SE+  V   DG++ +
Sbjct: 680 HLDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 101/206 (49%), Gaps = 27/206 (13%)

Query: 464 LNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPTTGTIMIDNQDITKMNCKSLRRH 520
           L F    GSS+ I+GP+G GKS+I  ++      YN   G + I +++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIADVWPVYNKN-GLLSIPSEN-----------N 678

Query: 521 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 572
           I  + Q+P     GT+RD I Y ++           KE ++ +A+    +        TY
Sbjct: 679 IFCIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTY 738

Query: 573 DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 633 SMTIVSIAHRLSTIRRSENVIVLGHD 658
               +SI+ R + I+  E ++ +G +
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGEN 820

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 109/232 (46%), Gaps = 31/232 (13%)

Query: 464 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTIMIDNQDITKMNCKSLRRH 520
           L F    GSS+ I+GP+G GKS+I  ++      YN   G + I  ++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPPEN-----------N 678

Query: 521 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 572
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTY 738

Query: 573 DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 633 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
               +SI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 165/390 (42%), Gaps = 41/390 (10%)

Query: 290 RNTSKDLQEA---TGQLTRVAEEQLSGIKTVQSFVAEGNELSRY----NVAIRDIFQVGX 342
           R+TS+   E    T +  +   E  S IK ++ F  E N ++      +  +R +  +  
Sbjct: 537 RSTSRFQHEGLLVTDKRIQNLNELFSSIKIIKCFTWEDNFINHILRTRDSEVRKMKLISV 596

Query: 343 XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL- 401
                        +L+  +SF       +Y +   + ++    AF      T  ++FGL 
Sbjct: 597 IWSCNAIIWYLTPTLITSISF-------AYFIFCERATLTAPIAF------TALSLFGLL 643

Query: 402 -------STFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPT 454
                  S+  + I+Q   +  R+    D +P +          D     F   +  +  
Sbjct: 644 KMPLDQLSSTINYIVQSVISLRRIQSFLD-EPDMDKQKNLLLSKDGTYFMFSGATIGWSI 702

Query: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITK 511
                I ++LN K        + GP+G GKS + + LL   +   G I +    ++    
Sbjct: 703 NNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHELM 762

Query: 512 MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 571
           ++   L   I    Q P +++ +I++NI +G  +   +     V + C   N +    + 
Sbjct: 763 IHGDGLTNSISYCSQIPWIINDSIKNNILFGSEFNLKRYN--DVIRACCLTNDLRLLQDG 820

Query: 572 YDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF---GQL 628
            ++++G  G  LSGGQ+QR+++ARA+  K   +ILD+  SA+D +    I Y     G L
Sbjct: 821 DNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPL 879

Query: 629 MKSKSMTIVSIAHRLS-TIRRSENVIVLGH 657
           MK ++  +VS  H +   I+++  +++L +
Sbjct: 880 MKGRTCILVS--HNVELVIKKAAYLLILDN 907

>SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa]
           {ON} highly similar to gnl|GLV|KLLA0D04554g
           Kluyveromyces lactis KLLA0D04554g and similar to YCR011C
           uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1027

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 130/275 (47%), Gaps = 40/275 (14%)

Query: 437 KPD-RGVIEFKDVSFSYPTR--PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493
           KPD +  + F+++++   +    S Q+  S++  + PG  + I+G SG GK+T+ L +L 
Sbjct: 363 KPDVKATLTFENINYQVRSSKGSSTQVLNSISGSVKPGEILAIMGGSGAGKTTL-LDILA 421

Query: 494 YYNPT---TGTIMIDNQDITKMNCKSLRRHIGIVQQEP-----------VLMSGTIRDNI 539
             N T   TG+I ++  ++TK N     + +G V QE            VL S  +R  +
Sbjct: 422 MKNKTGKVTGSIRLNGTEVTKQN---YSKIVGFVDQEDFLLPTLTVYETVLNSALLR--L 476

Query: 540 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALI 598
              +++   ++ +  V ++        +     + VIG +    +SGG+K+R++IA  L+
Sbjct: 477 PRSMSFAAKQKRVYQVLEE-------LRIFEIRNRVIGNDLERGISGGEKRRVSIACELV 529

Query: 599 KKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGH 657
             P +L LDE TS LD  +   +     +L    + T I+SI    S I +  + +VL  
Sbjct: 530 TSPLILFLDEPTSGLDSNNANNVIECLVRLANHYNRTLILSIHQPRSNIFKLFDKLVLLS 589

Query: 658 DGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSE 692
           +G +V        YS     +S+ L  +    PS+
Sbjct: 590 EGELV--------YSGEAVRVSEFLRNQGFTCPSD 616

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 92/191 (48%), Gaps = 21/191 (10%)

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIV 524
           N  + PGSS+ I+GP+  GKS+I  ++   +     T ++     + M C        I 
Sbjct: 592 NVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLLSIPSESDMMC--------IA 643

Query: 525 QQEPVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPNTYDTV--I 576
           Q+   +  GT RD I Y +      E      E+  V K+    +++ K  +  + +  +
Sbjct: 644 QRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRADALNYLDHV 702

Query: 577 GPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTI 636
                +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  L K +    
Sbjct: 703 ADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR-FNF 758

Query: 637 VSIAHRLSTIR 647
           +SI+ R S I+
Sbjct: 759 ISISQRPSLIK 769

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 113/242 (46%), Gaps = 31/242 (12%)

Query: 443 IEFKDVSFSYP----TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 496
           + F+++S+  P    ++   ++  S+   + PG  + I+G SG GK+T+   L + R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 497 PTTGTIMIDNQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTY 545
              GTI ++   I     K   + IG V Q           E VL S  +R  +   + +
Sbjct: 456 RVQGTIAVNGHSILN---KLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 546 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVL 604
           T  ++ +  V ++        +  +  D +IG +    +SGG+K+R++IA  L+  P +L
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPAIL 563

Query: 605 ILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVE 663
            LDE TS LD  +   +     +L K+ + T+V SI    S I    + +VL  DG ++ 
Sbjct: 564 FLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEMIY 623

Query: 664 MG 665
            G
Sbjct: 624 SG 625

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 116/243 (47%), Gaps = 28/243 (11%)

Query: 439 DRGVIEFKDVSFSYPT-RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYY 495
           +   + F++++++  + +    I K ++  I PG  + ++G SG GK+T+   L + R  
Sbjct: 373 NAAALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKT 432

Query: 496 NPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLT 544
              TG+I ++  DI +   K   + IG V Q           E VL S  +R  +    +
Sbjct: 433 GQVTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLR--LPRSFS 487

Query: 545 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTV 603
           +   +  +  V ++        +  +  D VIG +    +SGG+K+R++IA  L+  P +
Sbjct: 488 FAAKQTRVYQVLEE-------LRILDIKDRVIGNDFERGISGGEKRRVSIACELVTSPLI 540

Query: 604 LILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVV 662
           L LDE TS LD  +   +     +L K+ + T+V SI    S I +  + +VL  +G +V
Sbjct: 541 LFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMV 600

Query: 663 EMG 665
             G
Sbjct: 601 YSG 603

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 121/239 (50%), Gaps = 21/239 (8%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN-- 496
            +GV  +KDV +  P + S + +   ++  + PG +  ++G SG GK+T+  +L +  +  
Sbjct: 799  KGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLT-ALMGASGAGKTTLLNVLAQRMDFG 857

Query: 497  -PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTK 549
              ++G I++D + + +      +R +G VQQ+ +     T+R+++ +          P  
Sbjct: 858  IVSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDA 913

Query: 550  EEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDE 608
            E++  V K       +    +  D V+G  G  L+  Q+++++I   L+ KPT+L+ LDE
Sbjct: 914  EKMEYVEKIIV----VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDE 969

Query: 609  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS-ENVIVLGHDGSVVEMGK 666
             TS LD +S  AI     +L ++    + +I    +T+  S + +++L   GSVV  G 
Sbjct: 970  PTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGN 1028

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 114/254 (44%), Gaps = 32/254 (12%)

Query: 424 RKPSISPTVGHKYKPDRGVIEFKDVSFSYP---------TRPSVQIFKSLNFKIAPGSSV 474
           R  +I   +  KY  D G      +SF  P         +  ++ I K L F+  PGSS+
Sbjct: 546 RLENIDVVIPSKYGKD-GTRLINKLSFQVPPVITLGNGNSDSNLNINKKLAFQ-GPGSSM 603

Query: 475 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLM-SG 533
            I+GP+G GK++I  ++   +       ++     + + C         V Q+P  +  G
Sbjct: 604 LILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC---------VPQKPYFIQGG 654

Query: 534 TIRDNITYGLTYTPT------KEEIRSVAKQCFCHNFITKFPNT-YDTVIGPNGTLLSGG 586
           T R+ I Y ++           +E+  +  +      + +     Y   +     +LSGG
Sbjct: 655 TFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEWKDVLSGG 714

Query: 587 QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 646
           ++QRI  AR +  KP  ++LDEAT+A+  + E   +Y FG L+K      ++I+ R S I
Sbjct: 715 ERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKRYRFNFITISQRPSLI 770

Query: 647 RRSENVIVLGHDGS 660
           +  +  + +  DG+
Sbjct: 771 KYHDLALDISTDGT 784

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 104/210 (49%), Gaps = 20/210 (9%)

Query: 458 VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSL 517
           + + + L FK  PGSS+ I+GP+G GK++I  ++   + P      I N++   ++  + 
Sbjct: 589 INLSQKLMFK-GPGSSMLILGPNGSGKTSIQRIIAEIW-P------IYNKN-GLLSVPAE 639

Query: 518 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPT------KEEIRSVAKQCFCHNFITKFPNT 571
           R  I I Q+   +  GT R+ I Y ++           +E+  V K+      + +    
Sbjct: 640 RELICIPQKPYFIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGW 699

Query: 572 -YDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMK 630
            Y   +     +LSGG++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K
Sbjct: 700 RYLDAVAEWKDVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLF-NMLK 755

Query: 631 SKSMTIVSIAHRLSTIRRSENVIVLGHDGS 660
                 ++I+ R S I+  +  + +G D S
Sbjct: 756 RYRFNFITISQRPSLIKYHDLALEIGADES 785

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 109/232 (46%), Gaps = 31/232 (13%)

Query: 464 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTIMIDNQDITKMNCKSLRRH 520
           L F    GSS+ I+GP+  GKS+I  ++      YN   G + I +++           +
Sbjct: 631 LPFLQGSGSSLLILGPNSCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 521 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 572
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFCIPQKPYFSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTY 738

Query: 573 DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 632
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 633 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684
               +SI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1020

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 120/262 (45%), Gaps = 22/262 (8%)

Query: 440 RGVIEFKDVSFSYPT-RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 496
           R  + F+D+S+S  + +  + +   ++  + PG  + ++G SG GK+T+   L +     
Sbjct: 364 RSTLTFEDISYSITSNKKEINLLNGISGSVRPGEIMALMGGSGAGKTTLLDILAMKEKAG 423

Query: 497 PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLM-SGTIRDNI-TYGLTYTPTKEEIRS 554
             +G I ++ + +TK N   L   IG V QE  L+ + T+ + +    L   P K  +  
Sbjct: 424 KVSGLIKVNGKGVTKQN---LAEIIGFVDQEDFLLPTLTVYETVLNSALLRLPRK--MSF 478

