Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_16.328.841ON25925913850.0
Suva_13.515na 1ON32524913380.0
YPL273W (SAM4)8.841ON32524912131e-169
Smik_6.4848.841ON32524912051e-168
Suva_64.1singletonON27319710611e-147
TDEL0E05690singletonON32825410541e-145
NCAS0D049408.841ON32725010361e-142
SAKL0D01452g8.841ON32724810241e-140
KAFR0B00210singletonON32624710191e-140
KLTH0C03850g8.841ON32924810181e-139
Kwal_27.102558.841ON32924810071e-138
TPHA0G03760singletonON33124710061e-137
Skud_101.1singletonON2002009711e-134
NDAI0F00250singletonON3292509821e-134
KLLA0D01551g8.841ON3312499811e-134
Skud_100.1singletonON2002009661e-133
KNAG0B06970singletonON3322389781e-133
Ecym_46128.841ON3262509431e-128
Suva_16.17singletonON3242519391e-127
Smik_12.1na 2ON3242519311e-126
Skud_12.4na 2ON3252509211e-125
TDEL0E00240singletonON3282499221e-125
YLL062C (MHT1)na 2ON3242519211e-125
KAFR0L00150singletonON3262498061e-107
ABL125W8.841ON3362497891e-104
KAFR0F04420singletonON3262497611e-100
TBLA0B032608.841ON3262486863e-89
ZYRO0G14212g8.841ON3252536786e-88
Kpol_1068.78.841ON3232476682e-86
TPHA0I002608.841ON3232476586e-85
SAKL0D09306gna 3ON3262615533e-69
YMR321Cna 1ON1051055135e-66
AFR410WsingletonON3702544687e-56
Kwal_0.322na 3ON3322634571e-54
KLTH0H12716gna 3ON3482654162e-48
Skud_47.2singletonON9620909e-04
SAKL0A04202g6.224ON621187692.9
TPHA0O006301.386ON59450674.7
Skud_12.1698.289ON34866657.4
NDAI0K002808.858ON57129659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_16.32
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   538   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   520   0.0  
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   471   e-169
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   468   e-168
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        413   e-147
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   410   e-145
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               403   e-142
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   399   e-140
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       397   e-140
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   396   e-139
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   392   e-138
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     392   e-137
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   378   e-134
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       382   e-134
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   382   e-134
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   376   e-133
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             381   e-133
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   367   e-128
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   366   e-127
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   363   e-126
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   359   e-125
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       359   e-125
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   359   e-125
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      315   e-107
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   308   e-104
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               297   e-100
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   268   3e-89
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   265   6e-88
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   261   2e-86
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   258   6e-85
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   217   3e-69
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   202   5e-66
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   184   7e-56
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   180   1e-54
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   164   2e-48
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)       39   9e-04
SAKL0A04202g Chr1 complement(392142..394007) [1866 bp, 621 aa] {...    31   2.9  
TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {...    30   4.7  
Skud_12.169 Chr12 (324942..325988) [1047 bp, 348 aa] {ON} YLR100...    30   7.4  
NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON...    30   9.0  

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/259 (100%), Positives = 259/259 (100%)

Query: 1   MSKNKPRKNSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCI 60
           MSKNKPRKNSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCI
Sbjct: 1   MSKNKPRKNSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCI 60

Query: 61  GPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILS 120
           GPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILS
Sbjct: 61  GPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILS 120

Query: 121 WDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSP 180
           WDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSP
Sbjct: 121 WDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSP 180

Query: 181 DILESLHRALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGC 240
           DILESLHRALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGC
Sbjct: 181 DILESLHRALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGC 240

Query: 241 CRTTPKDIQEVSAAVKKYT 259
           CRTTPKDIQEVSAAVKKYT
Sbjct: 241 CRTTPKDIQEVSAAVKKYT 259

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/249 (99%), Positives = 249/249 (100%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE
Sbjct: 77  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF
Sbjct: 137 FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL
Sbjct: 197 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           PNMPLLAYPNSGEVYDTEKKIW+PNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE
Sbjct: 257 PNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 316

Query: 251 VSAAVKKYT 259
           VSAAVKKYT
Sbjct: 317 VSAAVKKYT 325

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  471 bits (1213), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 220/249 (88%), Positives = 238/249 (95%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTS+KSVSENTPI+TL+ Y+NLL RIVDFSR+CIGE+K+LIGCIGPWGAH+C E
Sbjct: 77  LMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYLIGCIGPWGAHICRE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTG+YG  PE+IDFYQYFKPQL+NFNKNDKLDL+GFETIPNIHELKAILSWDESILS+PF
Sbjct: 137 FTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHELKAILSWDESILSRPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHEHGVLRDGTTME +A+VIKDLGDKINPNF  LGINCVSFNQSPDILESLH+AL
Sbjct: 197 YIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVSFNQSPDILESLHQAL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           PNM LLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYI SGARIIGGCCRT+PKDIQE
Sbjct: 257 PNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQE 316

