Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.336.8ON51851825940.0
Smik_6.4806.8ON51651823760.0
YPL272C6.8ON51751823230.0
Skud_16.56.8ON51551823090.0
KNAG0E027706.8ON50852112521e-168
TDEL0G046306.8ON50352512351e-165
NDAI0G00860singletonON52353312231e-163
CAGL0A01089g6.8ON53554512021e-160
Kpol_1045.796.8ON50852611331e-150
SAKL0E00792g6.8ON51152410781e-142
KAFR0B065106.8ON50852710581e-139
TPHA0J002606.8ON51552910411e-136
TPHA0M001806.8ON50351910221e-133
NCAS0D021806.8ON5155298321e-105
TBLA0A072206.8ON5095398151e-102
KLTH0C11572g6.8ON5185256952e-84
Ecym_30116.8ON5095236305e-75
Kwal_56.223416.8ON5195236291e-74
ACR018C6.8ON4784576137e-73
Kpol_1032.1singletonON2462533143e-32
Kpol_191.16.8ON1391451002e-04
KLTH0C02178g5.119ON4641351029e-04
Kwal_27.98985.119ON460124930.010
CAGL0K00737g5.119ON457309830.16
Kpol_1010.495.119ON48180820.20
NDAI0D023605.119ON470324800.37
TPHA0H009605.119ON476136790.51
KNAG0F003901.65ON65896751.5
Kpol_1003.442.295ON47031706.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.33
         (518 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...  1003   0.0  
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   919   0.0  
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   899   0.0  
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   894   0.0  
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   486   e-168
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   480   e-165
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              475   e-163
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   467   e-160
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   441   e-150
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   419   e-142
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   412   e-139
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   405   e-136
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   398   e-133
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      325   e-105
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   318   e-102
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   272   2e-84
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   247   5e-75
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   246   1e-74
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   240   7e-73
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   125   3e-32
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    43   2e-04
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    44   9e-04
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    40   0.010
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    37   0.16 
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    36   0.20 
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    35   0.37 
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    35   0.51 
KNAG0F00390 Chr6 (48002..49978) [1977 bp, 658 aa] {ON} Anc_1.65 ...    33   1.5  
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    32   6.0  

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/518 (95%), Positives = 493/518 (95%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIF          EADADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120
           RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW
Sbjct: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240
           LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF
Sbjct: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300
           YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420
           LSLIDDELSINEFLV               KLMEYQFNKVTKHVSNYIMTKLKSWERNGF
Sbjct: 361 LSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420

Query: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480
           NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT
Sbjct: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480

Query: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/518 (85%), Positives = 476/518 (91%), Gaps = 2/518 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIF          E DADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120
           RLTLPLIATTLK+LIKSQPALFAT+NE+WE+ PL+QLKTSDIVNVIEFET KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRF+PGSN+PLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240
           LN+I+SV+  +DR+LFDIN+V+ ++L+FPKSIYDSAKL LPAMTPQI HKQTQSFFKSIF
Sbjct: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300
           YNTLKRPFGYLTNQTS SSPA  +QLK+YNDILN +SSLCGTTVFGIV+NQRF+YLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHL LGESLGLFFKELRI CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360

Query: 361 LSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420
           LSLIDDELS+NEFL                KLMEYQFN VTKHVS++IM KLKSWE+NGF
Sbjct: 361 LSLIDDELSVNEFLA--NSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWEKNGF 418

Query: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480
           NDDDIRRMKYDNDD+FH+QNSKTKL+QINDVSDISLSM+NDDKSFKIVSSGFT+SINRPT
Sbjct: 419 NDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPT 478

Query: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           L+SLSYTYC++MGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 479 LLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/518 (84%), Positives = 469/518 (90%), Gaps = 1/518 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKK+LTQSLNDQRNGTIF          E DADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120
           RLTLPLIATTLK+LIKSQPALFATVNE+WE+ PLKQLKTSDIVNVIEFET KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240
           LN I++V+ S+DR+LFD+ND+N +EL FPKSIYDSAKL LPAMTPQI HKQTQSFFKSI+
Sbjct: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240

Query: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300
           YNTLKRPFGYLTNQTS SS    +QLK+YNDILN ++SLCGTTVFGIVNNQRF+YLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVF+IPI+LR HL LG SLGLFFKELR+ECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECP 360

Query: 361 LSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420
           LSLIDDELS NEFL                +LMEYQFNKVTKHVS +IM KL+SWE+NGF
Sbjct: 361 LSLIDDELSANEFLT-NSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKNGF 419

Query: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480
           NDDDIRRMKYDNDDDFH+QNS+TKLIQINDVSDISLSM+ DDKSFKIVS+GFT+SINRPT
Sbjct: 420 NDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPT 479

Query: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           LMSLSYTYCE+MGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 480 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/518 (84%), Positives = 466/518 (89%), Gaps = 3/518 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIF            DADW+SDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120
           RLTLP IA TLK+LIKSQPALFATVNE+WE+ PLKQLKTSDIVNVIEFET KDKEVNCHW
Sbjct: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240
           LN+I+  + SDDRVLFDI+DVN + L+FPKSIYDSAKL LPAMTPQI HKQTQSFFKSIF
Sbjct: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300
           YNTLKRPFGYLTNQTS      T+QLK+YNDILN +SSLCGTTVFGIVNNQRF+YLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDF+G IVFSIPIDLRK+L+LGESLGLFFKELRIECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420
           LSLIDDELS +EFL                KLMEYQFNKVTKHVS++IM KLKSWE+NGF
Sbjct: 361 LSLIDDELSADEFLA--NRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKNGF 418

