Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.3142.152ON64464430000.0
Skud_8.1782.152ON63864424890.0
YHR117W (TOM71)2.152ON63964424150.0
Smik_8.1952.152ON63564423950.0
ZYRO0G06512g2.152ON60453916140.0
TDEL0B051402.152ON59953915950.0
NCAS0B070102.152ON62554015770.0
SAKL0E10956g2.152ON60053915700.0
Kpol_1048.212.152ON59753915690.0
CAGL0L12936g2.152ON60053715570.0
Kwal_33.147672.152ON59453915520.0
KLTH0B05170g2.152ON59353915230.0
KNAG0H035302.152ON61454615180.0
Skud_14.2112.152ON61755614830.0
Smik_14.2072.152ON61755914720.0
TBLA0C055302.152ON61053814710.0
YNL121C (TOM70)2.152ON61755614710.0
Suva_14.2192.152ON61755614670.0
KAFR0F007202.152ON60854014560.0
TPHA0I015102.152ON60354114540.0
Ecym_82042.152ON59753914420.0
ABR131W2.152ON59453914060.0
KLLA0F24046g2.152ON60454013870.0
NDAI0B043402.152ON66455013621e-180
NCAS0G024802.152ON59653513531e-180
NDAI0F028102.152ON60953712841e-169
CAGL0L04048g2.152ON58754012551e-165
Ecym_30256.21ON3181841614e-11
Ecym_44133.481ON5101871483e-09
NCAS0G008105.617ON584901432e-08
Kpol_505.413.481ON5131511412e-08
NDAI0B057903.481ON5231501403e-08
Suva_8.805.617ON586901403e-08
SAKL0G07084g5.617ON585901403e-08
ACR005W6.21ON3271201383e-08
TBLA0E033005.617ON582901351e-07
KLTH0F14542g3.481ON513951332e-07
AEL224W5.617ON580901332e-07
SAKL0E01210g6.21ON3231041312e-07
NDAI0F009105.617ON583891332e-07
Kpol_1032.86.21ON3431061312e-07
KAFR0L004106.21ON3311011303e-07
Kwal_55.199355.617ON593901314e-07
KLLA0A07062g5.617ON581901314e-07
KLLA0D01155g6.21ON335681294e-07
TPHA0J003406.21ON3381061286e-07
KNAG0A079003.481ON5121571288e-07
AAR083C3.481ON5381661289e-07
KAFR0B066103.481ON511951271e-06
NCAS0H008306.21ON3381041251e-06
CAGL0D05060g3.481ON510951262e-06
SAKL0F03102g3.481ON513951242e-06
YOR027W (STI1)5.617ON589901243e-06
Smik_15.2055.617ON589901234e-06
CAGL0H08195g5.617ON583901224e-06
TPHA0D028805.617ON585891225e-06
Suva_7.4083.481ON513981215e-06
NCAS0F034903.481ON5121501207e-06
TDEL0G044806.21ON3431061198e-06
TPHA0D038606.328ON120731109e-06
Ecym_55825.617ON584901191e-05
KLLA0B10912g3.481ON512951181e-05
Skud_15.1925.617ON589921181e-05
KNAG0B032005.617ON579901181e-05
Kwal_56.224336.21ON3221311162e-05
YGR123C (PPT1)3.481ON513981172e-05
TBLA0A072706.21ON373901162e-05
Kwal_55.211753.481ON511951172e-05
Smik_6.2153.481ON513971163e-05
CAGL0E02739g6.21ON343791143e-05
TPHA0D032203.481ON5131061153e-05
Kpol_1037.266.21ON342981133e-05
TBLA0I023106.328ON116621054e-05
KNAG0M011706.21ON3391061134e-05
TBLA0C039503.481ON512971144e-05
TBLA0G010506.21ON350761134e-05
NDAI0D008106.21ON3491041134e-05
TDEL0D055003.481ON5121001136e-05
ZYRO0A05676g5.617ON572901119e-05
Kpol_1018.695.617ON590901111e-04
Kpol_1018.1067.412ON7532331111e-04
SAKL0A01672g6.328ON128681021e-04
ZYRO0B04224g3.481ON513971092e-04
KAFR0C058905.617ON575901082e-04
Skud_7.4323.481ON513951072e-04
TDEL0A048405.617ON576901082e-04
NDAI0I004406.328ON128671002e-04
KLLA0B09966g8.506ON370941063e-04
NCAS0A153007.546ON1398721073e-04
ZYRO0F08624g8.506ON3791201054e-04
Smik_2.2958.506ON3851411054e-04
TPHA0M002706.21ON377931045e-04
KLTH0E02178g5.617ON593901046e-04
KNAG0I025206.328ON11789966e-04
Smik_4.4918.470ON612891046e-04
YDR244W (PEX5)8.470ON612881047e-04
KLLA0C15455g8.470ON566921047e-04
Suva_16.5217.546ON1424721048e-04
Suva_15.1826.21ON3461061029e-04
CAGL0G10087g7.546ON14111111030.001
YBR155W (CNS1)8.506ON3851151010.001
Suva_3.956.328ON11170930.001
NCAS0A112003.367ON9071281020.001
ZYRO0C07788g6.21ON3341011000.001
KAFR0B002507.546ON1420641020.001
KLTH0C11220g6.21ON327129990.002
KAFR0J025706.328ON12138930.002
Ecym_20906.328ON17262950.002
TPHA0E007407.412ON7461701000.002
TBLA0B049907.546ON1410821000.002
Smik_16.4537.546ON1417721000.003
Suva_2.4108.470ON61189990.003
Skud_4.5068.470ON61189990.003
Skud_2.2828.506ON38593980.003
ZYRO0C16522g3.367ON97488990.003
KLLA0C08910g6.328ON11544910.003
Kpol_513.28.506ON374108970.003
TDEL0H002507.546ON1397104980.004
Kpol_1050.1127.546ON136072970.005
Skud_16.4937.546ON142572970.005
Skud_15.1686.21ON348104950.007
YOR007C (SGT2)6.21ON346106950.007
YPR189W (SKI3)7.546ON143272960.008
KNAG0H006103.367ON973128950.008
TBLA0H033808.506ON37592940.009
NDAI0J001307.546ON140381950.009
TDEL0A074306.328ON12444880.010
NDAI0I022406.21ON350105930.010
Kwal_27.107407.412ON628245940.011
Suva_4.4058.506ON38579920.014
ABR206W5.72ON614106930.014
KLTH0A00638g7.546ON1411121930.014
NDAI0C001602.665ON77889930.015
Kwal_27.118908.506ON334129910.016
Kwal_23.54087.546ON1410102930.016
TDEL0B013108.506ON380125920.016
Smik_15.1766.21ON345106910.018
Ecym_50925.72ON62696920.018
CAGL0K11209g8.470ON59096920.018
TPHA0M016303.367ON1043120920.018
TBLA0A016908.470ON662114920.019
AAR054C6.328ON13373860.021
TDEL0C050903.367ON75990920.021
NDAI0A051003.367ON1007128920.022
NDAI0E040407.412ON783229910.022
Kpol_1028.516.328ON11761840.025
TPHA0A052905.72ON66693910.027
KAFR0H008703.367ON88788910.029
KNAG0A039508.506ON38693890.030
CAGL0D01364g3.367ON1148128900.032
NCAS0D026706.21ON351129890.033
NCAS0B024008.506ON38092890.035
Suva_4.3613.367ON96388900.038
YBR112C (CYC8)3.367ON96688900.039
Smik_2.2543.367ON102088900.039
YCR060W (TAH1)6.328ON11158820.044
Ecym_71427.412ON675228880.054
Kpol_172.23.367ON41877870.056
CAGL0H07425g8.506ON38094870.058
Kpol_1006.43.367ON732122880.061
CAGL0K09240g6.328ON14272830.062
Ecym_28207.546ON139879880.066
KNAG0B022407.412ON739175870.069
Skud_2.2403.367ON98488870.070
Kpol_1031.648.470ON60788870.072
TDEL0B016608.470ON54996870.073
KNAG0A041208.470ON60282870.075
SAKL0F16236g7.546ON1408519870.081
KLTH0C06204g7.412ON627155860.086
Skud_3.1356.328ON11869800.087
NCAS0A00490singletonON62072860.098
TDEL0C027207.412ON700165860.10
NDAI0J007107.458ON33553840.12
KAFR0E029808.506ON38093840.12
NCAS0B025608.470ON57882850.12
KLLA0B09262g3.367ON941128850.12
NDAI0C033505.72ON64967850.13
CAGL0C01903g7.412ON769187840.15
Kpol_1050.825.72ON63965840.16
TBLA0D004607.412ON835262840.17
KLTH0H00704g5.72ON621160840.17
NCAS0E024907.412ON80981840.17
KLTH0E11748g8.506ON37892830.19
SAKL0F12936g7.412ON632134830.23
Suva_2.347.412ON763193830.23
Ecym_34593.367ON1115109830.25
AEL281C7.546ON139082820.28
NDAI0C051308.470ON59077820.29
KLTH0E10934g8.470ON56889820.31
KAFR0D023405.689ON69766820.33
KNAG0H001602.665ON78092810.34
Smik_2.367.412ON751193810.36
AFR453W8.470ON569144810.36
Skud_8.2305.72ON62669810.38
TDEL0E027505.352ON564125810.39
Kwal_23.36703.367ON80290810.40