Query: 251 VSAAVKKYT 259
           +SAAVKKYT
Sbjct: 317 ISAAVKKYT 325

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  468 bits (1205), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 221/249 (88%), Positives = 236/249 (94%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTS+KSVSENTPIKTL+ Y+NLLTRIVDFSR CIGE+K+LIGCIGPWGAH+C E
Sbjct: 77  LMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKYLIGCIGPWGAHICRE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTG+YG NPESIDFYQYFKPQLDNFNKND LDL+GFETIPNIHELKAILSWDES+LSKPF
Sbjct: 137 FTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHELKAILSWDESVLSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHEHGVLRDGTTM+ VAKVIKDLGDKINPNF LLGINCVSFNQSPDILESLH+AL
Sbjct: 197 YIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVSFNQSPDILESLHQAL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P+M LLAYPNSGEVYDTEKKIWLPNSDKLNSWD VVK+YI SGARIIGGCCRT+PKDIQE
Sbjct: 257 PDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGARIIGGCCRTSPKDIQE 316

Query: 251 VSAAVKKYT 259
           +  AVKKYT
Sbjct: 317 IFTAVKKYT 325

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  413 bits (1061), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 197/197 (100%), Positives = 197/197 (100%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE
Sbjct: 77  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF
Sbjct: 137 FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL
Sbjct: 197 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 256

Query: 191 PNMPLLAYPNSGEVYDT 207
           PNMPLLAYPNSGEVYDT
Sbjct: 257 PNMPLLAYPNSGEVYDT 273

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  410 bits (1054), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 187/254 (73%), Positives = 221/254 (87%)

Query: 5   KPRKNSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWG 64
           K   N LMTITYQTSF S+ ENT  KTLA Y+ LL RIV FSR CIG+E++LIG +GPWG
Sbjct: 70  KSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDERYLIGSVGPWG 129

Query: 65  AHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDES 124
           AHVCCEFTGNYG +PESID+Y+YFKPQLDNFN  D++DL+GFET+PN HELKAILSWDE+
Sbjct: 130 AHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHELKAILSWDET 189

Query: 125 ILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILE 184
            ++KPFYIGLSVH +GVLRDGTTME + + IK LG+KI+ NFLLLG+NCVSFN S D+++
Sbjct: 190 KIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCVSFNDSSDMVK 249

Query: 185 SLHRALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTT 244
           S+H+ALP+MPLLAYPNSGEVYDTEKKIW  N DKL+SWD+VV+ YI +GARIIGGCCRT+
Sbjct: 250 SIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGARIIGGCCRTS 309

Query: 245 PKDIQEVSAAVKKY 258
           P+DI EVSAAVKKY
Sbjct: 310 PRDIAEVSAAVKKY 323

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 217/250 (86%), Gaps = 1/250 (0%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTSFKSVSENT IKTL  Y+ LL RIV FSRDCIGE+K+LIGCIGPWGAHVC E
Sbjct: 77  LMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKYLIGCIGPWGAHVCAE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           F G+YG +PE+ID+YQYFKPQLDNF  N+ LDL+GFET+PN++ELKAILSWDE ILSKPF
Sbjct: 137 FNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNELKAILSWDEKILSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHE+GVLRDGTTME +  + K LG+K+NPN LLLGINCVSFN SP ILE +H+ L
Sbjct: 197 YIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVSFNHSPSILEDIHKNL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLP-NSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQ 249
           P+MPL+AYPNSGEVYDT KKIWLP NS+   +W+ VVK+YI +GARIIGGCCRTTPKDI 
Sbjct: 257 PDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGARIIGGCCRTTPKDIL 316

Query: 250 EVSAAVKKYT 259
           E+S AVKK++
Sbjct: 317 EISKAVKKFS 326

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/248 (72%), Positives = 216/248 (87%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTSFKSVSENTPIKTL  Y+ LL RIV FSR+CIGE+K+LIGCIG WGAHVCCE
Sbjct: 77  LMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKYLIGCIGAWGAHVCCE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTG+YG NPE IDF +YF+PQL NFN ++++DL+GFETIPN+HELKAILSWDESI+SKPF
Sbjct: 137 FTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHELKAILSWDESIISKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHE+GVLRDGTTM+ VA +IK LGDK+NPN +LLGINCVSFN S  IL SLH+ L
Sbjct: 197 YIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVSFNHSHLILSSLHKEL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P+MP++ YPNSGE+YDT KKIWL N ++  +WD VVK YI +GARIIGGCCRT+P+DI++
Sbjct: 257 PDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGARIIGGCCRTSPQDIKD 316

Query: 251 VSAAVKKY 258
           +  A++KY
Sbjct: 317 IVQAIEKY 324

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  397 bits (1019), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 213/247 (86%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMTITYQTSFKSV+ENTPIKTL  Y+ LL RIV FSR CIG+EK+LIGCIGPWGAHVC E
Sbjct: 77  LMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEKYLIGCIGPWGAHVCAE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           F G+YG +PE+ID+Y YFKPQLDNF +N  LDL+GFET+PN HELKAILSWD++ILSKPF
Sbjct: 137 FNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHELKAILSWDDTILSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHE+GVLRDGTTM  +   IK LG KINPNFLLLGINCVSF+ SPDILES+H+ L
Sbjct: 197 YIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCVSFSDSPDILESIHKEL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P+MPL+AYPNSGE+YDT KKIWLPN     +W+ VV +YI +GARIIGGCCRT P DI++
Sbjct: 257 PDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGARIIGGCCRTMPDDIEQ 316

Query: 251 VSAAVKK 257
           VSAAVKK
Sbjct: 317 VSAAVKK 323

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  396 bits (1018), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/248 (74%), Positives = 208/248 (83%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT+TYQ SFKSVSENT I TL  YD LL+RIV FSR CIG++K L+GCIGPWGAH C E
Sbjct: 79  LMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDKWLVGCIGPWGAHNCSE 138

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTG+YG  PE ID+ QYFKPQLDNF  ND LDL+GFETIPNIHEL+AILSWD +IL KPF
Sbjct: 139 FTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHELRAILSWDTTILPKPF 198

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHEHGVLRDGTTM  VA++IK LGDKINPNF+LLGINCVS+N SP+IL SLH+ +
Sbjct: 199 YIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCVSYNHSPEILRSLHQEI 258

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P +PL+AYPNSGEVYDT KKIW P  D   +WD VVK YI SGARIIGGCCRT+PKDI  
Sbjct: 259 PELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGARIIGGCCRTSPKDIAA 318

Query: 251 VSAAVKKY 258
           ++AAV KY
Sbjct: 319 INAAVNKY 326

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  392 bits (1007), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/248 (72%), Positives = 209/248 (84%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT+TYQ SFKSVSENT IKTL  YD+LL RIV FSR+CIG++K L+GCIG WGAH C E
Sbjct: 79  LMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDDKFLVGCIGAWGAHNCSE 138

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTG+YG  PE IDF QYFKPQLDNF  N+ +DL+GFETIPNIHEL+AILSWDESI++KPF
Sbjct: 139 FTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIHELRAILSWDESIINKPF 198

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHE+G+LRDGTTM  VA++IK  GD++NPNF LLGINCVS+NQS DIL SLH  L
Sbjct: 199 YIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINCVSYNQSHDILRSLHEEL 258

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P MPL+AYPNSGEVYDT KKIW P + +  SW+ +VK YI SGARIIGGCCRT+PKDI+ 
Sbjct: 259 PEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSGARIIGGCCRTSPKDIEA 318

Query: 251 VSAAVKKY 258
           +  AV+KY
Sbjct: 319 IHEAVQKY 326

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 178/247 (72%), Positives = 213/247 (86%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTSFKSVSENTPIK    Y+ LL RI+DFSRDCIGEE++LIGCIG WGAH+C E
Sbjct: 77  LMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEERYLIGCIGSWGAHICAE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           F G+YG +PE+IDFY+YFKPQLDNF  N+KLDL+GFET+PNIHELKAILSWDE ILSKPF
Sbjct: 137 FHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHELKAILSWDEKILSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHE+G+LRDGT+M+ VA +IK  G+K+NPN  LLGINCVS+N S DI++S+H+ L
Sbjct: 197 YIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCVSYNHSNDIIKSIHKEL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           PN+PL+AYPNSGE+YDT KKIWLPN + + +WD +VK YI +G RIIGGCCRTTP DI+ 
Sbjct: 257 PNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGVRIIGGCCRTTPNDIKA 316

Query: 251 VSAAVKK 257
           V+ AVK+
Sbjct: 317 VTIAVKE 323

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  378 bits (971), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/200 (89%), Positives = 192/200 (96%)

Query: 12  MTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCEF 71
           MT TYQTS+KSVSENTPIKTL+ Y+NLLTRIVDFSRDCIGE K+LIGCIGPWGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 72  TGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPFY 131
           TG+YGP+PESIDFY+YFKPQLDNFNKNDKLDL+GFETIPN+HEL+AILSWDESILSKPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 132 IGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRALP 191
           IGLSVHEHGVLRDGTTME VAKVIK LGDKINPNF LLGINCVSFNQSPDILESLH+ALP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 192 NMPLLAYPNSGEVYDTEKKI 211
           +M LLAYPNSGEVYDTEKKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  382 bits (982), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/250 (72%), Positives = 209/250 (83%), Gaps = 1/250 (0%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTSFKSVSENT IKTL  YD LLTRIV+FSRDCIGE K+LIGCIGPWGAH+C E
Sbjct: 77  LMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKYLIGCIGPWGAHICSE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTGNYG +PE ID+Y+YFKPQL NF +ND LD++GFETIPN++ELK ILSW   IL KPF
Sbjct: 137 FTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYELKTILSWGTDILPKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHE+GVLRDGTTM  VA +I  L DK+NPN +LLGINCVS   SPDIL+S+H  L
Sbjct: 197 YIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVSLAHSPDILDSIHSNL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWL-PNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQ 249
           P++PL+ YPNSGEVYDT KKIWL PN +   SWD VV++Y+ +GARIIGGCCRTTP DI+
Sbjct: 257 PDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGARIIGGCCRTTPNDIK 316

Query: 250 EVSAAVKKYT 259
           ++S AV KY+
Sbjct: 317 QISDAVHKYS 326

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  382 bits (981), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 210/249 (84%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMTITYQTSFKSVSENTPI+TL  Y+ LL RIV FSR CIGE+++LIGCIG WGAHVC E
Sbjct: 76  LMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYLIGCIGAWGAHVCSE 135

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTG+YGP+P+ ID+++YF+PQL NF ++  +D++GFETIPNIHEL+AILSWDE++LSKPF
Sbjct: 136 FTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELRAILSWDETVLSKPF 195

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVHE+GVLRDGT+M+ +A +I  LGDK+N N + +GINC +FNQS  ILESLH + 
Sbjct: 196 YIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAFNQSHMILESLHNSC 255

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           PNMPL+ YPNSGE+YDT KKIWL N ++L +WD VVK YI +GARIIGGCCRTT  DI+E
Sbjct: 256 PNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARIIGGCCRTTVDDIKE 315

Query: 251 VSAAVKKYT 259
           V  AV KY 
Sbjct: 316 VRLAVNKYA 324

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  376 bits (966), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/200 (88%), Positives = 192/200 (96%)

Query: 12  MTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCEF 71
           MT TYQTS+KSVSENTPIKTL+ Y+NLLTRIVDFSR CIGE+K+LIGCIGPWGAH+CCEF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 72  TGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPFY 131
           TG+YGP+P+SIDFY+YFKPQLDNFNK+DKLDL+GFETIPN+HEL+AILSWDESILSKPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 132 IGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRALP 191
           IGLSVHEHGVLRDGTTME VAKVIK LGDKINPNF LLGINCVSFNQSPDILESLH+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 192 NMPLLAYPNSGEVYDTEKKI 211
           NM LLAYPNSGEVYDTEKKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  381 bits (978), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 176/238 (73%), Positives = 203/238 (85%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTSFKSVSENTPI+ L  Y +LL RIV FSRDCIG +K+LIGCIGPWGAHVC E
Sbjct: 77  LMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDKYLIGCIGPWGAHVCAE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           F G+YGPNP  ID+  YFKPQLDNF  ND LDL+GFETIPNIHEL+AILSWDE+ILSKPF
Sbjct: 137 FNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHELRAILSWDETILSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YIGLSVH +G+LRDG+TM+ VA +IK  G K+N N  LLGINCVSF+ SPDILES+H+ L
Sbjct: 197 YIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCVSFSDSPDILESIHKEL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248
           P+MPL+AYPNSGEVYDT KKIWLPN D + +W+ VV +YI +GARI+GGCCRT+PKDI
Sbjct: 257 PDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGARIVGGCCRTSPKDI 314

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  367 bits (943), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 169/250 (67%), Positives = 202/250 (80%)

Query: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68
           N LMTITYQ+SFKSVSENT IKTL  Y+ LL RIV FSR CIG + +L+GCIG WGAH+C
Sbjct: 75  NLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNYLVGCIGSWGAHIC 134

Query: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128
            EF+G+YG +PE I +  YF+PQL+NFN  + +D++GFETIPNIHEL AILSWDESI+ K
Sbjct: 135 AEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHELTAILSWDESIIKK 194

Query: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188
           PFYIG+SVHEHG LRDGTTM  VA++ + LG K+NPNFL LGINC SF  S  ILESLH 
Sbjct: 195 PFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCSFRYSHMILESLHE 254

Query: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248
            LP +PL+AYPNSGE+YDT KKIWL N + + +WD +VK Y+ SGARIIGGCCRTTP DI
Sbjct: 255 ELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGARIIGGCCRTTPNDI 314

Query: 249 QEVSAAVKKY 258
           +++  AVKKY
Sbjct: 315 RQIVTAVKKY 324

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  366 bits (939), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 163/251 (64%), Positives = 209/251 (83%)

Query: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68
           N LMT+TYQ +F S+SENT IKTL+ Y+  L R+V F+R  IGE+++LIG IGPW AHV 
Sbjct: 74  NVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDRYLIGSIGPWAAHVS 133

Query: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128
            E+TG+YG +PE ID+ Q+FK QLDNFNK+ ++DL+GFET+PN HELKAILSWDE+I+SK
Sbjct: 134 SEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHELKAILSWDENIISK 193

Query: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188
           PFY+GLSVH++G+LRDGTTME +A  +K LG KIN +FLLLG+NC+SFNQS  IL+SLH+
Sbjct: 194 PFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCISFNQSTSILKSLHQ 253

Query: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248
           ALP+MPLLAYPNSGEVYDT+ K W     K NSW+ VV+++I +GARIIGGCCRT+ KDI
Sbjct: 254 ALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGARIIGGCCRTSAKDI 313

Query: 249 QEVSAAVKKYT 259
            E+++AV K++
Sbjct: 314 SEIASAVDKHS 324

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  363 bits (931), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 207/251 (82%)

Query: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68
           N LMTITYQ +FKS+S+NT IKTL AY   L +IV FSR  IGEE++LIG IGPW AHV 
Sbjct: 74  NVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEERYLIGSIGPWAAHVS 133

Query: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128
            E+TGNYGP+PE ID+Y++F+PQLD FN+N+ +DL+GFETIPN HELKAILSW E I+S+
Sbjct: 134 SEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHELKAILSWGEDIISR 193

Query: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188
           PFY+GLSVH++G+LRDGTT+E ++  IK LG KIN NFLLLG+NC+SFNQS  IL++LH 
Sbjct: 194 PFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCISFNQSTLILKALHE 253

Query: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248
            LP+ PLL YPNSGE+YD ++K W   +DKL+SWD  V+++I SGARIIGGCCRT+PKDI
Sbjct: 254 VLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGARIIGGCCRTSPKDI 313

Query: 249 QEVSAAVKKYT 259
            E++A+V  Y+
Sbjct: 314 AEIAASVDTYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  359 bits (921), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 162/250 (64%), Positives = 204/250 (81%)

Query: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68
           N LMTITYQ +FKS+SENT I+TL+AY+  L RIV F+R  IGEE++L+G IGPW AHV 
Sbjct: 74  NVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEERYLVGSIGPWAAHVS 133

Query: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128
            E+TGNYGP+PE ID+Y +FKPQLD+FN+N  +DL+GFET+PN HELKAILSW E I+SK
Sbjct: 134 SEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHELKAILSWGEDIISK 193

Query: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188
           PFY+GLSVH++G+LRDGTTME V+  IK LG +IN + LL+G+NC+SFN+S  IL +LH 
Sbjct: 194 PFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCISFNRSTLILRTLHE 253

Query: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248
           +LP+ PLL YPNSGEVYD ++K W   +DK  SWD  VK +I SGARIIGGCCRT+PKDI
Sbjct: 254 SLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGARIIGGCCRTSPKDI 313

Query: 249 QEVSAAVKKY 258
            E++ AV++Y
Sbjct: 314 AEIATAVRRY 323

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  359 bits (922), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 161/249 (64%), Positives = 206/249 (82%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT+TYQ SFK+++ENT ++TL+ Y++LL RIV FSR CIG+E++L+G +GPW A+   E
Sbjct: 76  LMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDERYLVGSVGPWAAYNASE 135

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           +TG+YG + +SID+Y Y+KPQLDNFNK +++D++G ET+PN HELKAILSWDE  ++KPF
Sbjct: 136 YTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHELKAILSWDEKKIAKPF 195

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           Y+ L+ H+ GVLRDGT ME +A+ IK LG+ +NPNF+LLGINCVSFN S DILE LH AL
Sbjct: 196 YVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCVSFNDSRDILELLHNAL 255

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P M LLAYPNSGEVY+ +KKIWL N  K  SWD+VVK +I SGARIIGGCCRT+P+DI +
Sbjct: 256 PEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGARIIGGCCRTSPQDIAD 315

Query: 251 VSAAVKKYT 259
           VS AVKKY+
Sbjct: 316 VSIAVKKYS 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  359 bits (921), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 163/251 (64%), Positives = 209/251 (83%)

Query: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68
           N LMTITYQ +F+S+SENT IKTLAAY   L +IV F+R+ IGEE++LIG IGPW AHV 
Sbjct: 74  NILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERYLIGSIGPWAAHVS 133

Query: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128
           CE+TG+YGP+PE+ID+Y +FKPQL+NFN+N  +DL+GFETIPN HELKAILSWDE I+SK
Sbjct: 134 CEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHELKAILSWDEDIISK 193

Query: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188
           PFYIGLSV ++ +LRDGTT+E ++  IK LG+KIN N LL+G+NCVSFNQS  IL+ LH 
Sbjct: 194 PFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVSFNQSALILKMLHE 253

Query: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248
            LP MPLL YPNSGE+Y+ ++K W   ++KL+ W+T VK+++ +GARIIGGCCRT+PKDI
Sbjct: 254 HLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGARIIGGCCRTSPKDI 313

Query: 249 QEVSAAVKKYT 259
            E+++AV KY+
Sbjct: 314 AEIASAVDKYS 324

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  315 bits (806), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 190/249 (76%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           LMT TYQTSFK+VSE+T +K+L  Y+ LL +IV F+R CIG+ ++LIG IG +GA V  E
Sbjct: 77  LMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNRYLIGSIGSYGALVGGE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           ++G+YG +PE++DFY YFKPQLDNF  ND++D++GFETI N  ELK++LSWDE  +SKPF
Sbjct: 137 YSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTELKSLLSWDEKKVSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YI LSVH++G LRDGT M  +   IK L   INPN   LG+NCV++N++ +I++S+H  L
Sbjct: 197 YISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCVNYNKATEIIDSIHNGL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P MPL  +PNSGEV++ EK IW  N +   SW+ VVK++I SG RI+GGCCRT P DI++
Sbjct: 257 PTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGVRIVGGCCRTRPHDIEQ 316

Query: 251 VSAAVKKYT 259
           +S AVKK +
Sbjct: 317 ISKAVKKLS 325

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  308 bits (789), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           +MTITYQ SF SV+ NT I TL  Y+ LL RIV F R+ +G++K+L+G IG WGAHVC E
Sbjct: 77  IMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           FTG+YGP P+ ID+  YFKPQLDNFN    LDL+GFETIPN HEL+AILSWDES+++KPF
Sbjct: 137 FTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           Y+ LSVH+ G LRDGT M      I      +NPNFL LGINC S +++P IL  LH  L
Sbjct: 197 YVALSVHDAGTLRDGTPMA-DVAAIVAAAAPLNPNFLGLGINCSSLSRTPAILAELHALL 255