Query: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480
           NDDDIRRMKYDN DD H+QNSKTKLIQINDVSDISLSM+ND+K+FKI+SSGFT+SINRPT
Sbjct: 419 NDDDIRRMKYDN-DDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPT 477

Query: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           LMSLSYTYCE+MGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 478 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  486 bits (1252), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 253/521 (48%), Positives = 346/521 (66%), Gaps = 19/521 (3%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDS 60
           M++ R LSSFEKKLL QS++  +NGT F               W  +E TL T     DS
Sbjct: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFK-----EGWSDEEATLLT---VKDS 52

Query: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120
           RL L L+   L+ LIK    LF T+NE +E+  LK++KTSD+++ I+F++ KD+++NC  
Sbjct: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           G PP YLLRH FN  RFVPGS KPLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171

Query: 181 LNSITSVSRSDDRV--LFDINDVNFAEL-SFPKSIYDSAKLRLPAMTPQILHKQTQSFFK 237
           +N ++S  +   ++  +F     + +E+   PKSIYD+ KL +P + P + + QTQSFFK
Sbjct: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231

Query: 238 SIFYNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLK 297
           SI+ NT+K+P  +LTN T  S  +  S +K YNDIL+ NS LCG TVFG V+N+RF YL 
Sbjct: 232 SIYVNTVKKPIEFLTN-TDVSFLSLNSNMK-YNDILDINSKLCGNTVFGCVSNERFKYLN 289

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRI 357
           +I+NQE +CL+SFI GIAM+CLKP+VK+ SGT+ FSIP+DLR  ++     GL++K++R+
Sbjct: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349

Query: 358 ECPLSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSWER 417
           ECPLSLIDD+ S +                   KLMEYQF  +T  V N++  +L  + +
Sbjct: 350 ECPLSLIDDDKSKD-----CMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSK 404

Query: 418 NGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSIN 477
            GFNDDDIRRMK+D+ +     ++    IQI D S I+++   +  SF I +   T S+N
Sbjct: 405 TGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLN 464

Query: 478 RPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
              LMSLSYTYCE+ GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 465 SEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  480 bits (1235), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 254/525 (48%), Positives = 338/525 (64%), Gaps = 34/525 (6%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRL 62
           +FR L  FEKK+L+QSL   RNG +F              +W SD+ TL T     DSRL
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYST-----TPEEW-SDDATLLTYK---DSRL 52

Query: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122
            L L++ TL K+I     LF T+NE  E+AP+K++K  +++N + F + KD+ VNC +G 
Sbjct: 53  NLSLLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FN+T F PGS   LW +YV+DETL+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171

Query: 183 SITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFYN 242
           SI S S S    +F +         FPKSIYD+AKLRLPA    + + QTQSFFKS+++N
Sbjct: 172 SI-SKSGSKLSTIFKLEKAVLP--PFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228

Query: 243 TLKRPFGYLTNQTSFSSPAPTSQLK----RYNDILNTNSSLCGTTVFGIVNNQRFSYLKS 298
            +K+P  Y+ +        P  QLK    RY DIL T+++LCGTT+FG +  +R   L  
Sbjct: 229 AVKKPLDYINSN-------PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDC 281

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIE 358
           I  Q++ICL+SF+CGI M+CLKP+VK+++G+I F +P+DLR  L      G+F+K++R+E
Sbjct: 282 IFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVE 341

Query: 359 CPLSLIDDE----LSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKS 414
           CPLSLIDD+    L++                    +L+EYQF +VT HV   +  ++K+
Sbjct: 342 CPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKA 401

Query: 415 WERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSND-DKSFKIVSSGFT 473
           WE+ GFNDDDI+RMK+ +DD      + TKLIQINDVSDI +    D    F +     T
Sbjct: 402 WEKFGFNDDDIKRMKFGSDD----TATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMT 457

Query: 474 NSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
            S+    LMSLSYT+ E  GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 458 QSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  475 bits (1223), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 247/533 (46%), Positives = 354/533 (66%), Gaps = 29/533 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRL 62
           + R LSSFEKK+L+Q+L+ +RNG  +           +D+        L T     D RL
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATK----DIRL 57

Query: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122
            + ++   L++LIK    L++T+NE++E+  L ++K  D+++VI F+T KD+++NCH G 
Sbjct: 58  NIGIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGA 117

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FNK +F    NKPLW LY+IDET+++FHG D+LFDIFSAANFHKLF  ELN
Sbjct: 118 PP-YLLRHIFNKEKF--ELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELN 174

Query: 183 S---ITSVSRSDDR---VLFDIN--DVNFAE--LSFPKSIYDSAKLRLPAMTPQILHKQT 232
                 + S+S+ +   V+F IN  D NF      FP+SI+D+ KL LPAMTP + + QT
Sbjct: 175 DYFLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQT 234

Query: 233 QSFFKSIFYNTLKRPFGYLTNQTSFSSPAPTSQLKRYN-----DILNTNSSLCGTTVFGI 287
           +SFFK+I+ NT+K+P        S +    TSQLK Y      D+L   SSLCGTTVFG 
Sbjct: 235 KSFFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGT 294

Query: 288 VNNQRFSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGES 347
           V+  R++YLK ++ Q+ ICLRSFICGI MICLKP +K++SG I+FSIPI+LR +++  ++
Sbjct: 295 VSPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKN 354