KLLA0B03520g7.546ON140198810.40
NCAS0D045006.328ON12171750.41
Smik_8.2505.72ON62669810.42
Suva_15.3665.72ON62669800.43
Smik_11.2622.517ON182160780.44
TBLA0F012303.367ON118990810.46
YHR166C (CDC23)5.72ON62669800.49
ZYRO0D00836g7.546ON1401112800.52
NDAI0G037103.5ON112199800.52
KLLA0A05258g5.72ON63294800.55
TPHA0E011105.352ON69372790.62
SAKL0H02244g5.72ON62896790.68
TBLA0B079705.72ON68765790.68
TPHA0L014208.506ON374141780.72
AGL294W7.412ON656183790.74
KLLA0E20857g7.412ON710101790.75
TDEL0G009605.72ON62267780.76
KLTH0F10428g3.367ON79590780.80
ADL344W3.367ON91069780.81
KNAG0B027207.322ON1204102790.81
KAFR0C038202.665ON70474780.81
CAGL0I02288g5.72ON63967780.82
KAFR0L018707.412ON71277780.93
Ecym_13968.470ON57378780.94
Kwal_56.247505.72ON61967771.0
Kwal_27.117378.470ON57589771.1
KNAG0F040107.546ON141871771.1
Smik_3.1596.328ON11567721.1
SAKL0B07986g3.367ON88069771.2
ZYRO0A02926g8.470ON577101771.2
ZYRO0B03828g7.412ON727249761.4
SAKL0H11946g8.470ON57389761.5
TPHA0L012108.470ON58878751.7
KLTH0B04466g2.627ON65450752.1
ACR168W2.665ON70797752.1
YBL084C (CDC27)7.412ON758171752.3
TDEL0B023305.689ON70235742.3
KAFR0C018505.352ON646159742.4
CAGL0L09823g2.665ON74364742.5
Kpol_1057.142.665ON72460742.5
ZYRO0D00572g2.665ON78556742.8
AGR398W3.5ON1057190733.6
SAKL0G19712g2.665ON721209733.6
ZYRO0E01254g2.627ON65237733.8
TBLA0H015203.367ON68983733.8
Ecym_56372.665ON71797733.9
KAFR0B060308.372ON238152714.0
KLTH0D17512g4.370ON1429206734.0
NCAS0D013905.72ON63197724.6
CAGL0A03630g1.88ON106250724.6
Smik_4.5795.352ON667112715.1
NCAS0F028705.352ON70071715.2
ZYRO0C11594g5.72ON62867715.5
Suva_8.1295.689ON74135715.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.314
         (644 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...  1160   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   963   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   934   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   927   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   626   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   619   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   612   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   609   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   608   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   604   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   602   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   591   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   589   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   575   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   571   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   571   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   571   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   569   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   565   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   564   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   560   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   546   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   538   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   529   e-180
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   525   e-180
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   499   e-169
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   488   e-165
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    67   4e-11
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    62   3e-09
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    60   2e-08
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    59   2e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    59   3e-08
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    59   3e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    59   3e-08
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    58   3e-08
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    57   1e-07
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    56   2e-07
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    56   2e-07
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    55   2e-07
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     56   2e-07
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    55   2e-07
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    55   3e-07
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    55   4e-07
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    55   4e-07
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    54   4e-07
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    54   6e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    54   8e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    54   9e-07
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    54   1e-06
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    53   1e-06
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    53   2e-06
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    52   2e-06
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    52   3e-06
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    52   4e-06
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    52   4e-06
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    52   5e-06
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    51   5e-06
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    51   7e-06
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    50   8e-06
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    47   9e-06
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    50   1e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    50   1e-05
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    50   1e-05
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    50   1e-05
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    49   2e-05
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    50   2e-05
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    49   2e-05
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    50   2e-05
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    49   3e-05
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    49   3e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    49   3e-05