Query: 555 VAKQCFCHNFITKFPNTYDTVIGPNGTL---LSGGQKQRIAIARALIKKPTVLILDEATS 611
            AKQ   +  + +                  +SGG+K+R++IA  L+  P++L LDE TS
Sbjct: 479 TAKQKRVYQVLEELRIIDIKDRIIGDDFDRGISGGEKRRVSIACELVTSPSILFLDEPTS 538

Query: 612 ALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            LD  +   +     +L    + T+V SI    S I +S + +VL   G +V        
Sbjct: 539 GLDSNNANNVIECLVRLALHYNRTLVLSIHQPRSNIFKSFDKLVLLSQGEMV-------- 590

Query: 671 YSNPTSALSQLLNERTAPVPSE 692
           +S   + +S+ L       PS+
Sbjct: 591 FSGAATDVSEFLRNNNYNCPSD 612

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 90/207 (43%), Gaps = 38/207 (18%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y   P   + K +N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 534 IIQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGF 591

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSVAKQC 559
           +            ++ R  IG   Q  V      +  + +  T  P K  EE R      
Sbjct: 592 V-----------SRNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYR------ 634

Query: 560 FCHNFITKFPNTYDTVIGPNG----TLLSGGQKQRIAIARALIKKPTVLILDE-----AT 610
                +  F      + G  G     LLSGGQK R+A A   +  P +L+LDE      T
Sbjct: 635 ---RHLGSFG-----ITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDT 686

Query: 611 SALDVESEGAINYTFGQLMKSKSMTIV 637
           S LD   +   N++ G LM S  ++I+
Sbjct: 687 SGLDALEDSLKNFSGGVLMVSHDISII 713

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSHD 426

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 427 RAFLNEVATDIIYQHN 442

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 121/249 (48%), Gaps = 31/249 (12%)

Query: 441 GVIEFKDVSFSYPT----RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL--RY 494
             + F+++S++ P+         I K+++  + PG  + I+G SG GK+T+  +L   R 
Sbjct: 431 AALSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRK 490

Query: 495 YNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGL 543
               +G I I+ +++++   + + + IG V Q           E VL S  +R  +   +
Sbjct: 491 SGHVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSM 545

Query: 544 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPT 602
           T+   ++ +  V ++        +  N  D +IG +    +SGG+K+R++IA  L+  P 
Sbjct: 546 TFYQKQQRVFQVLEE-------LRIYNIKDRLIGDDFERGISGGEKRRVSIACELVTSPL 598

Query: 603 VLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR-LSTIRRSENVIVLGHDGSV 661
           +L LDE TS LD  +   +     +L K+ + T+V   H+  S I    + +VL   G +
Sbjct: 599 ILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEM 658

Query: 662 VEMGKFKEL 670
           V  G+ + +
Sbjct: 659 VYSGEIRRV 667

>AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR011C (ADP1) and
           YOL075C
          Length = 1011

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 128/268 (47%), Gaps = 39/268 (14%)

Query: 443 IEFKDVSFS-YPTRPS-VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN---P 497
           + F+++ +  +P+R S V+I  S++  ++PG  + ++G SG GK T  L +L   N    
Sbjct: 364 LTFENLCYKVFPSRSSPVRILNSISGYVSPGEILAVMGGSGAGK-TCLLDILGMKNKAGE 422

Query: 498 TTGTIMIDNQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTYT 546
            +GT+ I+   ITK    ++ + +G V Q           E VL S  +R  +   +++ 
Sbjct: 423 VSGTVKINGVPITK---HTVSKVVGFVDQDNHLLPTLTVYETVLNSALLR--LPRSMSFA 477

Query: 547 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLI 605
             ++ +  V ++        +  +  D +IG +    +SGG+K+R++IA  L+  P +L 
Sbjct: 478 AKQKRVYQVLEE-------LRIFDIRDRLIGNDFERGISGGEKRRVSIACELVTSPLILF 530

Query: 606 LDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEM 664
           LDE TS LD  +   +     +L      T+V SI    S I R  + +VL ++G +V  
Sbjct: 531 LDEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLLNEGEMV-- 588

Query: 665 GKFKELYSNPTSALSQLLNERTAPVPSE 692
                 YS P + ++  L       PS+
Sbjct: 589 ------YSGPITRVNDFLRNTGFNCPSD 610

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 91/212 (42%), Gaps = 46/212 (21%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y   P   + K +N  I   S + +VG +G GK+T+  ++L    P +G 
Sbjct: 531 IIQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGY 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             F  K    Y   +G  G           LLSGGQK R+A A   +  P +LILDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVS 638
            LD     A+     N+T G LM S  +++++
Sbjct: 680 HLDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 102/241 (42%), Gaps = 48/241 (19%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y    S  + K +N  +   S + +VG +G GK+T+  +++    P TG 
Sbjct: 532 IIQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGH 589

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
           +            ++ R  IG   Q  +       D++           ++ + A     
Sbjct: 590 V-----------SRNPRLRIGYFTQHHI-------DSM-----------DLNASAVDWMS 620

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             F  K    Y   +G  G           LLSGGQK R+A A   +  P +LILDE ++
Sbjct: 621 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSN 680

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            LD     A+     N++ G LM S  ++++        I  SE+  V   DG++ +  K
Sbjct: 681 HLDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKK 738

Query: 667 F 667
           +
Sbjct: 739 Y 739

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 643 LSTIRRSENVIVLGHD 658
            S +      I+  H+
Sbjct: 425 RSFLNEVATDIIYQHN 440

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 107/239 (44%), Gaps = 31/239 (12%)

Query: 471 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVL 530
           GSS+ I+GP+  GKS+I  +L   +       ++       + C         V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPIYNKNGLLSTPPSHDLFC---------VPQRPYF 665

Query: 531 MSG-TIRDNITYGLTYTPTKEE----------IRSVAKQCFCHNFITKFPNTYDTVIGPN 579
           + G T RD I Y +TY    E           +R V           +  N +D  I   
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRLDYLLKR--DRGLNYFDA-IADW 722

Query: 580 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 639
             +LSGG+KQR+   R +  +P  ++LDEAT+A+ V+ E  + +T   ++K      +SI
Sbjct: 723 KDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT---MLKRYRFNFISI 778

Query: 640 AHRLSTIRRSENVIVL--GHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQ 696
           + R S I+  + ++ L  G D S+  +G  + + S       + LN++   V   ++Q+
Sbjct: 779 SQRPSLIKYHDYLLELTNGTDWSLQALGSDEAILSIENEI--ETLNQKLTKVKEWERQR 835

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 100/239 (41%), Gaps = 55/239 (23%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y  +    + K +N  +   S + +VG +G GK+T+  +++    PT+G 
Sbjct: 531 IIQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGY 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNGRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             +  K    Y   +G  G           LLSGGQK R+A A   +  P +L+LDE ++
Sbjct: 620 KTYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
            LD     A+      +T G LM         ++H +S I    N I +  DG+V + G
Sbjct: 680 HLDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 103/242 (42%), Gaps = 54/242 (22%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           V+ F D+SF Y + PS  +++ LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 502 I--------------MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 548 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
              ++ +                            LS GQ+ R+  A   +++P VL+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 608 EATSALDVES----EGAIN-YTFGQLMKSKSMTIVS-IAHRLSTIRRSENVIVLGHDGSV 661
           E T+ LD+ +      AIN +  G ++ S    ++  IA  +  +   EN      DGS+
Sbjct: 541 EPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTATRWDGSI 597

Query: 662 VE 663
           ++
Sbjct: 598 LQ 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 109/234 (46%), Gaps = 21/234 (8%)

Query: 452 YPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI---------ALLLLRYYNPTTGTI 502
           +  + + QI + +N    PG    I+GPSG GKS++         + LL++++  +TG+I
Sbjct: 679 WLQKKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFH--STGSI 736

Query: 503 MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT---YTPTKEEIRSVAKQC 559
           +++   I+K   KS+  ++     + +L S T+R+   +      +  T ++ RS   + 
Sbjct: 737 LLNTNSISKEMFKSVCSYVS-QDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEI 795

Query: 560 FCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
                +T   NT   VIG      +SGG+K+R+ I   L+    +L+LDE TS LD  + 
Sbjct: 796 LLALGLTHCENT---VIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTSGLDSFTS 852

Query: 619 GAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            AI      L      T++   H  R    ++  +V++L   G     G   E+
Sbjct: 853 AAILEILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSGRAAFNGSPNEM 906

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH- 641
           LSGG+K+R+++A  L+  P+ + LDE T+ LD  S   +  +  +L +    + +   H 
Sbjct: 164 LSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKLARDGQKSFIMSVHQ 223

Query: 642 -RLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            R   +   ++V +L   G+VV  GK  E+
Sbjct: 224 PRSDIMFLLDSVCILSK-GNVVYCGKTTEM 252

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 80/188 (42%), Gaps = 45/188 (23%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           V+ F D+SF Y + PS  +++ LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 502 I--------------MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 548 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
              ++ +                            LS GQ+ R+  A   +++P VL+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 608 EATSALDV 615
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 136/328 (41%), Gaps = 65/328 (19%)

Query: 360 DLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAG 413
           D+    + AYG    SY+  +S+L    +  +    E   +       +  Y+ +++ A 
Sbjct: 294 DMRLQKLTAYGGNYDSYVKTRSELETNQMKQYHKQQEEIAHIKKFIASAGTYANLVKQAK 353

Query: 414 AASRLFELTDRKPSISPTVGHKYKPDR---------GVIEFKDVSFSYPTRPSVQIFKSL 464
           +  ++ +  +    + P V  +    R          V+ F ++SFSY  +P   ++++L
Sbjct: 354 SRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPPVLAFDEISFSYDEKPENNLYENL 413

Query: 465 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI--------------MIDNQDIT 510
           NF +   S V +VGP+G GKST+  ++     P  G +                D  D+T
Sbjct: 414 NFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQHSQDQLDLT 473

Query: 511 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 570
           K   + +R   G + ++     G +     YGLT      ++                  
Sbjct: 474 KSALEFVRDKYGHISEDFQYWRGQLG---RYGLTGEGQTVQM------------------ 512

Query: 571 TYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMK 630
                    GT LS GQ+ R+  A   + +P VL+LDE T+ LD+ +  ++     + + 
Sbjct: 513 ---------GT-LSEGQRSRVVFALLALDQPNVLLLDEPTNGLDIPTIDSL----AEAID 558

Query: 631 SKSMTIVSIAHRLSTIRR-SENVIVLGH 657
           + +  +V ++H    + R ++++ V+ H
Sbjct: 559 AFNGGVVVVSHDFRLLDRIAKDIYVVEH 586

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 80/188 (42%), Gaps = 45/188 (23%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           V+ F D+SF Y + PS  +++ LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 502 I--------------MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 548 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
              ++ +                            LS GQ+ R+  A   +++P VL+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 608 EATSALDV 615
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 124/281 (44%), Gaps = 38/281 (13%)