Query: 348 LGLFFKELRIECPLSLIDDE-LSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSN 406
            GLF+K+++I+CPLSLIDD     N +                 KL+EYQF +VT+ + N
Sbjct: 355 FGLFYKDVKIDCPLSLIDDRNFKYNGY--KDSSIPDENDLEFNEKLLEYQFKQVTEFIEN 412

Query: 407 YIMTKLKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMS-NDDKSF 465
            I+ +LK WE+  FNDDDI+RMK+D+D+   V    +K+IQIND ++I L  + N++K+F
Sbjct: 413 VILERLKIWEKFNFNDDDIKRMKFDHDE---VLGQNSKIIQINDTTEIMLGENDNNNKAF 469

Query: 466 KIVSSGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
            + +  FT +++    MS+S+  CE+ GLN+CIHYPD Y++E+FVECF++FIE
Sbjct: 470 TLTNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  467 bits (1202), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 248/545 (45%), Positives = 348/545 (63%), Gaps = 45/545 (8%)

Query: 5   RPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADAD-WHSDEVTLGT------NSSK 57
           R LSS+E+KLL++ L + +NGT+F           AD   W  D  TL        ++ K
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 58  DDSRLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVN 117
               LTLPL+   LK LI+  P ++ TVN+  E+APLK+++T D+++V+ F+  KD++VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 118 CHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLF 177
           CH G PPPYL+RH      F PGSNKPLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 178 LKELNSITSVSRSDDR---VLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQS 234
           LKEL ++    +S ++    LF +        S PKSIYD+ KL LPA  P++L+ QTQS
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 235 FFKSIFYNTLKRPFGYLTNQTSFSS-------------PAPTSQLK----RYNDILNTNS 277
           FFKSIF N +K+P  ++    +  +                 +QLK    RY +IL + +
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSAT 302

Query: 278 SLCGTTVFGIVNNQRFSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPID 337
           S CG T+FG V+N+RF+YL S+V  E ICLRSFI  I M+CLKP+VK F+GT++FS+P++
Sbjct: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362

Query: 338 LRKHLNLGESLGLFFKELRIECPLSLIDDEL----SINEFLVXXXXXXXXXXXXXXXKLM 393
           LR  +N     GL +K++R+ECPLS+IDD+      +NE                  KL+
Sbjct: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNE-----------SDPEYNEKLL 411

Query: 394 EYQFNKVTKHVSNYIMTKLKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSD 453
           E QF ++  +V+  I  ++ +W++ G+ND+D++RMK+   D+    N  T+LI+INDVS+
Sbjct: 412 EIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPN--TRLIKINDVSE 469

Query: 454 ISLSMSNDDKSFKIVSSGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECF 513
           +S    ND +   I S GFT S+++ TLMSLSYT+CE+ GLNICIHYPD YN+E+FV+CF
Sbjct: 470 VSFD-DNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCF 528

Query: 514 ESFIE 518
           ESF+E
Sbjct: 529 ESFME 533

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  441 bits (1133), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/526 (46%), Positives = 339/526 (64%), Gaps = 31/526 (5%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKD-- 58
           MT+FR L ++EKKL+ Q+L  Q NG IF              D  +D+ TL TNS     
Sbjct: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNA-----QDGLTDDATLLTNSEPLLL 55

Query: 59  DSRLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNC 118
           DSRL        L+K++   P L  TVNE  E+  +K++KTSDI+  ++F++ KD+ VNC
Sbjct: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110

Query: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFL 178
           H G PP YLLRH FN+ +F PGS KPLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169

Query: 179 KELNSITSVSRSDDRVLF--DINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFF 236
           + LNS+     +D   ++  D    N   +SFP++IY++ KLR+P  T  +++ QTQSFF
Sbjct: 170 ETLNSMDDEHITDLEYIYRYDATKSN-RSISFPRTIYENPKLRIPGKTIDLVNLQTQSFF 228

Query: 237 KSIFYNTLKRPFGYLTNQTSFSSPAPTSQLKRYN-DILNTNSSLCGTTVFGIVNNQRFSY 295
           KS + N +K+P   +T    F+S  P   +K    D +N  S+LCGTTVFG +   RF Y
Sbjct: 229 KSFYVNAIKKPLDIIT----FNS-EPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEY 283

Query: 296 LKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKEL 355
           L SI   E++C+RSFICGIA++CLK ++KDF+G+I FSIP++LR+ +      GLF+K +
Sbjct: 284 LNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTI 343

Query: 356 RIECPLSLIDDEL--SINEF--LVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTK 411
            +ECPLSLIDD++  +IN +                   K +EYQF +++  VS  +  +
Sbjct: 344 LVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKER 403

Query: 412 LKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSG 471
           +++W RNGFNDDDI++MK+ +DD    + S TK+IQINDVS+  ++ S   K   I    
Sbjct: 404 MRAWRRNGFNDDDIKKMKFTSDD----KASNTKIIQINDVSEFKINSSKSSKV-SIKELN 458

Query: 472 FTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFI 517
           FT+SI+    MSLSYTYC++ G NICIHYPD+Y++E FVE F+SF+
Sbjct: 459 FTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  419 bits (1078), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 224/524 (42%), Positives = 324/524 (61%), Gaps = 31/524 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRL 62
           +FR LSS EKKL +Q+LN++RNG +F          E    W SD  TL T     D RL
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEET--W-SDNATLLT---VKDQRL 59

Query: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122
           +  L++  LKK+I +   L+ T+N++ E+ P+K +   D+V  +EF++ KD+ VNCH GV
Sbjct: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K +F    +KPLW + ++DET+++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178