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    48   3e-05
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    45   4e-05
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    48   4e-05
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    49   4e-05
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    48   4e-05
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    48   4e-05
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    48   6e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    47   9e-05
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    47   1e-04
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    47   1e-04
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    44   1e-04
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    47   2e-04
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    46   2e-04
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    46   2e-04
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    46   2e-04
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    43   2e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    45   3e-04
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            46   3e-04
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    45   4e-04
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    45   4e-04
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    45   5e-04
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    45   6e-04
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    42   6e-04
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    45   6e-04
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    45   7e-04
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    45   7e-04
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    45   8e-04
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    44   9e-04
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    44   0.001
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    44   0.001
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    40   0.001
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    44   0.001
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    43   0.001
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    44   0.001
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    43   0.002
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    40   0.002
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    41   0.002
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    43   0.002
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    43   0.002
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    43   0.003
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    43   0.003
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    43   0.003
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.003
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    43   0.003
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    40   0.003
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    42   0.003
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    42   0.004
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    42   0.005
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    42   0.005
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    41   0.007
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    41   0.007
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    42   0.008
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    41   0.008
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    41   0.009
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    41   0.009
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    39   0.010
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    40   0.010
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    41   0.011
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.014
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    40   0.014
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    40   0.014
NDAI0C00160 Chr3 complement(21850..24186) [2337 bp, 778 aa] {ON}...    40   0.015
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    40   0.016
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    40   0.016
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    40   0.016
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    40   0.018
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    40   0.018
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    40   0.018
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    40   0.018
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    40   0.019
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    38   0.021
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    40   0.021
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    40   0.022
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    40   0.022
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    37   0.025
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    40   0.027
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    40   0.029
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    39   0.030
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    39   0.032
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    39   0.033
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    39   0.035
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    39   0.038
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    39   0.039
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    39   0.039
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.044
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    39   0.054
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    38   0.056
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    38   0.058
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    39   0.061
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    37   0.062
Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} simila...    39   0.066
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    38   0.069