Query: 430 PTVGHKYKPD-RGVIEFKDVSFSYPTR--PSVQIFKSLNFKIAPGSSVCIVGPSGRGKST 486
           P+  +  K D   V+ FKD+ +  P     S  +   ++  + PG  + ++G SG GK+T
Sbjct: 382 PSDANFLKTDVEAVLTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTT 441

Query: 487 I--ALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ-----------EPVLMSG 533
           +   L + +     +G I ++ + I+K   K   + IG V Q           E VL S 
Sbjct: 442 LLDILAMKKKAGKVSGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSA 498

Query: 534 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIA 592
            +R  +   L +   +  +  V ++        +  +  D +IG      +SGG+K+R++
Sbjct: 499 LLR--LPRALPFEAKRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVS 549

Query: 593 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSEN 651
           IA  L+  P +L LDE TS LD  +   +     +L ++   T+V SI    S I +  +
Sbjct: 550 IACELVTSPLILFLDEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFD 609

Query: 652 VIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSE 692
            +VL  +G +V        YS     +++ L       P+E
Sbjct: 610 KLVLLSNGEMV--------YSGEAIRVNEFLRNNGYQCPTE 642

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 81/188 (43%), Gaps = 45/188 (23%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           V+ F D+SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 502 I--------------MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
           +                D  D+TK   + +R     V Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLG---RYGLTGEG 508

Query: 548 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
              ++ +                            LS GQ+ R+  A   +++P VL+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 608 EATSALDV 615
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 103/242 (42%), Gaps = 54/242 (22%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           V+ F ++SF+Y   P   ++++LNF +   S + +VGP+G GKST+  ++     P  G 
Sbjct: 392 VLAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGR 451

Query: 502 I--------------MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDG 508

Query: 548 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
            K ++                           GT LS GQ+ R+  A   ++ P +L+LD
Sbjct: 509 QKAQM---------------------------GT-LSEGQRSRVVFALLALQAPNILLLD 540

Query: 608 EATSALDVES----EGAIN-YTFGQLMKSKSMTIVS-IAHRLSTIRRSENVIVLGHDGSV 661
           E T+ LD+ +      AIN +  G ++ S    ++  IA  +  +   EN      DGS+
Sbjct: 541 EPTNGLDIPTIDSLAEAINTFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTAYRWDGSI 597

Query: 662 VE 663
           +E
Sbjct: 598 LE 599

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVES 617
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 99/239 (41%), Gaps = 55/239 (23%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y  +    + K +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYDEKN--LLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGY 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNGRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             F  K    Y   +G  G           LLSGGQK R+A A   +  P +LILDE ++
Sbjct: 620 KTFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
            LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 680 HLDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 141/320 (44%), Gaps = 53/320 (16%)

Query: 369 YGSYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAGAASRLFELTDRKP 426
           Y SY+  +++L    +  +    E   +       +  Y+ +++ A +  ++ +  +   
Sbjct: 308 YDSYIKTRTELETNQMKQYNKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADG 367

Query: 427 SISPTVGHKY------KPDR---GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 477
            I P V  +       + DR    V+ F D+SFSY  +P   +++ LNF +   S + +V
Sbjct: 368 LIQPVVQDRVFSFRFPQVDRLPPPVLAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALV 427

Query: 478 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGT--- 534
           GP+G GKST+  ++       TG +M  +  +++     L  +    Q +  L       
Sbjct: 428 GPNGVGKSTLLKIM-------TGELMSQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEF 480

Query: 535 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIA 594
           +RD       Y+   ++ +      +    + ++  T +      GT LS GQ+ R+  A
Sbjct: 481 VRDK------YSNISQDFQ------YWRGQLGRYGLTGEAQTVLMGT-LSEGQRSRVVFA 527

Query: 595 RALIKKPTVLILDEATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-S 649
              +++P VL+LDE T+ LD+ +      AIN   G         +V ++H    + + +
Sbjct: 528 LLALEQPNVLLLDEPTNGLDIPTIDSLADAINEFNG--------GVVVVSHDFRLLDKIA 579

Query: 650 ENVIVLGH------DGSVVE 663
           +++ V+ H      DGS++E
Sbjct: 580 KDIFVVEHKTATRWDGSILE 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 98/210 (46%), Gaps = 33/210 (15%)

Query: 463 SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTIMIDNQDITKMNCKSLRR 519
           +L F   PGSS+ I+GP+  GKS+I  ++      YN   G + I  +D  ++ C     
Sbjct: 675 TLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED--ELMC----- 726

Query: 520 HIGIVQQEPVL-MSGTIRDNITY----------GLTYTPTKEEIRSVAKQCFCHNFITKF 568
               + Q P     GT RD I Y          GL      + +  V  +        K 
Sbjct: 727 ----IPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKR--DKG 780

Query: 569 PNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQL 628
            + +D V      +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F ++
Sbjct: 781 WSYFDAVFDWKD-VLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KM 835

Query: 629 MKSKSMTIVSIAHRLSTIRRSENVIVLGHD 658
           +K      +SI+ R S ++  + ++ +  D
Sbjct: 836 LKKYRFNFISISQRPSLVKYHDLLLEISED 865

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 113/235 (48%), Gaps = 18/235 (7%)

Query: 441  GVIEFKDVSFSYPTRPSV-QIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 498
            GV  +K+V+F+ P + S  ++  +++   APGS   ++G SG GK+T +  L  R     
Sbjct: 843  GVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGII 902

Query: 499  TGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEI 552
            TG ++++ + I      S  R  G VQQ+ V +   T+R++  +          P  E++
Sbjct: 903  TGDMLVNGKPID----ASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKL 958

Query: 553  RSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATS 611
              V K       I    +  + +IG  G  L+  Q+++++I   L  KP +L+ LDE TS
Sbjct: 959  AYVEKII----EILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTS 1014

Query: 612  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 665
             LD +S  AI     +L ++    + +I    +T+    + +++L   G  V  G
Sbjct: 1015 GLDSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1069

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 86/178 (48%), Gaps = 25/178 (14%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           V+ F D+SFSY   P   +++ LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 390 VLAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGR 449

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP---TKEEIRSVAKQ 558
           +            +     +G+  Q         +D +   LT +P    +++  ++++ 
Sbjct: 450 V-----------SRHTHVKLGVYSQHS-------QDQLD--LTKSPLEFVRDKYPNISQD 489

Query: 559 C-FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
             +    + ++  T +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 490 FQYWRGQLGRYGLTGEAQTSQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 97/208 (46%), Gaps = 33/208 (15%)

Query: 457 SVQIFKSLN------FKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTIMIDNQ 507
           S Q FK +N      F    GSS+ I+GP+  GK++I  ++      YN   G + + +Q
Sbjct: 645 STQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIWPIYNKN-GLLSVPSQ 703

Query: 508 DITKMNCKSLRRHIGIVQQEPVLMS-GTIRDNITYGLTYTPTKEE------IRSVAKQCF 560
           +           +I  + Q P   S GT+RD I Y ++     +       +  + K+  
Sbjct: 704 E-----------NIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVN 752

Query: 561 CHNFITKFPN-TYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
               + +    TY   +     LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E 
Sbjct: 753 LKYLMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME- 811

Query: 620 AINYTFGQLMKSKSMTIVSIAHRLSTIR 647
             +Y F  ++K      ++I+ R S I+
Sbjct: 812 --DYLFN-ILKKYRFNFITISQRPSLIK 836

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 113/237 (47%), Gaps = 21/237 (8%)

Query: 442  VIEFKDVSFSYP-TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP--T 498
            V+ ++D+ +     R S +I  +++  + PG+   ++G SG GK+T+   L         
Sbjct: 852  VVHWRDLCYEVRIKRESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVI 911

Query: 499  TGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEI 552
            TG I +D     K+  +S  R IG  QQ+ + L + T+R+++ +          P  E+ 
Sbjct: 912  TGGIFVDG----KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKR 967

Query: 553  RSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATS 611
            + V +     N +   P   D ++G  G  L+  Q++R+ I   L+ KP +LI LDE TS
Sbjct: 968  KYVEEVI---NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTS 1023

Query: 612  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST--IRRSENVIVLGHDGSVVEMGK 666
             LD ++  +I     +L  ++   I+   H+ S   I+  + ++ L   G  V  G+
Sbjct: 1024 GLDSQTAWSICQLIRKL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 115/247 (46%), Gaps = 36/247 (14%)

Query: 445 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-------LRYYNP 497
           +K+ +F + T+   +I +S+N    PG    I+GPSG GKS++  L+       +     
Sbjct: 697 WKEGNFHHETK---EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFD 753

Query: 498 TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG-------LTYTPTKE 550
           T+G+IM ++  ++++  K++  ++     + +L + T+++ + Y        LT     E
Sbjct: 754 TSGSIMFNDIQVSELMFKNVCSYVS-QDDDHLLAALTVKETLKYAAALRLHHLTEAERME 812

Query: 551 E----IRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLI 605
                IRS+  +  C N           +IG      +SGG+K+R+ +   L+  P +L+
Sbjct: 813 RTDNLIRSLGLK-HCEN----------NIIGNEFVKGISGGEKRRVTMGVQLLNDPPILL 861

Query: 606 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVE 663
           LDE TS LD  +   I     +L + +  TI+   H  R    +R  NV++L   G    
Sbjct: 862 LDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAF 921

Query: 664 MGKFKEL 670
            G   E+
Sbjct: 922 NGSPDEM 928

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 93/217 (42%), Gaps = 37/217 (17%)

Query: 454 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-------------LRYYNPTTG 500
           ++ +  +  + +  +  GS + ++G SG GK+T+  +L             +RY    TG
Sbjct: 38  SKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTG 97

Query: 501 T---------IMIDNQDITKMNCKSLRRHIGIV---QQEPVLMSGTIRDNITYGLTYTPT 548
           +           +D QD        +++H+ +    QQ+ +    T R+ + +       
Sbjct: 98  SEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLN 151

Query: 549 KEEIRSVAKQCFCHNFITKF--PNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLI 605
             E     K+      I +    +  DT++G N    LSGG+K+R++I   +I  P+++ 
Sbjct: 152 SSE---RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMF 208

Query: 606 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
           LDE T+ LD  S   +  T  +L K    T +   H+
Sbjct: 209 LDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 245

>Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 113/236 (47%), Gaps = 18/236 (7%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 497
            +GV  +KDV F+ P   S + +  +++    PG+   ++G SG GK+T +  L  R    
Sbjct: 850  KGVFIWKDVCFTIPYEGSTRMLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGI 909

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTKEE 551
             TG ++++ + I      S  R  G VQQ+ + ++  T+R+++ +          P  E+
Sbjct: 910  ITGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQRLPDSEK 965

Query: 552  IRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEAT 610
            +  V K       +       + ++G  G  L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 966  MEYVEKII----RVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPT 1021

Query: 611  SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 665
            S LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1022 SGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1077

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 98/241 (40%), Gaps = 48/241 (19%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF +   PS  + K +N  +   S + IVG +G GK+T+  +L+    P  G 
Sbjct: 531 IIQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQG- 587

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
                                 V + P L        + Y   +     ++ + A     
Sbjct: 588 ---------------------YVSRNPRL-------RVAYFTQHHVDSMDLNASAVDWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
           + F  +    Y   +G  G           LLSGGQK R+A A   +  P +L+LDE ++
Sbjct: 620 NTFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            LD     A+      +T G LM S  ++++      + I  SEN  V   +G++ +   
Sbjct: 680 HLDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVRRFEGTIFDYKN 737

Query: 667 F 667
           +
Sbjct: 738 Y 738

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+V ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 110/237 (46%), Gaps = 12/237 (5%)

Query: 440  RGVIEFKDVSFSYPTRPSV-QIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 497
             GV  +KDV ++ P +    Q+  +++   APG+   ++G SG GK+T +  L  R    
Sbjct: 834  EGVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGI 893

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVA 556
             TG ++++   I      S  R  G VQQ+ + +   T+R+++ +        E I    
Sbjct: 894  ITGDMLVNGSPID----ASFERRTGYVQQQDIHIKEMTVRESLQFS-ARMRRPESIPDSE 948

Query: 557  KQCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSAL 613
            K  +    I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS L
Sbjct: 949  KMSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLDEPTSGL 1008

Query: 614  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKE 669
            D ++  AI     +L ++    + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1009 DSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGE 1065

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 99/223 (44%), Gaps = 21/223 (9%)

Query: 459 QIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPTTGTIMID---NQDITKM 512
           +I + +N    PG  + ++G  G G S+    +   +  +   TG I  D    +D+ K 
Sbjct: 159 KIIQGVNLLALPGEMILVLGRPGAGCSSFLKTISGEVDQFPEVTGDISYDGIPQKDMMKK 218

Query: 513 NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF------IT 566
               +  +  +    P L   T++  + + L        + + +++ +  +       I 
Sbjct: 219 YKPDVIYNGEMDVHFPHL---TVKQTLDFALACKVPSVRVNNASRKQYIASMRELYATIF 275

Query: 567 KFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF 625
              +TY+T +G +    +SGG+++R++IA AL  + ++   D AT  LD  +  A+ Y  
Sbjct: 276 GLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST--ALEYAQ 333

Query: 626 G-QLMKS--KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
             ++M +  KS  +V+I      I  + + + + +DG  +  G
Sbjct: 334 AIRIMTNLLKSTALVTIYQASENIYETFDKVTVLYDGRQIYFG 376

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 122/259 (47%), Gaps = 40/259 (15%)

Query: 443 IEFKDVSFSYPT---------RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLL 491
           + F+++++  P+           +V++ KS++  + PG    I+G SG GK+T+   L +
Sbjct: 390 LSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAM 449

Query: 492 LRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNIT 540
            R      G I ++   +++   KS  + IG V Q           E VL S  +R  + 
Sbjct: 450 KRKTGQVGGEIKVNGNIMSR---KSYSKLIGFVDQNDYLHPTLTVYETVLNSALLR--LP 504

Query: 541 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIK 599
             +++   +  +  + ++        +  +  D +IG +    +SGG+K+R++IA  L+ 
Sbjct: 505 RTMSFESKQSRVFQILEE-------LRIFDIKDRIIGNDFERGISGGEKRRVSIACELVT 557

Query: 600 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR-LSTIRRSENVIVLGHD 658
            P +L LDE TS LD  +   +  +  +L K+ + T++   H+  S I    N +VL   
Sbjct: 558 SPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVLLSQ 617

Query: 659 GSVVEMG---KFKE-LYSN 673
           G +V  G   K  E LY+N
Sbjct: 618 GEMVFSGDSIKIHEFLYNN 636

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 108/247 (43%), Gaps = 33/247 (13%)

Query: 445 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-------LRYYNP 497
           FK+   S     + +I +S+N    PG    I+GPSG GKS++  L+       L     
Sbjct: 702 FKNWKESKLHHETKEILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKFD 761

Query: 498 TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY-----------T 546
           T+GTIM ++  ++++  K++  ++     + +L + T+++ + Y                
Sbjct: 762 TSGTIMFNDIQVSELMFKNVCSYVS-QDDDHLLATLTVKETLKYAAALRLHHLNEAERTE 820

Query: 547 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLI 605
            T   IRS+  +  C N           +IG      +SGG+K+R+ +   L+  P +L+
Sbjct: 821 RTDNLIRSLGLK-HCEN----------NIIGNEFVKGISGGEKRRVTMGVQLLSDPPILL 869

Query: 606 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVE 663
           LDE TS LD  +   I      L K    T++   H  R    +R  NV++L   G    
Sbjct: 870 LDEPTSGLDSFTSATILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAF 929

Query: 664 MGKFKEL 670
            G   E+
Sbjct: 930 NGSPDEM 936

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 95/218 (43%), Gaps = 32/218 (14%)

Query: 454 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-------------LRYY----N 496
           ++ +  +  S +  +  GS + ++G SG GK+T+  +L             +RY      
Sbjct: 38  SKTNTTLVNSFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLRHEGSIRYVLEDSE 97

Query: 497 PTTGTIMIDNQDITKMNCK------SLRRHIGIV---QQEPVLMSGTIRDNITYGLTYTP 547
           P +G    ++ D+   N +        ++H+ +    QQ+ +    T R+ + +      
Sbjct: 98  PGSGYGSEESVDVKAKNSRLDGEDHHTQKHVIMAYLPQQDVLSPRLTCRETLNFA---AD 154

Query: 548 TKEEIRSVAKQCFCHNFITKFP--NTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVL 604
            K    S  K+      I +    +  DT++G N    LSGG+K+R++I   +I  P+++
Sbjct: 155 LKLNSSSRTKKLMVEQLIEELGLRDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIM 214

Query: 605 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            LDE T+ LD  S   +  T  +L K    T +   H+
Sbjct: 215 FLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 252

>TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {ON}
           Anc_3.133 YOL075C
          Length = 1312

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 107/234 (45%), Gaps = 35/234 (14%)

Query: 459 QIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT-------GTIMIDNQDITK 511
           +I  S+N    PG    I+GPSG GKS++  L+      +        G+I +++ +I++
Sbjct: 727 EILNSINATFKPGMINAIMGPSGSGKSSLLNLISAKQKSSMFATFSKEGSIALNDNEISE 786

Query: 512 MNCKSLRRHIGIVQQEPVLMSG-TIRDNITYG----LTYTPTKEE-------IRSVAKQC 559
              KSL  ++   Q +  L+S  T+R++  +     L Y  + E        IR++    
Sbjct: 787 EMFKSLCAYVS--QDDDHLLSKLTVRESFKFAADLRLHYMCSDERDEKIDTLIRALG--- 841

Query: 560 FCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
                     N  +T+IG      +SGG+K+R+++   L+K P +L+LDE TS LD  + 
Sbjct: 842 --------LTNCQNTIIGDEFVKGISGGEKRRVSMGIQLLKDPPILLLDEPTSGLDSFTS 893

Query: 619 GAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             +     QL      T++   H  R    ++  NV++L   G     G  KE+
Sbjct: 894 LTVLEILEQLSADFGKTVIITIHQPRAELFKKFGNVLLLAKSGRTAFNGSPKEM 947

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 104/244 (42%), Gaps = 44/244 (18%)

Query: 435 KYKPDRGV-IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-- 491
           K+KP   V +  +D++ +  ++    + +  +  +  GS + ++G SG GK+T+  +L  
Sbjct: 20  KFKPTNKVSLHVRDLTIT-ASKSKKTLIRDFSIDLPSGSVMAVIGGSGSGKTTLLNVLAS 78

Query: 492 -----LRYYNPTTGTI--MIDNQDIT-------KMNCKSLRRHIGIVQQEPVLMSG---- 533
                L Y    TG I  + DN   T       K++  S    +    QE +  S     
Sbjct: 79  KISGGLSY----TGDISYIADNNSSTTSSNPYEKVSVTSDTFSLSSTSQESIASSHASMA 134

Query: 534 ------------TIRDNITYG--LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPN 579
                       T R+ + Y   L    +KEE   +  +     +     +  DT++G +
Sbjct: 135 YLPQQDVLAPKLTCRETLMYSAELKLQQSKEENAKLVDELI---YELGLIDCADTLVGDS 191

Query: 580 GTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 638
               LSGG+K+R++I   +I  P+++ LDE T+ LD  S   +  T  +L +    T + 
Sbjct: 192 SHRGLSGGEKRRLSIGTQMISNPSLMYLDEPTTGLDAYSAFLVIKTIKRLAQFGGRTFIM 251

Query: 639 IAHR 642
             H+
Sbjct: 252 SIHQ 255

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 94/235 (40%), Gaps = 55/235 (23%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DV+F Y    +  + K +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVTFGY--NENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGY 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
           +            ++ R  +G   Q  V                     ++ + A +   
Sbjct: 589 V-----------SRNPRLRLGYFAQHHV------------------DAMDLNASAVEWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             F  +    Y   +G  G           LLSGGQK R+A A   +  P VLILDE ++
Sbjct: 620 KTFPGRSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
            LD     A+     N+T G LM         ++H +S I    N I +  DGS 
Sbjct: 680 HLDTSGIDALVDALKNFTGGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   TI+ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 109/277 (39%), Gaps = 66/277 (23%)

Query: 369 YGSYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAGAASRLFELTDRKP 426
           Y SY+  +++L    +  +    E   +       +  Y+ +++ A +  ++ +  +   
Sbjct: 418 YDSYIKTRTELETNQMKQYNKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADG 477

Query: 427 SISPTVGHKYKPDR--------------GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 472
            I P V     PDR               V+ F D+SF+Y   P   +++ LNF +   S
Sbjct: 478 LIQPVV-----PDRVFSFRFPPVERLPPPVLAFDDISFAYDGNPENNLYEHLNFGVDMDS 532

Query: 473 SVCIVGPSGRGKSTIALLLLRYYNPTTGTI--------------MIDNQDITKMNCKSLR 518
              +VGP+G GKST+  ++     P +G +                D  D+TK   + +R
Sbjct: 533 RTALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVR 592

Query: 519 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 578
                + Q+     G +     YGLT    K ++                          
Sbjct: 593 DKYSNISQDFQYWRGQLG---RYGLTGDAQKVQM-------------------------- 623

Query: 579 NGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
            GT LS GQ+ R+  A   ++ P VL+LDE T+ LD+
Sbjct: 624 -GT-LSEGQRSRVVFALLALENPNVLLLDEPTNGLDI 658

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+   +     + +K    T+V ++H
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 391

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 120/278 (43%), Gaps = 58/278 (20%)

Query: 423 DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPT---RPSVQIFKSLNFKIAP--------- 470
           +++  IS TV  K+   RG I  +++    P+   +  +++ K L F+I P         
Sbjct: 564 EKEEVISGTVQRKF---RG-IRLENIDIMIPSVRGKSGIKLIKKLTFQIPPHLDQLSSKT 619

Query: 471 --------------------GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 510
                                SS+ I+GP+G GKS+I  ++   +       ++   D +
Sbjct: 620 SSLQDITSMSNIPLPFLSGQASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSS 679

Query: 511 KMNCKSLRRHIGIVQQEPVLM-SGTIRDNITYGLTYTPTKEE------IRSVAKQCFCHN 563
            + C         + Q+P     GT RD I Y ++     +       +  +  +     
Sbjct: 680 SLLC---------IPQKPYFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDY 730

Query: 564 FITKFPN-TYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 622
            + + P  +Y   +     +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   +
Sbjct: 731 LLKRAPGWSYLDEVTEWKDVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---D 787