Query: 183 SITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFYN 242
            +     + + +  + +  +F    FPKSIY++ KLRLPA+   +   QTQSFFKS++  
Sbjct: 179 QLPKDGPTLECLFKNDSKASF----FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234

Query: 243 TLKRPFGYLTNQTSFSSPAPTSQLKRYN----DILNTNSSLCGTTVFGIVNNQRFSYLKS 298
           T+K+P  ++          P S LK Y     DIL   ++LCGTTVFG ++ +R   LK 
Sbjct: 235 TIKKPLDFINTN-------PNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKK 287

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIE 358
           I+ QE+ICL SF+C IA++CLKPLV +F  ++ FSIP+DLR  +      GL +K + +E
Sbjct: 288 IMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVE 347

Query: 359 CPLSLIDDE----LSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKS 414
           CPL+LIDD+    L++                     L+EYQF +   HV N +  + ++
Sbjct: 348 CPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRA 407

Query: 415 WERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTN 474
           WER+GFNDDDI+RMK+   +    Q    ++I++N+V++    + +D+ +F I    FT 
Sbjct: 408 WERSGFNDDDIKRMKFGKTE----QGKSKRIIEVNNVTEFQFHV-DDNATFNIKDVCFTK 462

Query: 475 SINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           S N  T MSLS  + E  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 463 SQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  412 bits (1058), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/527 (40%), Positives = 332/527 (62%), Gaps = 31/527 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRL 62
           T R LSS+E+K+L +++  +RNG IF           A ++   D+ TL T     DSR 
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASY------SASSEEWGDDTTLLT---LKDSRP 52

Query: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122
           T+ ++   +++LI     LF T+NE++E+  LK +K  DI+N++EF++ KD+++NCH G 
Sbjct: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+  RFVPGS KPLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171

Query: 183 SITS--VSRSDDRVLFDINDV--NFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKS 238
            + +  +  S+  ++F + +       L   KSIYD+ ++ LPA +P + + QTQSFFKS
Sbjct: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231

Query: 239 IFYNTLKRPFGYLTNQ------TSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQR 292
           +F++T+K+P  YL         TS ++ +  + +++Y DI + N++L  TTVFG +  QR
Sbjct: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291

Query: 293 FSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGE-SLGLF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ FSI I+LR  L       GLF
Sbjct: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351

Query: 352 FKELRIECPLSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTK 411
           +K++ I+ PLSLIDD    N  ++               K++E+QF +VT  V + I  +
Sbjct: 352 YKDVLIDVPLSLIDD----NAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERR 407

Query: 412 LKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSG 471
           +  +   GFNDDDIR+MKY    +       TK+I++ D S++SL     D  + + ++ 
Sbjct: 408 ISKFSTMGFNDDDIRQMKYGKPAE------DTKIIRLFDTSEVSLGSGKRDGKYILHNTN 461

Query: 472 FTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           FT S+ +    S+SYT C++ GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 462 FTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  405 bits (1041), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 219/529 (41%), Positives = 320/529 (60%), Gaps = 34/529 (6%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRLT 63
           FRPL+S+E+ +L +S  +Q NGTIF          + ++  + D  TL T + +++    
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDM---QTNSTINDDAATLLTQNEENN---M 56

Query: 64  LPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVP 123
                  L  +I   P L+ T+N   E+ P+ ++KT D+++ I+F +TKD+ VNC  G P
Sbjct: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNS 183
           P YLLRH FNK +FVPGS KPLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L  
Sbjct: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG 175

Query: 184 ITSVSRSDDRVLFDINDVNFAELS--FPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFY 241
            T  S      +F ++D++ + L+  FPKSIYDS  L LPA T  ++  QT+ F KS+  
Sbjct: 176 ATPTSEKL-TTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234

Query: 242 NTLKRPFGYLT----NQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLK 297
            T+ +P   +        SF++  P        DIL   SSLCGTTVFG ++N+RF YL+
Sbjct: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM-------DILEKTSSLCGTTVFGNISNERFDYLQ 287

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRI 357
           SI  +E++C +S +CGI M+CLKPL+KDFS  I FSI ++LR  +      GLF+K +RI
Sbjct: 288 SIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRI 347

Query: 358 ECPLSLIDDEL-----SINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKL 412
           E PLS IDD +     S N +                 +L+ YQFN++   +S  +  ++
Sbjct: 348 EVPLSFIDDNVFKLKTSYNGYDA-SNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRM 406

Query: 413 KSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVS--- 469
           ++W RNGFNDDDI+ MK+ + D    +N+  K+IQIND+SD+S    N +     VS   
Sbjct: 407 RAWRRNGFNDDDIKMMKFGSKD----KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKD 462

Query: 470 SGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
             FT+S+     MSLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 463 LSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  398 bits (1022), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 214/519 (41%), Positives = 318/519 (61%), Gaps = 23/519 (4%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRLT 63
           FR L  +EKK+L Q++  +RNG +F          +  AD   D  TL T  S ++  L 
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFAD---DNATLYTGRSVNEVSLK 59

Query: 64  LPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVP 123
             L A  L+ +I +   L+ T+N+   + P+ Q++T+D++  I ++ +KDK +       
Sbjct: 60  SVLCAA-LQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNS 183
              LLRH FNK  F P + KPLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N 
Sbjct: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176

Query: 184 ITSVSRSDDRV--LFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFY 241
           + + ++    V  LF   D   +  ++P+SIY++ KL LPA+T  +L+ QTQSFFK+I+ 
Sbjct: 177 VLNSNQKLKTVKTLFKF-DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235