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P +P+  YPNSGE+YD  KK+W   S  +  W  VV  YI SGARIIGGCCRT P DI++
Sbjct: 256 PALPMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGARIIGGCCRTIPNDIRQ 314

Query: 251 VSAAVKKYT 259
           ++ AV+ + 
Sbjct: 315 IADAVRTHA 323

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  297 bits (761), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 183/249 (73%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           L T TYQTSF S+SENT I+TL  Y  LL RI  F+R+CIG+ K+L+G IG + A++  E
Sbjct: 77  LSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSKYLVGSIGTYAAYLSAE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           +TG++G   ++ID++ YFKPQLDNFN++ ++D++GFETIPNIHEL+AILS ++  LSKPF
Sbjct: 137 YTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHELRAILSLNKKDLSKPF 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           YI LS +    LRDGT+++GV  VIK     +NPN +LLGINC+  N S   +E L+  L
Sbjct: 197 YISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCIGLNSSHLTMEYLNNHL 256

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P  PL+ YPNSGE YD  +KIWL + D   +W+ +V +Y+ +GARI+GGCCRTTP DI+ 
Sbjct: 257 PQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGARIVGGCCRTTPSDIRS 316

Query: 251 VSAAVKKYT 259
           +S A+K YT
Sbjct: 317 ISEAIKCYT 325

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  268 bits (686), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 187/248 (75%), Gaps = 2/248 (0%)

Query: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68
            +LM+ITYQ SF ++S NT I+ L  Y+ LL +IV F R+CIG  K+LIG IGP+ +HV 
Sbjct: 75  QALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVS 134

Query: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128
            E+TG+YG +PE++D+  YFKPQLDNFN ND +DL+  ET+PN +ELKA+LSWD + + K
Sbjct: 135 AEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYELKALLSWDGTTIKK 194

Query: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188
           PFYI LSV + G LRDGT+M+ ++ + ++   K NPN +++G+NCVS++++  I++ L  
Sbjct: 195 PFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQI 253

Query: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSD-KLNSWDTVVKQYIGSGARIIGGCCRTTPKD 247
           A+P++PL+ YPNSGEVYD   + W  N+D KL+SW+T+VK  + +G R++GGCCRTTP D
Sbjct: 254 AVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTTPDD 313

Query: 248 IQEVSAAV 255
           I +++ AV
Sbjct: 314 IHKIAQAV 321

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  265 bits (678), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 177/253 (69%), Gaps = 10/253 (3%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           L T+TYQTS+K++  +T I T   YD LL RIV F R CIG++ +L+G IGP+ AHV  E
Sbjct: 76  LSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHVGAE 135

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           +TG+YGP PE ID++QYF+PQ+ NFN+N+ +D++G ET+PN+HELK+ILSWDE+ +SKPF
Sbjct: 136 YTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKISKPF 195

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           Y+ L V + G LRDGT +E   +++    ++ N N LL+GINC S + S   L  L+  L
Sbjct: 196 YVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCSLSVSSQALSHLNEIL 252

Query: 191 PNMP--LLAYPNSGEVYDTEKKIWLP----NSDKLNSWDTVVKQYIGSGARIIGGCCRTT 244
            + P  LL YPNSGE+YD + + W      +S +L SW ++V++Y   GAR IGGCCRTT
Sbjct: 253 ASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRL-SWPSLVQEYRKFGARAIGGCCRTT 311

Query: 245 PKDIQEVSAAVKK 257
           P DIQE+   V +
Sbjct: 312 PLDIQEICKVVDR 324

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  261 bits (668), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 172/247 (69%), Gaps = 2/247 (0%)

Query: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70
           L TITYQTSF  +S +T +KT+  Y  L+  I  F R  IGE+ +LIG IGP+GA +  E
Sbjct: 77  LSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNYLIGSIGPFGARLGAE 136

Query: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130
           +TGNYG +P +I++ +YFKPQL+ FN ND +D++GFET+PN +EL+AILSWD+S++SKP+
Sbjct: 137 YTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYELEAILSWDKSVISKPY 196

Query: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190
           Y+ LS+ ++G LRDGT+ E +A + K   +  N N +L G NC+SF  + + +  LH+A+
Sbjct: 197 YVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCISFKYASENISKLHQAI 254

Query: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250
           P +PL+ YPNSGE+YD   K W  +     +W+ ++K+   S  RI+GGCCRTTP DI +
Sbjct: 255 PTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRIVGGCCRTTPDDINK 314

Query: 251 VSAAVKK 257
           +   + K
Sbjct: 315 IKDMITK 321

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  258 bits (658), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 167/247 (67%), Gaps = 1/247 (0%)

Query: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68
           N   T+TYQTSF SVSENT IK+L  Y  LL +I  F R CI ++ +L+GCIG + A + 
Sbjct: 75  NVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDYLLGCIGAYAASIG 134

Query: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128
            E+ GNYG     ID+ +YFKPQLD FN +  +D++GFETIPN HEL+AILSWDE I+++
Sbjct: 135 AEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHELEAILSWDEDIINR 194

Query: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188
           PF+I LS+ +   LRDGT+ E + ++      + N N + +G NC+S+  S D +  LH 
Sbjct: 195 PFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCISYAYSIDNIRKLHD 253

Query: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248
            +P++ L+AYPNSGE+YD + K W   S    SW+ VV +Y  +G +IIGGCCRTTP DI
Sbjct: 254 IVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVKIIGGCCRTTPDDI 313

Query: 249 QEVSAAV 255
           +++  AV
Sbjct: 314 KQIKKAV 320

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  217 bits (553), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 167/261 (63%), Gaps = 15/261 (5%)

Query: 10  SLMTITYQTSFKSVSE--NTPIKTLAAYDNLLTRIVDFSRD-CIGEEKHLIGCIGPWGAH 66
           +L TITYQ SF ++ +  +  + T   Y   L  I+ F+RD CI + ++LIGC+GP+ A+
Sbjct: 67  ALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCISDSQYLIGCVGPYAAY 126

Query: 67  VC--CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDES 124
           +C   E++G+YG   E IDF QYFKPQLD F+++D++D++GFETIPNI ELK +LS D +
Sbjct: 127 LCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETIPNIEELKTLLSKDFT 184

Query: 125 IL--SKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDI 182
            +  +KPFYI +S   +G LRDGT +  + + IKD      PN L LGINCV ++ S +I
Sbjct: 185 SMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLLFLGINCVDYHHSYNI 244

Query: 183 LESLHRALPNMPLL----AYPNSGEVYDTEKKIWLPNSDKLN--SWDTVVKQYIGSGARI 236
           L  L+  L +   L     YPNSGE+YD     W  NS+     +W+ +V ++     ++
Sbjct: 245 LSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELTWNYLVSKFAEQKCQL 304

Query: 237 IGGCCRTTPKDIQEVSAAVKK 257
           IGGCCRTTP DI++++ AV K
Sbjct: 305 IGGCCRTTPDDIKQIADAVNK 325

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  202 bits (513), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 99/105 (94%)

Query: 155 IKDLGDKINPNFLLLGINCVSFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWLP 214
           + DLGDKINPN   LGINCVSFNQSPDILESLH+ALPNM LLAYPNSGEVYDTEKKIWLP
Sbjct: 1   MMDLGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP 60

Query: 215 NSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQEVSAAVKKYT 259
           NSDKLNSWDTVVKQYI SGARIIGGCCRT+PKDIQE+SAAVKKYT
Sbjct: 61  NSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKYT 105

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  184 bits (468), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 155/254 (61%), Gaps = 13/254 (5%)

Query: 13  TITYQTSFKS-VSENTPIKTLAAYDNLLTRIVDFS-RDCIGEEK-HLIGCIGPWGAHVC- 68
           T+TYQ SF S V  +  + + A Y+  L ++VDF+ R+C+   + ++IG +GP+ A +C 
Sbjct: 115 TLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYIIGSVGPYAAFLCN 174

Query: 69  -CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESIL- 126
             E+TG+YG   E+I+F+ YF+PQ+  F  + ++D + FET+PN+ EL A+L  +   L 
Sbjct: 175 GAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVELMAMLQPEFHALL 232

Query: 127 -SKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILES 185
            +KPFYI +S  +  VLRDGT +  V ++I++  D + PN L  G+NCV   +S  +L  
Sbjct: 233 KNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLNCVDLTRSAAMLAE 292

Query: 186 LHRALPNMPL---LAYPNSGEVYDTEKKIWLPNSDKLN-SWDTVVKQYIGSGARIIGGCC 241
           L+  L + P+     YPN   V+D     W P+ D  + +W   VK Y+    R+IGGCC
Sbjct: 293 LNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVKLYLNQDCRMIGGCC 352

Query: 242 RTTPKDIQEVSAAV 255
            TTP+D+++++ A+
Sbjct: 353 GTTPQDMRQIAEAL 366

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  180 bits (457), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 156/263 (59%), Gaps = 18/263 (6%)

Query: 9   NSLMTITYQTSFKSVSENTP--IKTLAAYDNLLTRIVDFSRD-CIGEEKHLIGCIGPWGA 65
           N+LMTITYQ SF S+  ++   I     Y   L  ++D++ + CI    +L+G +GP+ A
Sbjct: 65  NALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPNSYLVGSVGPYAA 124

Query: 66  HVC--CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDE 123
           ++    E++G+Y    ++IDF ++F+PQ+ +F  + ++DL+G ETIPN  E KA+L  + 
Sbjct: 125 YLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETIPNFEEFKALLRPEF 182

Query: 124 SILS--KPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPD 181
           S L   KP+YI ++    G LRDGT  + + + IK     + PN +  GINCVSF    D
Sbjct: 183 SRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFFGINCVSFAHCAD 242

Query: 182 ILESLHRALPNMPL-------LAYPNSGEVYDTEKKIWLPNSD--KLNSWDTVVKQYIGS 232
           IL+ L+ +L ++ +         YPNSGEVY  +   W PN +    ++W+ +  + +  
Sbjct: 243 ILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPADTWENLASKVVQQ 302

Query: 233 GARIIGGCCRTTPKDIQEVSAAV 255
           G  +IGGCCRT+P D++++++ V
Sbjct: 303 GCLMIGGCCRTSPADLRQIASVV 325

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  164 bits (416), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 150/265 (56%), Gaps = 18/265 (6%)

Query: 9   NSLMTITYQTSFKSVSENTP--IKTLAAYDNLLTRIVDFS-RDCIGEEKHLIGCIGPWGA 65
           N+LMTITYQ SF S+ + +   + +   Y   L  ++ F+ R+CI  +K+L+G +GP+  
Sbjct: 65  NALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPDKYLVGSVGPYAG 124

Query: 66  HVC--CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDE 123
            +    E++G YG     IDF  Y+ PQ+ +F  + ++DL+G ETIPNI E KA+LS + 
Sbjct: 125 LLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETIPNIDEFKALLSPEF 182

Query: 124 SILS--KPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPD 181
           S LS  KP+YI ++   +G LRDGT++  + + IK     +  NF+   INCV F    +
Sbjct: 183 SRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFFAINCVEFLHCVE 242

Query: 182 ILESLHRALPNMPL-------LAYPNSGEVYDTEKKIWL--PNSDKLNSWDTVVKQYIGS 232
           IL+SL+  L    +        AYPNSGE+Y      W   P +   ++W+ +    +  
Sbjct: 243 ILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPEDTWENLTLGLLSQ 302

Query: 233 GARIIGGCCRTTPKDIQEVSAAVKK 257
              ++GGCCRT  ++I++++   KK
Sbjct: 303 ECLMLGGCCRTGSEEIRQMALTTKK 327

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score = 39.3 bits (90), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 19/20 (95%)

Query: 11 LMTITYQTSFKSVSENTPIK 30
          LMT TYQTS+KSVSENTPIK
Sbjct: 77 LMTTTYQTSYKSVSENTPIK 96

>SAKL0A04202g Chr1 complement(392142..394007) [1866 bp, 621 aa] {ON}
           similar to uniprot|P38688 Saccharomyces cerevisiae
           YPL210C SRP72 Component of the signal recognition
           particle (SRP) ribonucleoprotein (RNP) complex that
           functions in protein targeting to the endoplasmic
           reticulum (ER) membrane
          Length = 621

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 83/187 (44%), Gaps = 37/187 (19%)

Query: 66  HVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDL-----LGFETIPN--------I 112
           HV  +F    G   E++  YQY     ++ + +++L+L     + F ++PN        +
Sbjct: 123 HVKAQFCLKTGQYEEAVQIYQYLSSH-NSHSHDNELELSCNERVPFSSLPNTNYKLVTQL 181

Query: 113 HELKAILSWDESIL--SKPFY---IGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFL 167
           +E    L ++ES++  +K  Y   +GL      +  D    EG  + IK +  +I     
Sbjct: 182 NEESYDLLFNESMILTAKGCYDDSLGLLTKARSLAID----EGFEEDIKAISLQIAYVNQ 237

Query: 168 LLGINCVSFNQSPDILESLHRALP---NMPLLAYPNSGEVYDTEK-----KIWLP--NSD 217
           L+G N V    S DIL+ L   LP    M LLA  N    +D  K      + L   N++
Sbjct: 238 LMGNNAV----SKDILKKLVENLPPGSPMYLLAVNNLKSFFDLSKFTTNFSLLLRELNAE 293

Query: 218 KLNSWDT 224
           KLNS + 
Sbjct: 294 KLNSLNV 300

>TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {ON}
           Anc_1.386 YLR173W
          Length = 594

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 22/50 (44%)

Query: 193 MPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCR 242
           + LL  PN+  + D  KKIW  + D LN W  +  +       + G   R
Sbjct: 186 ITLLLKPNTKNIVDVLKKIWKKDYDHLNIWSDMSLKLSKKSYLLFGANLR 235

>Skud_12.169 Chr12 (324942..325988) [1047 bp, 348 aa] {ON} YLR100W
           (REAL)
          Length = 348

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 107 ETIPNIHELKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNF 166
           + +P + + KA + W  SI+S P Y  LS+++  +L+   + EG  +++  L      + 
Sbjct: 164 KILPQLSKGKAYIVWVSSIMSDPKY--LSLNDIELLKSDASYEGSKRLVDLLHLATYKDL 221

Query: 167 LLLGIN 172
             LGIN
Sbjct: 222 KKLGIN 227

>NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON}
           Anc_8.858
          Length = 571

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 50  IGEEKHLIGCIGPWGAHVCCEFTGNYGPN 78
           IG   H IG  G  G ++ C+F  N+GPN
Sbjct: 419 IGFAYHKIGDKGLLGLYIVCQFFQNFGPN 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,409,457
Number of extensions: 1470270
Number of successful extensions: 3818
Number of sequences better than 10.0: 44
Number of HSP's gapped: 3873
Number of HSP's successfully gapped: 44
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)