Query: 623 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVI-VLGHDG 659
           Y F  L K +  + ++I+ R S I+  + ++ +   DG
Sbjct: 788 YLFNMLKKFR-FSFITISQRPSLIKYHDMLLEIADRDG 824

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 106/234 (45%), Gaps = 23/234 (9%)

Query: 447  DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR--YYNPTTGTIMI 504
            DV     TR   +I  +++  + PG+   ++G SG GK+T+   L         TG + I
Sbjct: 901  DVQIKTETR---RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFI 957

Query: 505  DNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563
            D     K   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +  +
Sbjct: 958  DG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVED 1012

Query: 564  FIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDVESEGA 620
             I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  A
Sbjct: 1013 IIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWA 1072

Query: 621  INYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 669
            I     QLM+   ++   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1073 I----CQLMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1499

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 111/232 (47%), Gaps = 12/232 (5%)

Query: 441  GVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 498
            G+  +++V ++ P R S + +  +++   APG+   ++G SG GK+T +  L  R     
Sbjct: 851  GIFIWRNVCYTIPYRGSTRRLLDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGII 910

Query: 499  TGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 557
            TG ++++   I      S  R  G VQQ+ V +   T+R+++ +        + +    K
Sbjct: 911  TGDMLVNGNHID----ASFERRTGYVQQQDVHVKEMTVRESLQFA-ARMRRPQSVPEAEK 965

Query: 558  QCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALD 614
              +  + I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS LD
Sbjct: 966  MAYVEDIIEILDMEEYADALVGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLD 1025

Query: 615  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 665
             +S  AI     +L ++    + +I    +T+  + + +++L   G  V  G
Sbjct: 1026 SQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1077

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/249 (20%), Positives = 99/249 (39%), Gaps = 34/249 (13%)

Query: 440 RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYN 496
           RG+ E K+       R +  I ++ N    PG  + ++G  G G S+    +   +  + 
Sbjct: 160 RGIREAKN-------RKTRDIVRNANILARPGEMILVLGRPGAGCSSFLKTVSGEVDNFE 212

Query: 497 PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556
              G I  D     +M  K     I   + +      T++  + + L+ T  ++ + + +
Sbjct: 213 EVRGEISYDGISQKEMMAKFKTDVIYNGETDVHFPHLTVQQTLDFALSCTTPQKRLDNAS 272

Query: 557 KQCFCHNFITKFPNTYDTVIGPNGTL-----------LSGGQKQRIAIARALIKKPTVLI 605
           +      +IT     Y T+ G   T            +SGG+++R++IA AL  + ++  
Sbjct: 273 RS----EYITAMRELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALASRGSIYC 328

Query: 606 LDEATSALDVESEGAINYTFGQLMK-----SKSMTIVSIAHRLSTIRRSENVIVLGHDGS 660
            D AT  LD  +       F Q ++      KS+  V+I      I    + + +  DG 
Sbjct: 329 WDNATRGLDASTA----LEFAQAIRIMTNLQKSVAFVTIYQASENIYECFDKVTVLFDGR 384

Query: 661 VVEMGKFKE 669
            +  G  ++
Sbjct: 385 QIYYGHVED 393

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 100/229 (43%), Gaps = 32/229 (13%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y  +    +   +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYNEKN--LLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGY 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 559
           +            ++ R  IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 V-----------SQNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKTDEEYR------ 631

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                +  F  T    +     LLSGGQK R+A A   +  P +LILDE ++ LD     
Sbjct: 632 ---RHLGAFGITGSLSL-QKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGID 687

Query: 620 AI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 663
           A+      +T G LM S  ++++S  +  + I  SEN  V   DG++ +
Sbjct: 688 ALVDAMKKFTGGILMVSHDISVIS--NVCNEIWVSENGTVKRFDGTIYD 734

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 106/234 (45%), Gaps = 23/234 (9%)

Query: 447  DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR--YYNPTTGTIMI 504
            DV     TR   +I  +++  + PG+   ++G SG GK+T+   L         TG + I
Sbjct: 959  DVQIKKETR---RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFI 1015

Query: 505  DNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563
            D     K   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +  +
Sbjct: 1016 DG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVED 1070

Query: 564  FIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDVESEGA 620
             I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  A
Sbjct: 1071 IIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWA 1130

Query: 621  INYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 669
            I     QLM+   ++   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1131 I----CQLMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 125/262 (47%), Gaps = 22/262 (8%)

Query: 440 RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 496
           +  + F+++ ++  +    + I   ++  + PG  + ++G SG GK+T+   L +     
Sbjct: 363 KSTLTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAG 422

Query: 497 PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLM-SGTIRDNI-TYGLTYTPTKEEIRS 554
             +G+I I+  +ITK N   L +  G V QE  L+ + T+ + +    L   P K  +  
Sbjct: 423 KASGSIKINGSEITKQN---LSKIAGFVDQENFLLPTLTVYETVLNSALLRLPRK--LSF 477

Query: 555 VAKQCFCHNFITKFP--NTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATS 611
           V KQ   +  + +    +  D +IG +    +SGG+K+R++IA  L+  P+VL LDE TS
Sbjct: 478 VQKQKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVLFLDEPTS 537

Query: 612 ALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
            LD  +   +     +L    + T I+SI    S I +S + +VL   G +V        
Sbjct: 538 GLDSNNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMV-------- 589

Query: 671 YSNPTSALSQLLNERTAPVPSE 692
           +S   + +S+ L       PS+
Sbjct: 590 FSGVATDVSEFLRNNGYNCPSD 611

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 98/229 (42%), Gaps = 43/229 (18%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSFSY  + S  +   +N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 531 IIQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKGF 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 559
           +            ++ R  IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 V-----------SRNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRR----- 632

Query: 560 FCHNFITKFPNTYDTVIGPNGTL-------LSGGQKQRIAIARALIKKPTVLILDEATSA 612
                       +    G +G+L       LSGGQK R+A A   +  P +L+LDE ++ 
Sbjct: 633 ------------HLGAFGISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 613 LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
           LD     A+       +KS +  ++ ++H +S I    N I +   G V
Sbjct: 681 LDTAGLDAL----VDALKSFNGGVLMVSHDISVINSVCNEIWVSEGGKV 725

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 107/239 (44%), Gaps = 15/239 (6%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR--YYN 496
              +  ++D+ +    +   + I  +++  + PG+   ++G SG GK+T+   L       
Sbjct: 866  EAIFHWRDLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMG 925

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSV 555
              TG I +D         +S  R IG  QQ+ + L + T+R+++ +   Y    +E+   
Sbjct: 926  VITGDIFVDGLPRN----ESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKEVSVE 980

Query: 556  AKQCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSA 612
             K  +    I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS 
Sbjct: 981  EKNAYVEEIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSG 1040

Query: 613  LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 669
            LD ++  AI     +L K     + +I H+ S I   E   ++ +   G  V  G+  E
Sbjct: 1041 LDSQTAWAICQLMKKLCKHGQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa]
           {ON} Anc_8.661 YPL147W
          Length = 872

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 88/193 (45%), Gaps = 21/193 (10%)

Query: 463 SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIG 522
           SL F   PG+S+ I+GP+  GKS+I  ++   +       ++       + C        
Sbjct: 632 SLPFFEGPGASLLILGPNSCGKSSIQRIIAEIWPVYNKNGLLSIPSEGNLFC-------- 683

Query: 523 IVQQEPVLM-SGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTYDT 574
            V Q+P     GT+RD I Y ++           K  ++ + +    +    K   TY  
Sbjct: 684 -VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGFKDKHLVQILGEVRLEYLLKRKKGWTYLD 742

Query: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 634
            +     +LSGG+KQR+  AR +  KP  ++LDE T+A+  + E   +Y F  L+K    
Sbjct: 743 AVADWKDVLSGGEKQRMNFARIMFHKPRFVVLDEGTNAISADME---DYLF-NLLKRYRF 798

Query: 635 TIVSIAHRLSTIR 647
             +SI+ R S I+
Sbjct: 799 NFISISQRPSLIK 811

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 125/271 (46%), Gaps = 30/271 (11%)

Query: 440  RGVIEFKDVSFSYPTRPSVQIF-KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP- 497
            +GV  ++DV +  P + + +I   ++   +APG+   ++G SG GK+T+   L +  N  
Sbjct: 866  KGVFIWQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVG 925

Query: 498  -TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKE 550
              TG + I+ + +      S  R  G VQQ+ + +   T+R+++ +          P  E
Sbjct: 926  IVTGDMSINGKPVD----SSFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAE 981

Query: 551  EI---RSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-L 606
            ++    +V K       +       D ++G  G  L+  Q+++++I   L+ KP +L+ L
Sbjct: 982  KVADAETVMK-------LLDMEEYGDALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFL 1034

Query: 607  DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 665
            DE TS LD +S  AI     ++ K+    + +I    +T+  + + +++L   G  V  G
Sbjct: 1035 DEPTSGLDSQSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1094

Query: 666  KFKELYSNPTSALSQLLNERTAPVPSEQQQQ 696
               E   N +  L     ER      EQ++ 
Sbjct: 1095 DIGE---NSSIVLDYF--ERNGARHCEQREN 1120

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 103/237 (43%), Gaps = 40/237 (16%)

Query: 459 QIFKSLNFKIAPGSSVCIVGPSGRGKS----TIALLLLRYYNPTTGTIMIDN--QDITKM 512
           +I +++N    PG  + ++G  G G S    T A +  ++     G I+ D   Q++   
Sbjct: 178 KILQNINVLAKPGEMILVLGRPGSGCSSFLKTAAGVTDQFAGGVDGEILYDGIPQNVMMK 237

Query: 513 NCKS-------LRRHIGIVQQEPVLMSGTIRDNITYGLTY-TPT--------KEEIRSVA 556
           N KS       L  H       P L   T++  + + +   TP         KE IR+  
Sbjct: 238 NYKSDVIYNPELDVHF------PFL---TVKQTLDFAIACKTPAVRVNNVSRKEHIRATR 288

Query: 557 KQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDV 615
                +  I    +TYDT +G +    +SGG+++R++IA AL  + TV   D AT  LD 
Sbjct: 289 D---LYATIFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEALAARGTVYSWDNATRGLDA 345

Query: 616 ESEGAINYTFG-QLMKS--KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 669
            +  A+ Y    ++M +  +S   V+I      I  + + + + H G  +  G  K+
Sbjct: 346 ST--ALEYAQAIRIMTNLLRSTAFVTIYQASENIYETFDKVTVLHSGRQIYYGSTKD 400

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 107/237 (45%), Gaps = 15/237 (6%)

Query: 442  VIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY--NPT 498
            +  ++DV +    +   + I  +++  + PG+   ++G SG GK+T+  +L         
Sbjct: 841  IFHWRDVCYDIQIKNETRRILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVV 900

Query: 499  TGTIMIDNQDITKMNCKSLRRHIGIVQQEPVL-MSGTIRDNITYGLTYTPTKEEIRSVAK 557
            TG I +D      +   S +R  G  QQ+ +   + T+RD + +   Y    + I    K
Sbjct: 901  TGNIFVDGH----LRDTSFQRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQSISRAEK 955