Query: 242 NTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIVN 301
           NTLK+P   +T+  S ++   +    R  DIL+  +SLCG TV G ++ +R+ +LK +V 
Sbjct: 236 NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVE 295

Query: 302 QEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECPL 361
           QE+I LRSFI  I M+CLKP+VK+F G+I+FSIP++LR  +      GLF+K +++ECPL
Sbjct: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355

Query: 362 SLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSWERNGFN 421
            LI+DE                        L+E QF ++++HVS+ I  ++K+WE+ GFN
Sbjct: 356 ELINDE--------KYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFN 407

Query: 422 DDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDD--KSFKIVSSGFTNSINRP 479
           DDDI+RMK+ ND+   +      +IQINDV++IS    ND+   SF + +  FT S++  
Sbjct: 408 DDDIKRMKFSNDEKTGI----APIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCN 463

Query: 480 TLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
             MSL Y++    GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 464 EFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/529 (36%), Positives = 304/529 (57%), Gaps = 33/529 (6%)

Query: 5   RPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRLTL 64
           R LS +E KLL Q+L  +RNG  F           + +          T  S  D RLTL
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLS-----SSDESTLVSLKDRRLTL 58

Query: 65  PLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVPP 124
            +I   L+ LI     L+  ++ED  Y+ + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117

Query: 125 PYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNS- 183
           PYLLRH FNK+ F  G  KPLW LY+IDET ++FHG D+LFD FSAA FHK FL E+NS 
Sbjct: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177

Query: 184 ITSVSRSDDR----VLFDINDVNFAEL-----SFPKSIYDSAKLRLPAMTPQILHKQTQS 234
           ++S+  S  +     LF ++  + A+L       P+SIYD        +T  + + QT+S
Sbjct: 178 MSSIVSSKQKKPLDYLFQLS--SSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKS 235

Query: 235 FFKSIFYNTLKRPFGYLTN---QTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQ 291
           FFKS++ N +K+P  ++TN   Q         ++ + Y + +  + SLCG T+FG +++ 
Sbjct: 236 FFKSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSC 295

Query: 292 RFSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLF 351
           RF+ L     +E I L+S ICG+ M+ LKP + DFS  +VFSI ++LR  ++  ++ GL+
Sbjct: 296 RFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLY 355

Query: 352 FKELRIECPLSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTK 411
           ++++ IECPLSLIDD  +I                    K+ E QF  VT ++ N +  K
Sbjct: 356 YRDIIIECPLSLIDDR-AIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEK 414

Query: 412 LKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVS--DISLSMSNDDKSFKIVS 469
           +  W+     D+DI+ MK  +     +  SK ++IQIND++  DI+ ++S +D  + + S
Sbjct: 415 IGYWK----TDNDIKMMKMMD----DMHQSKDEIIQINDLTEIDINENLSQND-PYCVKS 465

Query: 470 SGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           S    S+++  + S+SYT+CE  GL I IH P   ++ESFVE F++F++
Sbjct: 466 SSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/539 (35%), Positives = 303/539 (56%), Gaps = 64/539 (11%)

Query: 3   TFRPLSSFEKKLLTQSLNDQ-RNGTIFXXXXXXXXXXEADADWHSDEVTLGTNS---SKD 58
             RPLSS EK+ L  SL  + R+G++                W S+ + +  ++   S  
Sbjct: 11  VLRPLSSVEKRFLGNSLESETRHGSV------------CSGKWVSNSLDISDDATLLSSK 58

Query: 59  DSRLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNC 118
           D  LT+ L++  LK LI +   +F T+N++ E+  L ++ TSD+++ I FE  KD+ VNC
Sbjct: 59  DKPLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNC 118

Query: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFL 178
           H G PP YL+ + F+   F P S KPLW L++++ +L+VF+G D LFDIF+ ANF KL  
Sbjct: 119 HSGAPP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLF 177

Query: 179 KELNSITSVSRS-DDRVLFDINDV-NFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFF 236
           + +NS+   ++   D ++F + ++ N ++++FPKSIYD+  L LPA  P++ + QTQSFF
Sbjct: 178 EIINSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFF 237

Query: 237 KSIFYNTLKRPFGYL--TNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFS 294
           KSI+ NT K+ F YL  T QT        +  K YN+IL+ NS +    V G V+ +R+ 
Sbjct: 238 KSIYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYL 297

Query: 295 YLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNL---------- 344
            L  +++ E I L+SF C I ++CLK ++  F G+I+F IP +LR   NL          
Sbjct: 298 QLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSS 357

Query: 345 -----GESLGLFFKELRIECPLSLIDDELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNK 399
                   LG+ +K++ +E PL LI+                          ++E QF  
Sbjct: 358 GPEDSANELGIIYKDIYVEVPLKLIE--------------------KIGNEDVVEEQFKI 397

Query: 400 VTKHVSNYIMTKLKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMS 459
           V  +++  I  ++K+WE+NGFNDDDI+RMK+  +    V N    +I++ND++ + LS S
Sbjct: 398 VCNYINESIQKRIKAWEKNGFNDDDIKRMKFGYE---QVGN----IIEVNDLTSLDLSCS 450

Query: 460 NDDKSFKIVSSGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
             D  F I     T ++ +  ++SLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 451 -KDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  272 bits (695), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 171/525 (32%), Positives = 270/525 (51%), Gaps = 25/525 (4%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDS 60
           +  +R L+  EK +L ++    +NG +F            + D   +E    T  S  + 
Sbjct: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNF---PNKDLSDNE----TLRSDMNQ 57