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    38   0.070
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    38   0.072
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    38   0.073
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    38   0.075
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    38   0.081
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    38   0.086
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    35   0.087
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       38   0.098
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    38   0.10 
NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7....    37   0.12 
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    37   0.12 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    37   0.12 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.12 
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    37   0.13 
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    37   0.15 
Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa] ...    37   0.16 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    37   0.17 
KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar ...    37   0.17 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    37   0.17 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    37   0.19 
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    37   0.23 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    37   0.23 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    37   0.25 
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    36   0.28 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    36   0.29 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    36   0.31 
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    36   0.33 
KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}...    36   0.34 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    36   0.36 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    36   0.36 
Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON...    36   0.38 
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    36   0.39 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    36   0.40 
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    36   0.40 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.41 
Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON...    36   0.42 
Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {...    35   0.43 
Smik_11.262 Chr11 (438440..438988) [549 bp, 182 aa] {ON} YKR007W...    35   0.44 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    36   0.46 
YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}  ...    35   0.49 
ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {O...    35   0.52 
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    35   0.52 
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    35   0.55 
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    35   0.62 
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    35   0.68 
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    35   0.68 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    35   0.72 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    35   0.74 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    35   0.75 
TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.7...    35   0.76 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    35   0.80 
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    35   0.81 
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    35   0.81 
KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {O...    35   0.81 
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    35   0.82 
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    35   0.93 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    35   0.94 
Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]...    34   1.0  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    34   1.1  
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    34   1.1  
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   1.1  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    34   1.2  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    34   1.2  
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    34   1.4  
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    34   1.5  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    33   1.7  
KLTH0B04466g Chr2 (360380..362344) [1965 bp, 654 aa] {ON} simila...    33   2.1  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    33   2.1  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    33   2.3  
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    33   2.3  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    33   2.4  
CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} som...    33   2.5  
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    33   2.5  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    33   2.8  
AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic...    33   3.6  
SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} simi...    33   3.6  
ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON...    33   3.8  
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    33   3.8  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    33   3.9  
KAFR0B06030 Chr2 (1247049..1247765) [717 bp, 238 aa] {ON} Anc_8....    32   4.0  
KLTH0D17512g Chr4 (1457372..1461661) [4290 bp, 1429 aa] {ON} hig...    33   4.0  
NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72      32   4.6  
CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa] ...    32   4.6  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    32   5.1  
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    32   5.2  
ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {...    32   5.5  
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    32   5.6  
TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.6...    32   6.0  
TBLA0C00420 Chr3 (76048..78897) [2850 bp, 949 aa] {ON} Anc_8.20 ...    32   7.1  
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    32   7.4  
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    32   9.1  

