Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.346.6ON62623098e-39
Skud_16.66.6ON62622829e-35
YPL271W (ATP15)6.6ON62622751e-33
Smik_6.4796.6ON62622691e-32
NDAI0I027406.6ON66592161e-24
Sklu_YGOB_Anc_6.66.6ON61621934e-21
Kpol_1045.826.6ON62601935e-21
TPHA0J002306.6ON62611926e-21
TDEL0G046506.6ON62601901e-20
ZYRO0F00418g6.6ON62601901e-20
CAGL0A01111g6.6ON69591865e-20
Kwal_56.223336.6ON62561865e-20
KNAG0E027906.6ON65611849e-20
NCAS0D022006.6ON85571823e-19
Kthe_YGOB_Anc_6.66.6ON62561804e-19
Klac_YGOB_Anc_6.66.6ON61621771e-18
TBLA0A072006.6ON65571771e-18
KAFR0B064906.6ON66611753e-18
Ecym_30086.6ON61621319e-12
ACR021W6.6ON62621181e-09
AGL099C8.416ON74731583.4
Ecym_41538.416ON81631573.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.34
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)   123   8e-39
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)      113   9e-35
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...   110   1e-33
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...   108   1e-32
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    88   1e-24
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    79   4e-21
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    79   5e-21
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    79   6e-21
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    78   1e-20
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    78   1e-20
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    76   5e-20
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    76   5e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    75   9e-20
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    75   3e-19
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    74   4e-19
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    73   1e-18
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    73   1e-18
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    72   3e-18
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    55   9e-12
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    50   1e-09
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    27   3.4  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    27   3.6  

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score =  123 bits (309), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score =  113 bits (282), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 55/62 (88%), Positives = 59/62 (95%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG+SYAAYLNVAAQTIRSSLKTELQTA+VLSRS+TDA+YTKYKNG AASEP  I
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score =  110 bits (275), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG+SYAAYLNVAAQ IRSSLKTELQTA+VL+RS+TDA+YT+YKNGTAASEP  I
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score =  108 bits (269), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 52/62 (83%), Positives = 58/62 (93%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG+SYAAYLNVAA+ IRSSLKTELQTA+VLSRS+TDA+YT+YKNG AASEP  I
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 87.8 bits (216), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 52/59 (88%)

Query: 4  WRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSITK 62
          WRKAG++Y+AYL++AA+T+R++LK ELQTA V++RS TDAY+TKYK+G  ASEP S+ K
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 79.0 bits (193), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG++Y  YL++AA+T+R++LKTE QTA VLSRS+++A + K++NGT  S+P+ +
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGT-PSDPIPL 59

Query: 61 TK 62
           K
Sbjct: 60 KK 61

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 79.0 bits (193), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG++Y  Y+N+AAQT+R +LK EL+T  VL+RS+T+A +  ++NG    EPV I
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 78.6 bits (192), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MS WRKAG++Y+ YL VAA+T+R SLK +L+T +VLSRS+TD  YT ++ GTA SEP SI
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 T 61
          +
Sbjct: 61 S 61

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 77.8 bits (190), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          M+AWRKAG++Y  YL+VAA+T+R++LK ELQ A VL+RS+TDA Y KY+ G+AAS+ V +
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 77.8 bits (190), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG++Y AYL+VAA+T+RS+LK E QTA VLSR R D+ YTK++ G    EP  +
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 76.3 bits (186), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (79%)

Query: 2  SAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          +AWRKAG+SY+++L +AA+T+R SLK ELQT  V+ R +TDA YTKY+ G+  S+P+ +
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 76.3 bits (186), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 46/56 (82%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASE 56
          MSAWRKAG++Y  Y+ +AAQT+RS+LK E QTA VL RS+T+A + KY+NGTA +E
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAE 56

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 75.5 bits (184), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 1  MSA-WRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVS 59
          MSA W+KAG++YA YLNV A+T+RS+LK ELQT NVLSR  TDA YT Y+ GT  ++P  
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 I 60
          +
Sbjct: 61 L 61

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 74.7 bits (182), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 46/57 (80%)

Query: 4  WRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
           RKAGV+YA YL VA++T+R+SLKTELQT  V++RS TDAYYTKY+ G+  ++P  +
Sbjct: 24 LRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPL 80

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 73.9 bits (180), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 45/56 (80%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASE 56
          MSAWRKAG++Y  Y+ +AAQT+RS+LK +LQTA VL RS+T+A + KY+ GT  +E
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAE 56

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 72.8 bits (177), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 50/62 (80%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MS WRKAG+++  Y++VAA T+R++LK ELQT +VL+RS+++A + K++NG  ASEPV +
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPL 59

Query: 61 TK 62
           K
Sbjct: 60 KK 61

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 72.8 bits (177), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (80%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEP 57
          MSAWRKAG++Y AY+ +AA+T+R++LK ELQTA V+ RS T+A +TKY  G+  ++P
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADP 57

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 72.0 bits (175), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 47/61 (77%)

Query: 2  SAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSIT 61
          S WRKAG++YA+YL++A++T+R  LKTE QTA V SRS T+A+ T YKNG+  S+P  + 
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 62 K 62
          K
Sbjct: 63 K 63

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 55.1 bits (131), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG+SY  Y+ VAA+ +RS+LK EL+ A VLSRS T+A    YK+G AAS+ V +
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59

Query: 61 TK 62
           K
Sbjct: 60 KK 61

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 50.1 bits (118), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 46/62 (74%)

Query: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60
          MSAWRKAG++Y +YL VAA+T+R++LK ELQ+  VL+RS T+A    Y +  +A+E V +
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 61 TK 62
           K
Sbjct: 61 RK 62

>AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR207C
           (UME6)
          Length = 747

 Score = 26.9 bits (58), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 29  ELQTANVLSRSRTDAYYTKYKNGTAASEPVS 59
           EL  A ++S+ R+  Y+T + +  A S PVS
Sbjct: 463 ELGAAAIISQMRSSPYHTDFSSADANSRPVS 493

>Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}
           similar to Ashbya gossypii AGL099C
          Length = 816

 Score = 26.6 bits (57), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 29  ELQTANVLSRSRTDAYYTKYKNGTAASEPVS 59
           EL  A ++S+ R+  Y+T + +  A S PVS
Sbjct: 525 ELGAAAIISQMRSSPYHTDFSSAEANSRPVS 555

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.117    0.312 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,315,616
Number of extensions: 127514
Number of successful extensions: 294
Number of sequences better than 10.0: 22
Number of HSP's gapped: 294
Number of HSP's successfully gapped: 22
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)