Query: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120
           RL+  +I   L K+IK    L   V+ + E+ P+ ++   D+V  IEF+   D++VNC+ 
Sbjct: 58  RLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYN 117

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPP YLLRH F+K  F  G  +PLW L+VID T++VFHGHDVLFD F+AANFHKLFL+ 
Sbjct: 118 GVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQA 176

Query: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240
           LNS+ S S +  R +F    +     + P++++   + +  +      + Q+Q+  +S++
Sbjct: 177 LNSL-SESCTSPRPVFKGGKI---LPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLY 232

Query: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300
              +K+P  ++ +     S   T Q     + LN  + LCGT VFG ++  RF  LK I+
Sbjct: 233 NLAIKKPLRFIESGRIEHS---TEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGIL 289

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360
           N   I +++FI    + CL+P++      I FS+PI+LR  +     LG++ + + IECP
Sbjct: 290 NDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECP 349

Query: 361 LSLIDDELSI-------NEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLK 413
           L       +        N  L+                  E  F +   HVSN +   L+
Sbjct: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409

Query: 414 SWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFT 473
             E   F D D+  MK + +  F+   S +K+I+IND+S+I LS  N  + + +     T
Sbjct: 410 DLETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQ-YVVEDICAT 466

Query: 474 NSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
            S    T MS+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  247 bits (630), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 161/523 (30%), Positives = 283/523 (54%), Gaps = 30/523 (5%)

Query: 2   TTFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSR 61
           ++ R LSS EK    +    +RNG +F          + +++  SD++TL   S+  DSR
Sbjct: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSN---KCESERWSDDITL---SNLRDSR 59

Query: 62  LTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWG 121
           L    I+  L+ +IK    L  T+ +D ++AP + ++  D+V  IEF+T KD+ + C  G
Sbjct: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119

Query: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKEL 181
           +PP Y+LR+     +F  G  +PLW L ++D T+++ H H+V+FD+F+AANFH  F K L
Sbjct: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176

Query: 182 NSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFY 241
           +     + + D +LF + + N  EL   K+ +D    ++     Q L  Q  S  K  + 
Sbjct: 177 SQFPKDTHALD-ILF-VYEGN--ELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYR 231

Query: 242 NTLKRPFGYLTNQTSFSSPAPTSQLKR---YNDILNTNSSLCGTTVFGIVNNQRFSYLKS 298
            T+K+    +      ++   T +  +   +  + N N+ LCGTTV G +N +R + L  
Sbjct: 232 TTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNT-LCGTTVSGSLNAERLASLLE 290

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIE 358
           + + E++C+ S +C I ++ LKPL++ F+G+I F +PID+R+ L + + LG+ +  L +E
Sbjct: 291 LTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMVE 349

Query: 359 CPLSLIDD---ELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSW 415
           CPLS I+D   + ++++  +                L+EYQF ++T HV N +  K ++W
Sbjct: 350 CPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAW 409

Query: 416 ERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNS 475
           ++  F+   ++  K    +       + K I+IN V D+  +    D  F   +  FT+S
Sbjct: 410 QKRRFDMSSLKGKKLRRSNKI----IRGKFIEINLV-DMGEA---QDGQFHTKNVNFTSS 461

Query: 476 INRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           +    L+S+S      +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  246 bits (629), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 153/523 (29%), Positives = 269/523 (51%), Gaps = 24/523 (4%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRL 62
            +R L++ EK ++ ++    +NG +F            +   + D  +   +  K    L
Sbjct: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYF-------EGPDNVDNTSPSVSCMKMGKGL 59

Query: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122
              ++   L ++IK    L +++N+  ++  +  +   D+V  IEF+   D++V+C+ GV
Sbjct: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K  F  G  KPLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178

Query: 183 SITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFYN 242
           S  +V      ++F   +     +   +S+     + L +     +   +Q+  K+++  
Sbjct: 179 SFRNVKGQKSDLIFKTRE---DLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSL 235

Query: 243 TLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIVNQ 302
            +K+P  ++ +     S  P S      D+ +    LCGT VFG VN +R   L++++N+
Sbjct: 236 AIKKPLRFIESGRLEHSGIPASNPY---DLASYAGDLCGTVVFGNVNPERVRGLRALMNE 292

Query: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECPLS 362
             I  RSFI  + M CL P+++     I+FS+PI+LR+ +     LG+F   +  ECPL 
Sbjct: 293 SKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLD 352

Query: 363 LIDDEL-------SINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSW 415
           LI  ++       + N+  +                  +  F ++  HV+  +       
Sbjct: 353 LIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRL 412

Query: 416 ERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNS 475
           E++  + +D+  +K + +  +   +S++K+++IND+ ++ LS S     +KI     T+S
Sbjct: 413 EKSHSSGEDL--IKAEREARYFAASSRSKIVEINDLLEVDLS-SKIHSRYKIGDVCSTSS 469

Query: 476 INRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
               T MS+SY   E  GLN+ IHY + +N+E FVE FE F++
Sbjct: 470 RKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  240 bits (613), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 156/457 (34%), Positives = 243/457 (53%), Gaps = 33/457 (7%)

Query: 67  IATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVPPPY 126
           I++ L+ +I+    +  TV +  ++AP+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105

Query: 127 LLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNSITS 186
           + RH  NK++F  G  KPLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163

Query: 187 VSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAM-TPQILHKQTQSFFKSIFYNTLK 245
            +   +  LF         L  P    D     LP +  P        SF K++    LK
Sbjct: 164 -NEPHNETLFVYEG---GPLQLP---IDPDACSLPGVDVPYPASSPFVSFVKNVCRYALK 216