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/644 (90%), Positives = 580/644 (90%)

Query: 1   MAENSFSKFFARNKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTKDRQRQGEA 60
           MAENSFSKFFARNKL                                  GTKDRQRQGEA
Sbjct: 1   MAENSFSKFFARNKLAIVATVSAGAAAVGAYVYYHQLKQQQQHHQQQLKGTKDRQRQGEA 60

Query: 61  LPXXXXXXXXXXXXXXSAAADXXXXXXXXXXXXXXXXPKSAEDVEYPLLPHGEPDMDRLR 120
           LP              SAAAD                PKSAEDVEYPLLPHGEPDMDRLR
Sbjct: 61  LPGQDGEEELGLKEDGSAAADSNKKKKKKNRRKKKSKPKSAEDVEYPLLPHGEPDMDRLR 120

Query: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180
           GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD
Sbjct: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180

Query: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240
           LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML
Sbjct: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240

Query: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300
           ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS
Sbjct: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300

Query: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360
           ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ
Sbjct: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360

Query: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420
           FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY
Sbjct: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420

Query: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480
           YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK
Sbjct: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480

Query: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540
           FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS
Sbjct: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540

Query: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600
           QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR
Sbjct: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600

Query: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI
Sbjct: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/644 (75%), Positives = 523/644 (81%), Gaps = 6/644 (0%)

Query: 1   MAENSFSKFFARNKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTKDRQRQGEA 60
           MAENS  KF A+NK+                                  GTK+R+R GE 
Sbjct: 1   MAENSLLKFIAKNKVAILATVSAGTAAVGAYAYYKQLKQREQQQLK---GTKNRRRPGET 57