Query: 558  QCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALD 614
              +  + I         D V+G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD
Sbjct: 956  NAYVEDIIKLLGMEAYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLD 1015

Query: 615  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 669
             ++  +I     +L+      + +I H+ S I   E   +++L + G  V  G   E
Sbjct: 1016 SQTAWSICQLIKKLVNHGQAILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPLGE 1071

>KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1022

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 103/212 (48%), Gaps = 25/212 (11%)

Query: 468 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPT---TGTIMIDNQDITKMNCKSLRRHIGIV 524
           + PG  + I+G SG GK+T+ L +L   N T   TG+I ++  DI K       + IG V
Sbjct: 397 VKPGEMLAIMGGSGAGKTTL-LDILAMKNKTGKVTGSIKVNGVDIDK---DKYSKIIGFV 452

Query: 525 QQEPVLM-SGTIRDNITYG--------LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 575
            QE  L+ + T+ + +           L+++  +  +  V ++        +  +  D V
Sbjct: 453 DQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVLEE-------LRIFDIRDRV 505

Query: 576 IGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 634
           IG      +SGG+K+R++IA  L+  P VL LDE TS LD  +   +     +L    + 
Sbjct: 506 IGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANHYNK 565

Query: 635 TIV-SIAHRLSTIRRSENVIVLGHDGSVVEMG 665
           T+V SI    S+I +  + +VL  +G +V  G
Sbjct: 566 TLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSG 597

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 98/227 (43%), Gaps = 32/227 (14%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y  +    + K +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 530 IIQLQDVSFGYDEKN--LLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGY 587

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 559
           +             + R  IG   Q  V      +  + +     P  T EE R      
Sbjct: 588 V-----------SSNGRLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYR------ 630

Query: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619
                +  F  T  T+      LLSGGQK R+A A   +  P +L+LDE ++ LD     
Sbjct: 631 ---RHLGSFGIT-GTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLD 686

Query: 620 AI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
           A+     N++ G LM S  ++++    +   I  SEN  V   DG++
Sbjct: 687 ALVESLKNFSGGVLMVSHDISVIDSVCK--EIWVSENGTVRRFDGTI 731

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSHD 422

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 423 RAFLNEVATDIIYQHN 438

>Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ABR125C
          Length = 1474

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 115/241 (47%), Gaps = 18/241 (7%)

Query: 439  DRGVIEFKDVSFSYPTRPSV-QIFKSLNFKIAPGSSVCIVGPSGRGKSTI-ALLLLRYYN 496
            +  V  +K+VS++ P + +  ++   ++    PG+   ++G SG GK+T+   L  R   
Sbjct: 835  NEDVFLWKNVSYTIPYKGTKRKLLDEVSGYCIPGTLTALMGESGAGKTTLLNTLAQRNVG 894

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKE 550
              TG ++++   +      S  R  G VQQ+ V +   T+R+++ +          P  E
Sbjct: 895  IITGDMLVNGLPVDI----SFERRTGYVQQQDVHIKEMTVRESLQFSARLRRPESVPDAE 950

Query: 551  EIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEA 609
            ++  V K       +    +  D V+G  G  L+ GQ+++++I   L+ KP++L+ LDE 
Sbjct: 951  KLDYVEKIIE----VLGMTDYADAVVGDVGYGLNVGQRKKLSIGVELVAKPSLLLFLDEP 1006

Query: 610  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFK 668
            TS LD +S  AI     +L K+    + +I    +T+  + + +++L   G  V      
Sbjct: 1007 TSGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFNDIG 1066

Query: 669  E 669
            E
Sbjct: 1067 E 1067

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 102/224 (45%), Gaps = 23/224 (10%)

Query: 459 QIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL---RYYNPTTGTIMIDN--QDITKMN 513
            I + ++F   PG  V ++G  G G S++   +      +   +G+I  D   QD    N
Sbjct: 157 NILEKVDFIARPGEMVLVLGRPGAGCSSLLKTVAGDTDQFKSVSGSISYDGIPQDEMMSN 216

Query: 514 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY-TP-------TKEEIRSVAKQCFCHNFI 565
            K+   + G  +++      T+R  + + +   TP       T+ +  S+ ++ +   F 
Sbjct: 217 FKAEVIYNG--EEDVHFPHLTLRQTLDFAIACKTPHVRVNSLTRADYISMMRELYATIFG 274

Query: 566 TKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYT 624
            K  + YDT +G      +SGG+++R++IA AL    +V   D AT  LD  +  A+ Y 
Sbjct: 275 LK--HAYDTPVGNEFVRGVSGGERKRVSIAEALAANGSVYCWDNATRGLDAST--ALEYA 330

Query: 625 FG-QLMKS--KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 665
              ++M +  KS ++V+I      I    + + + +DG  +  G
Sbjct: 331 QAIRIMTNILKSTSLVTIYQASEKIYEVFDKVTVLYDGKQIYFG 374

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 113/250 (45%), Gaps = 21/250 (8%)

Query: 429  SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTI 487
            S T G +    + V  ++++ +  P +   + +  +++  + PG+   ++G SG GK+T+
Sbjct: 837  SSTNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

Query: 488  ALLLLR--YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLT 544
               L         TG +++D     +   +S  R IG  QQ+ + L + T+R+++ +   
Sbjct: 897  LDCLAERVTMGVITGDVLVDG----RPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-A 951

Query: 545  YTPTKEEIRSVAKQCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPT 602
            Y     E+    K  +    I   +     D V+G  G  L+  Q++R+ I   L  KP 
Sbjct: 952  YLRQPAEVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPK 1011

Query: 603  VLI-LDEATSALDVESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLG 656
            +L+ LDE TS LD ++  +I     QLM+   S    I+   H+ S I   E   ++ L 
Sbjct: 1012 LLVFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQ 1067

Query: 657  HDGSVVEMGK 666
              G     G+
Sbjct: 1068 DGGQTTYFGE 1077

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 74/175 (42%), Gaps = 23/175 (13%)

Query: 457 SVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC-- 514
           S QI K +   + PG  + ++G  G G +T    LL+  +  T    +D   +   N   
Sbjct: 157 SFQILKPMEGYLDPGELLVVLGRPGSGCTT----LLKTISSNTHGFRVDKDSVISYNGLT 212

Query: 515 -KSLRRH-----IGIVQQEPVLMSGTIRDNI-TYGLTYTPTKEEIRSVAKQCFCHNFITK 567
            + +R+H     +   + +  L   T+ + + T     TPT   I+ V +  +  +    
Sbjct: 213 PREMRKHFRGEVVYNAESDVHLPHLTVFETLYTVARLKTPTN-RIKGVDRDTYARHITDV 271

Query: 568 FPNTY------DTVIGPNGTL--LSGGQKQRIAIARALIKKPTVLILDEATSALD 614
              TY      +T +G N  +  +SGG+++R++IA   I        D AT  LD
Sbjct: 272 AIATYGLSHTKNTKVG-NALVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLD 325

>Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {ON}
           YOL075C (REAL)
          Length = 1295

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 106/234 (45%), Gaps = 35/234 (14%)

Query: 459 QIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL--------LRYYNPTTGTIMIDNQDIT 510
           QI +S+N    PG    I+GPSG GKS++  L+           +N T G+IM+++  ++
Sbjct: 709 QILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSFFAKFN-TAGSIMLNDIQVS 767

Query: 511 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG-------LTYTPTKEE----IRSVAKQC 559
           +   K++  ++     + +L + T+++ + Y        LT     E     IRS+  + 
Sbjct: 768 EFMFKNVCSYVS-QDDDHLLATLTVKETLKYASALRLHHLTEAERMERTDNLIRSLGLK- 825

Query: 560 FCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 618
            C N           +IG      +SGG+K+R+ +   L+  P +L+LDE TS LD  + 
Sbjct: 826 HCEN----------NIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTS 875

Query: 619 GAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             I     +L   +  T++   H  R    +R  NV++L   G     G   E+
Sbjct: 876 ATILEILEKLCTEQGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDEM 929

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 573 DTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS 631
           DT++G N    LSGG+K+R++I   +I  P+V+ LDE T+ LD  S   +  T  +L K 
Sbjct: 175 DTLVGDNSHRGLSGGEKRRLSIGTQMISNPSVMFLDEPTTGLDAYSAYLVIKTLKKLAKE 234

Query: 632 KSMTIVSIAHR 642
              T +   H+
Sbjct: 235 DGRTFIMSIHQ 245

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 27/209 (12%)

Query: 463 SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIG 522
           S+ F  + GSS+ I+GP+G GKS+I  ++   +       ++       + C        
Sbjct: 636 SIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPTEANLLC-------- 687

Query: 523 IVQQEPVLM-SGTIRDNITY----------GLTYTPTKEEIRSVAKQCFCHNFITKFPNT 571
            V Q+P     GT+RD I Y          GL      + +R V           K  + 
Sbjct: 688 -VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKLDYLLKR--DKGWSY 744

Query: 572 YDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS 631
            DTV      +LSGG+KQR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K 
Sbjct: 745 LDTV-SDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VLKR 799

Query: 632 KSMTIVSIAHRLSTIRRSENVIVLGHDGS 660
                ++I+ R S I+  + ++ +  D S
Sbjct: 800 YRFNFITISQRPSLIKYHDLLLEISDDNS 828

>YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}
           PDR18Putative transporter of the ATP-binding cassette
           (ABC) family, implicated in pleiotropic drug resistance;
           the authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 1333

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 116/236 (49%), Gaps = 18/236 (7%)

Query: 441 GVIEFKDVSFSYP-TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 498
           GV  +K+VSF+ P +    ++  S++    PG+   ++G SG GK+T +  L  R     
Sbjct: 727 GVFIWKNVSFTIPHSSGQRKLLDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTI 786

Query: 499 TGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTKEEI 552
           TG +++D   +      S +R  G VQQ+ + ++  T+++++ +          P  E++
Sbjct: 787 TGDMLVDGLPMD----ASFKRRTGYVQQQDLHVAELTVKESLQFSARMRRPQSIPDAEKM 842

Query: 553 RSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATS 611
             V K       I +     + ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS
Sbjct: 843 EYVEKII----SILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTS 898

Query: 612 ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGK 666
            LD +S  A+     +L  +    + +I    +T+  + + +++LG  G  +  G+
Sbjct: 899 GLDSQSAWAVVKMLKRLALAGQSILCTIHQPSATLFEQFDRLLLLGKGGQTIYFGE 954

>TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {ON} 
          Length = 1500

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 111/233 (47%), Gaps = 12/233 (5%)

Query: 440  RGVIEFKDVSFSYPTRPS-VQIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 497
            RGV  ++ V ++ P +    ++  +++    PG+   ++G SG GK+T +  L  R    
Sbjct: 840  RGVFMWQKVCYTIPYKGGPRRLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGV 899

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVA 556
             TG ++++ + I      S  R  G VQQ+ + +   T+R+++ +       K+ +    
Sbjct: 900  ITGDMLVNGRPID----ASFERRTGYVQQQDLHIAEMTVRESLIFSAR-MRRKQSVPDAE 954