Query: 246 RPFGYLTNQTSFSSPAPTSQLKRYNDILNTN-SSLCGTTVFGIVNNQRFSYLKSIVNQEH 304
            PFG L +  + S     S L R   +L  +  SL GTTV G +N+++   L  ++++E 
Sbjct: 217 -PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNSKKLDSLLKLISKEE 275

Query: 305 ICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECPLSLI 364
           +C+RSF+C I ++ LKPL+++F G+I FSIP+DLR   +     G   K + ++CPL+LI
Sbjct: 276 VCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALI 335

Query: 365 DD---ELSINEFLVXXXXXXXXXXXXXXXKLMEYQFNKVTKHVSNYIMTKLKSWERNGFN 421
           DD   E   N                    L+EYQF +VT HV       +KS       
Sbjct: 336 DDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHV-------MKSLTAQTSG 388

Query: 422 DDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPTL 481
           D   +R KY        Q  K K+I+IN V D+  S S     F+I +  FT+S+   T 
Sbjct: 389 DWTGKR-KYSK-----CQLRKKKIIEIN-VVDMGTSPS---ARFQIKNMNFTDSLGSETF 438

Query: 482 MSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518
           MSLS      +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 439 MSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  125 bits (314), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 131/253 (51%), Gaps = 28/253 (11%)

Query: 273 LNTNSSLCGTTVFGIVNNQRFSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVF 332
           L  +S +    +FG +  +RF+ LK+++ +  ICLRS ICGI M+C KP +++F G I F
Sbjct: 14  LRKDSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRF 73

Query: 333 SIPIDLRKHLNLGESLGLFFKELRIECPLSLIDDELSINEFLVXXXXXXXXXXXXXXXKL 392
           SI +D++  ++     G+  K + ++CPL LIDD+                        +
Sbjct: 74  SIGVDMKPIVDDSSQFGILKKNIIVDCPLKLIDDK----------HYKDTDSESIKNGDI 123

Query: 393 MEYQFNKVTKHVSNYIMTKLKS----WERNG--FNDDDIRRMKYDNDDDFHVQNSKTKLI 446
           +E QF KVT  V+  +  KL+S    ++RN   FN   I           + Q S +K+I
Sbjct: 124 LEIQFRKVTDFVTEELSNKLQSMAKHFKRNNCPFNFSSI-----------NSQISDSKVI 172

Query: 447 QINDVSDISLSMSNDD-KSFKIVSSGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYN 505
           QIND++DI  + +  +   +       T  ++    MSLSY    +  ++I IHY ++  
Sbjct: 173 QINDLTDIPFTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKY 232

Query: 506 LESFVECFESFIE 518
           ++SFVECF +FIE
Sbjct: 233 MDSFVECFRTFIE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 63/145 (43%), Gaps = 9/145 (6%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFXXXXXXXXXXEADADWHSDEVTLGTNSSKDDSRLT 63
            R L+  EK  L Q+     NG IF              D  SD+ TL T     +S   
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNL 53

Query: 64  LPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVP 123
             L+  +LK LI     L  TV+E+  +  L ++KT+D+V +I +   K  ++N     P
Sbjct: 54  QLLLLKSLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTL 148
              L+   +  + F PGS KP   L
Sbjct: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 17/135 (12%)

Query: 67  IATTLKKLIKSQPALFATV---NEDWEYAPLKQ-LKTSDIVNVIEFETTKDKEVNCHWGV 122
           I   ++ ++   P L++ V   N      PL+  L  SD+V   E E+  ++  N     
Sbjct: 38  IVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN----- 92

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVI-DETLLVFHGHDVLFDIFSAANFHKLFLKEL 181
                    F +  FV G+ KPLW + ++ D+   V     ++ D  SA  F   F++ L
Sbjct: 93  -------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRSL 145

Query: 182 NSITSVSRSDDRVLF 196
           N+  + S   D V+F
Sbjct: 146 NASHADSTFPDEVVF 160

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 52/124 (41%), Gaps = 11/124 (8%)

Query: 67  IATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIV-NVIEFETTKDKEVNCHWGVPPP 125
           I   +K  ++  P L++ V    E   L+ +    ++  V+E+           +G+   
Sbjct: 38  ICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYT---------DYGLLDE 88

Query: 126 YLLRHAFNKTRFVPGSNKPLWTLYVI-DETLLVFHGHDVLFDIFSAANFHKLFLKELNSI 184
            +    F +  F  GS KPLW + V+ D   LV     V+ D  S   F K FL  LN+ 
Sbjct: 89  DICNKIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLNAT 148

Query: 185 TSVS 188
            S S
Sbjct: 149 ASTS 152

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 125/309 (40%), Gaps = 61/309 (19%)

Query: 70  TLKKLIKSQPALFATV---NEDWEYAPLKQ-LKTSDIVNVIEFETTKDKEVNCHWGVPPP 125
            L++++ S   L+      N +    P+ + +K  D+V+ ++++T  ++E+N        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 126 YLLRHAFNKTRFVPGSNKPLWTLYVIDET-LLVFHGHDVLFDIFSAANFHKLFLKELNSI 184
                 F K  F  G +KPLW + V+ +   ++F    + FD  +   F    LK L  +
Sbjct: 95  -----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEEL 149

Query: 185 TSVSRSDDRVLFDINDVNFAELSFPKSI---YDSAKLRLPAMTPQILHKQTQSFFKSIFY 241
               + D+ +  D++++ +       SI   +   KL +P        K  +   K++F 
Sbjct: 150 ----KQDNDL--DVDEIIYRPGGSTDSIDQCHPYEKLPIP-----FSWKVKRPIVKALF- 197

Query: 242 NTLKRPFGYLTNQTSFSSPAPTSQLKRY---NDILNTNSSLCGTTVFGIVNNQRFSYLKS 298
                    +      S  A   Q   Y    D L  NS+  G   + I N  R   LK 
Sbjct: 198 --------TIAPGAVVSQDASIIQFDEYKIPEDYLKKNSNDDG--CYQIKNTNRQISLKM 247

Query: 299 IVN----------QEHICLRSFICGIAMICLKPLVKD-FSG-TIVFSIPIDLRKHL-NLG 345
             N          Q H+   +++  +  + L  + K+ +SG TI + +P++ R  + N G
Sbjct: 248 SSNKLKVIMKDCKQHHVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPMNTRNRISNSG 307

Query: 346 E---SLGLF 351
           E   S G F
Sbjct: 308 EYSNSYGTF 316

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 38/80 (47%), Gaps = 13/80 (16%)

Query: 132 FNKTRFVPGSNKPLWTLYVIDET--LLVFHGHDVLFDIFSAANFHKLFLKELNSITSVSR 189
           F +  F   ++KP+W + V++    LL+   H VLFD  S  NF   F+  L SI S+S 
Sbjct: 101 FQEYSFEYFTDKPVWKILVLENQNQLLMLLDH-VLFDGMSGINFWNSFISSLPSIDSISE 159

Query: 190 SDDRVLFDINDVNFAELSFP 209
                     D N  EL FP
Sbjct: 160 ----------DANANELIFP 169

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 130/324 (40%), Gaps = 60/324 (18%)

Query: 70  TLKKLIKSQPALFATV--NEDWEYAPLKQLKTS-----DIVNVIEFETTKDKEVNCHWGV 122
            L+  I + P L   +  N++ EY  ++ +K +     D+V  + +E  ++KE+N     
Sbjct: 44  ALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINS---- 99

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE--TLLVFHGHDVLFDIFSAANFHKLFLKE 180
                    F    F   +++PLW + V+    T ++   H  LFD  SA    + F+++
Sbjct: 100 --------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDH-ALFDGISAVKIWETFMEK 150

Query: 181 LNSITSVSRSDDRVLFDINDVNF-AELSFPKSIYDSAKL------------RLPAMTPQI 227
           LN  + +   D  V   I + N    L   +  YD   +            +L    PQ 
Sbjct: 151 LNKSSEIENIDVTVPLYIPEENHEGTLVASQHPYDIWPVPIAWKVKSFIATKLFNWYPQA 210

Query: 228 LHKQTQSFFKSIFYNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGI 287
           +     + F+   +   K P G+L   + +     TS  K  ND       +    +  I
Sbjct: 211 IISPNSNLFE---FKGYKFPEGFL---SQYPKDGVTS-FKVRNDNTQKLIKMAPGKLETI 263

Query: 288 VNNQRFSYLKSIVNQEHICLRSFICGIAMICLKPLVKD-FSGTIV-FSIPIDLR----KH 341
           + N +            + L S+I  I +I L+ + ++ ++G ++  SIPI+ R      
Sbjct: 264 LKNCK---------TNAVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIPINTRNICANQ 314

Query: 342 LNLGE---SLGLFFKELRIECPLS 362
           +N  E    LG F   +  E P++
Sbjct: 315 VNTPEEMLQLGNFVGSMDFEHPIN 338

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 58/136 (42%), Gaps = 16/136 (11%)

Query: 67  IATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSD----IVNVIEFETTKDKEVNCHWGV 122
           + ++L+K+I     L   +N++ + A +  +  +D    + +VIE+           W  
Sbjct: 40  LCSSLRKVIAKNRILRCNINKNGDSAYINDIIENDNEFTVQDVIEYR---------DWNK 90

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE--TLLVFHGHDVLFDIFSAANFHKLFLKE 180
                    F +  F  G  KPLW L +  +  T+++   H   FD  SA  F K  L E
Sbjct: 91  FEEDEQNSVFQEINFKYGELKPLWKLIIASKINTIVLAMDH-TFFDGSSATLFWKALLLE 149

Query: 181 LNSITSVSRSDDRVLF 196
           L+SI      D  V+F
Sbjct: 150 LSSIDRDQLEDTDVVF 165

>KNAG0F00390 Chr6 (48002..49978) [1977 bp, 658 aa] {ON} Anc_1.65
           YNL279W
          Length = 658

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 5/96 (5%)

Query: 239 IFYNTLKRPFGYLTNQT-SFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLK 297
           IF   LKR    + +++ SF++    + LKR  DI +TN+++        +N Q F +++
Sbjct: 453 IFLAVLKRAMHNIDSKSGSFTNSTVATTLKRDMDIWSTNTNMYINATEANINQQIFGWIE 512

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFS 333
           +     +  +   I  I     K LVK F+GT++++
Sbjct: 513 TTTTSVNQTVNHMIQDID----KTLVKIFNGTLLYN 544

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDV 451
           NDDDIR M  DN DD  + N  T++ ++++V
Sbjct: 333 NDDDIRSMPDDNVDDVLLSNEVTEIEELDNV 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,526,067
Number of extensions: 2664195
Number of successful extensions: 8579
Number of sequences better than 10.0: 49
Number of HSP's gapped: 8796
Number of HSP's successfully gapped: 50
Length of query: 518
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 404
Effective length of database: 40,409,475
Effective search space: 16325427900
Effective search space used: 16325427900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)