Query: 557  KQCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSAL 613
            K  F    I         + ++G  G  LS  Q+++++I   L+ KP +L+ LDE TS L
Sbjct: 955  KIEFAEKIIDILDMGEYAEALVGEPGAGLSVEQRKKLSIGVELVAKPDLLLFLDEPTSGL 1014

Query: 614  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 665
            D +S  AI     +L K+    + +I    +T+  + + +++L   G  V  G
Sbjct: 1015 DSQSAWAIVQLLRKLAKAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1067

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 114/258 (44%), Gaps = 35/258 (13%)

Query: 459 QIFKSLNFKIAPGSSVCIVGPSGRGKS----TIALLLLRYYNPTTGTIMID--NQDITKM 512
           +I + +N    PG  V ++G  G G S    T A +  ++    +G I  +  +QD    
Sbjct: 157 KILRGVNLLARPGEMVLVLGRPGAGCSSMLKTAAGVTDQFAGGVSGDISYNGISQDEIMK 216

Query: 513 NCKSLRRHIGIVQQE-PVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ---CFCHNF---I 565
           + +S   + G +    P L   T++  + + +      + + ++++Q    F  +F   I
Sbjct: 217 DFRSDVIYNGELDVHFPYL---TVKQTLDFAIACKTPAKRVNNMSEQEYIDFTRDFYATI 273

Query: 566 TKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYT 624
               +TYDT +G +    +SGG+++R++IA A++ + +V   D AT  LD  +  A+ Y 
Sbjct: 274 FGLTHTYDTKVGNDFVRGVSGGERKRVSIAEAVVARGSVYCWDNATRGLDAST--ALEYA 331

Query: 625 -----FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK--------FKELY 671
                   LM S ++  V+I      I  + + + + + G  +  G         +K  Y
Sbjct: 332 KAIRIMTNLMHSTAL--VTIYQASENIYETFDKVTVLYSGRQIYYGHTSKAKNFFWKMGY 389

Query: 672 SN-PTSALSQLLNERTAP 688
           S  P  A ++ L   T P
Sbjct: 390 SCPPRQATAEFLTALTDP 407

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 92/200 (46%), Gaps = 21/200 (10%)

Query: 469 APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEP 528
           + G+S+ I+GP+  GKS+I  ++   +       ++     + + C         V Q P
Sbjct: 629 STGASLLILGPNSCGKSSIQRIITEVWPVYNKNGLLSIPAPSNLFC---------VPQRP 679

Query: 529 VLM-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITK-FPNTYDTVIGPNG 580
                GT RD I Y ++           + +  + K+      + +    +Y   +    
Sbjct: 680 YFTRGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADWK 739

Query: 581 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 640
            +LSGG+KQR+  AR L  +P  ++LDEAT+A+ V+ E   +Y F  L+K      ++I+
Sbjct: 740 DVLSGGEKQRMNFARILFHRPRFVVLDEATNAISVDME---DYLF-NLLKRYRFNFITIS 795

Query: 641 HRLSTIRRSENVIVLGHDGS 660
            R S I+  + ++ +   GS
Sbjct: 796 QRPSLIKYHDMLLEVDSSGS 815

>YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter involved in multidrug resistance
            and resistance to singlet oxygen species
          Length = 1501

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 113/236 (47%), Gaps = 18/236 (7%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 497
            +GV  +KDV F+ P     + +  +++    PG+   ++G SG GK+T +  L  R    
Sbjct: 850  KGVFIWKDVCFTIPYEGGKRMLLDNVSGYCIPGTMTALMGESGAGKTTLLNTLAQRNVGI 909

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGL-----TYTPTKEE 551
             TG ++++ + I      S  R  G VQQ+ + ++  T+R+++ +        + P  E+
Sbjct: 910  ITGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQHLPDSEK 965

Query: 552  IRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEAT 610
            +  V K       +       + ++G  G  L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 966  MDYVEKII----RVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPT 1021

Query: 611  SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 665
            S LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1022 SGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLRKGGQTVYFG 1077

>CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] {ON}
            highly similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011w SNQ2 multidrug resistance protein
          Length = 1507

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 114/236 (48%), Gaps = 18/236 (7%)

Query: 440  RGVIEFKDVSFSYPTRPSV-QIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 497
            +G+  +++V ++ P    + Q+  +++    PG+   ++G SG GK+T +  L  R    
Sbjct: 854  KGIFIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVGI 913

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTKEE 551
             TG ++++ + I      S  R  G VQQ+ + +S  T+R+++ +          P +E+
Sbjct: 914  ITGDMLVNGKPID----ISFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPEEEK 969

Query: 552  IRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEAT 610
            +  V +       +       D ++G  G  L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 970  MEHVERII----KVLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPT 1025

Query: 611  SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 665
            S LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1026 SGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1081

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 471 GSSVCIVGPSGRGKSTI----ALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQ 526
           G  V ++G  G G S++    A  + ++     G IM D     +M  +     I   +Q
Sbjct: 188 GEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKRYKPDVIYNGEQ 247

Query: 527 EPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC------HNFITKFPNTYDTVIGPNG 580
           +      T++  + + +      + +  V+++ +       H  I    +TY T +G + 
Sbjct: 248 DVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDLHATIFGLRHTYHTKVGNDF 307

Query: 581 TL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVES 617
              +SGG+++R++IA AL+ K ++   D AT  LD  +
Sbjct: 308 VRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDAST 345

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_5.500
          Length = 1543

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 108/235 (45%), Gaps = 15/235 (6%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR--YYN 496
              +  ++D+ +  P +  V+ I  +++  + PG+   ++G SG GK+T+   L       
Sbjct: 875  EAIFHWRDLCYDVPIKKEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 934

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSV 555
              TG I +D     ++  +S  R IG  QQ+ + L + T+R+++ +   Y      +   
Sbjct: 935  TITGNIYVDG----RLRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAAVSIE 989

Query: 556  AKQCFCHNF--ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSA 612
             K  +      I +     D V+G  G  L+  Q++R+ I   L  KP +L+ LDE TS 
Sbjct: 990  EKNKYVEEVIRILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSG 1049

Query: 613  LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMG 665
            LD ++  A      +L ++    + +I H+ S I  +  + ++ L   G  V  G
Sbjct: 1050 LDSQTAWATCQLMRKLAENGQAILCTI-HQPSAILMQDFDRLLFLQKGGQTVYFG 1103

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 106/234 (45%), Gaps = 23/234 (9%)

Query: 447  DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR--YYNPTTGTIMI 504
            DV     TR   +I  +++  + PG+   ++G SG GK+T+   L         TG +++
Sbjct: 861  DVQIKDETR---RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDVLV 917

Query: 505  DNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563
            D     +   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +   
Sbjct: 918  DG----RPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAEVSVEEKDAYVEE 972

Query: 564  FIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDVESEGA 620
             I   +     D V+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  +
Sbjct: 973  VIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS 1032

Query: 621  INYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 669
            I     QLM+   S    I+   H+ S I   E   ++ L   G  V  G+  E
Sbjct: 1033 I----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFGELGE 1082

>KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON} 
          Length = 1517

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 114/240 (47%), Gaps = 18/240 (7%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 497
            +GV  +KDV ++ P     + +   ++    PG+   ++G SG GK+T +  L  R    
Sbjct: 861  KGVFIWKDVCYTIPYDGGQRMLLDHVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVGI 920

Query: 498  TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTKEE 551
             TG ++++   I      S  R  G VQQ+ + +S  T+R+++ +            KE+
Sbjct: 921  ITGDMLVNGHPID----TSFERRTGYVQQQDIHISELTVRESLQFSARMRRPQSVTDKEK 976

Query: 552  IRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEAT 610
            +  V K    H  +    +  + ++G  G+ L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 977  MTYVEK--IIH--VLDMEDYAEALVGTVGSGLNVEQRKKLSIGVELVAKPDLLLFLDEPT 1032

Query: 611  SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKE 669
            S LD +S  AI     +L  S    + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1033 SGLDSQSSWAIVQLLKKLAHSGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGNIGE 1092

>TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.366
           YFR009W
          Length = 752

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 97/234 (41%), Gaps = 46/234 (19%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DV F Y  +    +   +N  I   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVDFGYDNKE--LLLNDVNLDIQMDSRIALVGANGCGKTTLLKVMMEQLRPVKGY 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 559
           +            ++ R  IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 V-----------SRNGRLRIGYFTQHHVDSMDLDKSAVDWMSTAFPGKTDEEYRR----- 632

Query: 560 FCHNFITKFPNTYDTVIGPNGTL-------LSGGQKQRIAIARALIKKPTVLILDEATSA 612
                       +    G  G+L       LSGGQK R+A A   ++ P +L+LDE ++ 
Sbjct: 633 ------------HLGAFGITGSLSLQKIQLLSGGQKSRVAFAALCLENPHILVLDEPSNH 680

Query: 613 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
           LD     A+     N+T G LM S  ++++    +   I  SE   V   DG++
Sbjct: 681 LDTAGIDALVDALKNFTGGVLMVSHDISVIDSVCK--EIWVSEKGTVKRFDGNI 732

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTVLTVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON} 
          Length = 1531

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 109/236 (46%), Gaps = 17/236 (7%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 498
              +  ++++ +  P +  ++ I  +++  + PG+   ++G SG GK+T+   L +    T
Sbjct: 864  EAIFHWRNLCYEIPIKKEIRHILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQ--RVT 921

Query: 499  TGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 557
             GTI  D      +  +S  R IG  QQ+ + L + T+R+++ +   Y     ++    K
Sbjct: 922  VGTITGDVFVNGCLRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPFDVPVEEK 980

Query: 558  QCFCHNFITKFP-NTY-DTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALD 614
              +    I      TY D V+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD
Sbjct: 981  NKYVEEIIKTLEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1040

Query: 615  VESEGAINYTFGQLMK---SKSMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMG 665
             ++  A      QLMK        I+   H+ S I  +  + ++ L   G  V  G
Sbjct: 1041 SQTAWAT----CQLMKKLAQNGQAILCTIHQPSAILMQNFDRLLFLQKGGETVYFG 1092

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 117/271 (43%), Gaps = 34/271 (12%)

Query: 445 FKDVSFSY----PTRP--SVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 498
           +K +++ Y    PTR   + QI KS++  + PG  + ++G  G G +T    LL+  +  
Sbjct: 149 WKIITYVYRKVTPTREIDTFQILKSMDGILNPGELLVVLGRPGSGCTT----LLKSISSN 204

Query: 499 TGTIMIDNQDITKMNC---KSLRRH-----IGIVQQEPVLMSGTIRDN-ITYGLTYTPTK 549
           T    I    I   N    K +RRH     +   + +  L   T+    +T     TP+ 
Sbjct: 205 THGFDISKDSIISYNGLTPKDIRRHYRGEVVYNAESDIHLPHLTVYQTLLTVARLKTPSN 264

Query: 550 EEIRSVAKQCFCHNFITKFPNTY------DTVIGPNGTL-LSGGQKQRIAIARALIKKPT 602
             I+ V ++ + ++       TY      DT +G +    +SGG+++R++IA   I    
Sbjct: 265 -RIKDVTREDYANHLTQVTMATYGLLHTRDTKVGDDLVKGVSGGERKRVSIAEVSICGSK 323

Query: 603 VLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 662
           V   D AT  LD     A    F + +K+++ TI++    ++  + S++   L     V+
Sbjct: 324 VQCWDNATRGLD----SATALEFIRALKTQA-TILNTTATVAIYQCSQDTYDLFDKVCVL 378

Query: 663 EMGKFKELYSNPTSALSQLLNERTAPVPSEQ 693
           + G   +LY  P+    +   +     P  Q
Sbjct: 379 DDG--YQLYYGPSDRAKKYFQDMGYVCPPRQ 407

>NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3.133
           YOL075C
          Length = 1273

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 103/238 (43%), Gaps = 15/238 (6%)

Query: 445 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-------LRYYNP 497
           F D+        S QI +S+N    PG    I+GPSG GKST+  L+             
Sbjct: 674 FSDIKTGLYHHQSKQILQSINATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFA 733

Query: 498 TTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG--LTYTPTKEEIRSV 555
           TTG+IM ++  I++   K++  ++     + +L   T+R+   +   L      EE R +
Sbjct: 734 TTGSIMFNDVQISEEMFKNVCSYVS-QDDDHLLAKLTVRETFKFAADLRLHNLTEEQRVI 792

Query: 556 AKQCFCHNFITKFPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALD 614
                      K  +  + +IG      +SGG+K+R+ +   L+  P +++LDE TS LD
Sbjct: 793 KSDELIRALGLK--HCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLD 850

Query: 615 VESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVEMGKFKEL 670
             +   I     +L      TI+   H  R    ++  NV++L   G     G   E+
Sbjct: 851 SFTSATILEILKKLSVEYGKTIIITIHQPRSELFKQFGNVLLLAKSGRTAFNGSPNEM 908

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 93/195 (47%), Gaps = 15/195 (7%)

Query: 460 IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN---PTTGTIMIDNQDITKMNC-- 514
           +  S +  +  GS + ++G SG GK+T+  +L    +    T G I    ++  + +   
Sbjct: 36  LVNSFSLDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLKTDGDIHYILEEKPQRDSEQ 95

Query: 515 -KSLRRHIGIV---QQEPVLMSGTIRDNITYG--LTYTPTKEEIRSVAKQCFCHNFITKF 568
            + ++ H+ +    QQ+ +    T R+ + Y   L    +KEE + V  Q   H    K 
Sbjct: 96  EQEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQ-LIHELGLK- 153

Query: 569 PNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQ 627
            +  +T++G N    LSGG+K+R+++   +I  P+++ LDE T+ LD  S   +  T  +
Sbjct: 154 -DCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKK 212

Query: 628 LMKSKSMTIVSIAHR 642
           L K    T +   H+
Sbjct: 213 LAKEDGRTFIMSIHQ 227

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 109/242 (45%), Gaps = 21/242 (8%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR--YYN 496
              +  ++D+ +  P +   + I  ++N  + PG+   ++G SG GK+T+   L       
Sbjct: 797  EAIFHWRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 856

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSV 555
              TG I +D     ++  +S  R IG  QQ+ + L + T+R+++ +   Y      +   
Sbjct: 857  VITGGIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPSSVSVE 911

Query: 556  AKQCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSA 612
             K  +    I   +     D V+G  G  L+  Q++R+ I   L  +P +L+ LDE TS 
Sbjct: 912  EKNKYVEEVIKILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSG 971

Query: 613  LDVESEGAINYTFGQLMK---SKSMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMGKF 667
            LD ++     +   QLM+   +    I+   H+ S I  ++ + ++ L   G  V  G  
Sbjct: 972  LDSQTA----WDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGDL 1027

Query: 668  KE 669
             E
Sbjct: 1028 GE 1029

>Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 109/242 (45%), Gaps = 21/242 (8%)

Query: 440  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR--YYN 496
              +  ++D+ +  P +   + I  ++N  + PG+   ++G SG GK+T+   L       
Sbjct: 797  EAIFHWRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 856

Query: 497  PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSV 555
              TG I +D     ++  +S  R IG  QQ+ + L + T+R+++ +   Y      +   
Sbjct: 857  VITGGIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPSSVSVE 911

Query: 556  AKQCFCHNFIT--KFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSA 612
             K  +    I   +     D V+G  G  L+  Q++R+ I   L  +P +L+ LDE TS 
Sbjct: 912  EKNKYVEEVIKILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSG 971

Query: 613  LDVESEGAINYTFGQLMK---SKSMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMGKF 667
            LD ++     +   QLM+   +    I+   H+ S I  ++ + ++ L   G  V  G  
Sbjct: 972  LDSQTA----WDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGDL 1027

Query: 668  KE 669
             E
Sbjct: 1028 GE 1029

>CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}
          Length = 1542

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 111/253 (43%), Gaps = 31/253 (12%)

Query: 429  SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTI 487
            SP VG        +  ++++ +  P +  V+ I  +++  + PG+   ++G SG GK+T+
Sbjct: 873  SPQVG--LSKSEAIFHWQNLCYDVPIKTEVRRILNNVDGWVKPGTLTALMGASGAGKTTL 930

Query: 488  ALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITY----- 541
               L      T G I  D     +    S  R IG  QQ+ + L + T+R+++ +     
Sbjct: 931  LDCLAE--RTTMGVITGDVMVNGRPRDTSFSRSIGYCQQQDLHLKTATVRESLRFSAYLR 988

Query: 542  ---GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALI 598
                ++     E + +V K       I +     D V+G  G  L+  Q++R+ I   L 
Sbjct: 989  QPSSVSIEEKNEYVEAVIK-------ILEMETYADAVVGVPGEGLNVEQRKRLTIGVELA 1041

Query: 599  KKPTVLI-LDEATSALDVESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NV 652
             KP +L+ LDE TS LD ++  A      QLMK   +    I+   H+ S +   E   +
Sbjct: 1042 AKPKLLVFLDEPTSGLDSQTAWAT----CQLMKKLANHGQAILCTIHQPSAMLMQEFDRL 1097

Query: 653  IVLGHDGSVVEMG 665
            + L   G  V  G
Sbjct: 1098 LFLQKGGQTVYFG 1110

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 25/181 (13%)

Query: 453 PTRPS--VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 510
           P R S   +I K ++  + PG  + ++G  G G +T    LL+  + TT    I    + 
Sbjct: 165 PARESDTFRILKPMDGLLKPGELLVVLGRPGSGCTT----LLKSISSTTHGFQISKDSVI 220

Query: 511 KMNC---KSLRRH-----IGIVQQEPVLMSGTIRDN-ITYGLTYTPTKEEIRSVAKQCFC 561
             N      +++H     +   + +  L   T+    +T     TP +  ++ V ++ F 
Sbjct: 221 SYNGLTPNEIKKHYRGEVVYNAEADIHLPHLTVYQTLVTVARLKTP-QNRVKGVTREDFA 279

Query: 562 HNFITK-------FPNTYDTVIGPNGTL-LSGGQKQRIAIARALIKKPTVLILDEATSAL 613
            N +T          +T DT +G +    +SGG+++R++IA   I        D AT  L
Sbjct: 280 -NHVTDVAMATYGLSHTRDTKVGNDLVRGVSGGERKRVSIAEVWICGSKFQCWDNATRGL 338

Query: 614 D 614
           D
Sbjct: 339 D 339

>Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009W
           (GCN20) - 1:1 [contig 265] FULL
          Length = 752

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 96/241 (39%), Gaps = 48/241 (19%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF +   P   + K +N  +   S + +VG +G GK+T+  +L+    P  G 
Sbjct: 531 IIQLQDVSFGFD--PKQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKILMEQLRPIQG- 587

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
                                 V + P L        + Y   +     ++ + A     
Sbjct: 588 ---------------------YVSRNPRL-------RVAYFTQHHVDSMDLNTSAVDWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
             F  K    Y   +G  G           LLSGGQK R+A A   +  P +L+LDE ++
Sbjct: 620 TTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 666
            LD     A+      +T G LM S  ++++      + I  SEN  V   +G++ +   
Sbjct: 680 HLDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVKRFEGTIFDYKN 737

Query: 667 F 667
           +
Sbjct: 738 Y 738

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+V ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366
          Length = 753

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 99/234 (42%), Gaps = 46/234 (19%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y     +    +L+ ++   S + +VG +G GK+T+  +++    PT G 
Sbjct: 532 IIQLQDVSFGYDENNLLLNDVNLDVQM--DSRIALVGANGCGKTTLLKVMMEELRPTKGF 589

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 559
           +            ++ R  IG   Q  V         + +     P  T EE R      
Sbjct: 590 V-----------SRNGRLRIGYFTQHHVDSMDLTTSAVDWMSKAYPGKTDEEYR------ 632

Query: 560 FCHNFITKFPNTYDTVIGPNGTL-------LSGGQKQRIAIARALIKKPTVLILDE---- 608
             H+  +          G  GTL       LSGGQK R+A A   +  P +L+LDE    
Sbjct: 633 --HHLGS---------FGITGTLGLQKMELLSGGQKSRVAFAALCLNNPHILVLDEPSNH 681

Query: 609 -ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661
             T+ LD   E   N++ G LM S  ++I  I H  + I  SEN  V   DG +
Sbjct: 682 LDTTGLDALVESLKNFSGGVLMVSHDISI--IDHVCNEIWVSENGTVKRFDGDI 733

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSHD 424

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 425 RAFLNEVATDIIYQHN 440

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 98/233 (42%), Gaps = 52/233 (22%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           +I+ +DVSF Y  +    + K +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYDEKN--LLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGF 588

Query: 502 IMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 561
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMS 619

Query: 562 HNFITKFPNTYDTVIGPNG----------TLLSGGQKQRIAIARALIKKPTVLILDEATS 611
            +F  K    Y   +G  G           LLSGGQK R+A A   +  P +L+LDE ++
Sbjct: 620 KSFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 612 ALDVESEGAI-----NYTFGQLMKSKSMTIV-SIAHRL-----STIRRSENVI 653
            LD     A+     N+  G LM S  ++++ S+   +      T++R E  I
Sbjct: 680 HLDTTGLDALVDALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSHD 423

Query: 643 LSTIRRSENVIVLGHD 658
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 104/243 (42%), Gaps = 56/243 (23%)

Query: 442 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 501
           V+ F +++FSY   P   +++ LNF +   S + +VGP+G GKST+  ++     P  G 
Sbjct: 392 VLAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGR 451

Query: 502 I--------------MIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 547
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLG---RYGLTGEG 508

Query: 548 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILD 607
              ++                           GT LS GQ+ R+  A   +++P VL+LD
Sbjct: 509 QTVQM---------------------------GT-LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 608 EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENVIVLGH------DGS 660
           E T+ LD+ +  ++     +     +  +V ++H    + + ++++ V+ H      DGS
Sbjct: 541 EPTNGLDIPTIDSLADAISEF----NGGVVVVSHDFRLLDKIAKDIFVVEHKTATRWDGS 596

Query: 661 VVE 663
           +++
Sbjct: 597 ILQ 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 641
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,265,423
Number of extensions: 2624233
Number of successful extensions: 10646
Number of sequences better than 10.0: 526
Number of HSP's gapped: 10191
Number of HSP's successfully gapped: 936
Length of query: 767
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 650
Effective length of database: 40,065,477
Effective search space: 26042560050
Effective search space used: 26042560050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)