Query: 61  LPXXXXXXXXXXXXXXSAAADXXXXXXXXXXXXXXXXPKSAEDVEYPLLPHGEPDMDRLR 120
                             +                  PK AE  EYPLL  GEPDM +LR
Sbjct: 58  F---TSQNEDEVSLKDDGSITSGSRKRKKNKRKRKNKPKLAESFEYPLLSDGEPDMAQLR 114

Query: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180
           GL   QRQ +AVQLKDKGNHFFT+K+F DAIKYYQ+AIELDPNDPVFYSN+SACYISTGD
Sbjct: 115 GLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGD 174

Query: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240
           L+KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDG SIEPML
Sbjct: 175 LNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 234

Query: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300
           ERNLNKQAMKVLN +L KN  D+ S+ILPSNTSLASFFGIFDPDLE SRV++ S  D+A 
Sbjct: 235 ERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAH 294

Query: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360
             L EALQ LYSATSEGYLIA+ L TKATD YHSLL A++ D  IR NAALAFCY GIFQ
Sbjct: 295 DMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQ 354

Query: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420
           FLKNDLLDAQALLQESINLHPTPNSY+FMALT+ADKENSQEFF FFQ AIDLDPEY PTY
Sbjct: 355 FLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTY 414

Query: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480
           YHRGQMYFILQDY+NAK DFQKAQSLNPGN+YPYIQLACLLYKQ KFSE+E LFNE KLK
Sbjct: 415 YHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLK 474

Query: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540
           FP LPEVPTF+AEILTDKGD+N AIKQYDIAKRL+EVQ+KIHVGIGPLIGKATILARQS+
Sbjct: 475 FPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQST 534

Query: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600
           QDPTQLDEEKFNMAIELLT+AC+LDPRSEQAKIGLAQL+LQMEKID AI+LFQ+SATLAR
Sbjct: 535 QDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLAR 594

Query: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLA+YRA GMI
Sbjct: 595 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/644 (72%), Positives = 520/644 (80%), Gaps = 5/644 (0%)

Query: 1   MAENSFSKFFARNKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTKDRQRQGEA 60
           MAENS  +F  +NK+                                  GTKD +RQ EA
Sbjct: 1   MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLK---GTKDNRRQSEA 57

Query: 61  LPXXXXXXXXXXXXXXSAAADXXXXXXXXXXXXXXXXPKSAEDVEYPLLPHGEPDMDRLR 120
                           S  +                  KS E  +YP LP+GEPD+ +L+
Sbjct: 58  F-AGQNEDEADLKDDGSVVSGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLK 116

Query: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180
           GLS  QRQA+AVQLK++GNHFFTAK+F +AIKYYQYAIELDPN+PVFYSNISACYISTGD
Sbjct: 117 GLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGD 176

Query: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240
           L+KV+E+TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDG SIEPML
Sbjct: 177 LEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 236

Query: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300
           ERNLNKQAMKVLNE+L K+ + + SQ+LPSNTSLASFFGIFD  LE S VNT S  D+A 
Sbjct: 237 ERNLNKQAMKVLNENLSKD-EGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAY 295

Query: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360
           A LS+ALQ LYSAT EGYL+A+DLLTK+TD YHSLL AN  D  +RENAALA CY GIF 
Sbjct: 296 ALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFH 355

Query: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420
           FLKN+LLDAQ LLQESINLHPTPNSY+F+ALT+ADKENSQEFFKFFQ A+DL+PEYPPTY
Sbjct: 356 FLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTY 415

Query: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480
           YHRGQMYFILQDY NAK DFQKAQSLNP NVYPYIQLACLLYKQ KF+E+E+ FNE KLK
Sbjct: 416 YHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLK 475

Query: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540
           FP LPEVPTF+AEILTD+GDF+ AIKQYDIAKRLEEVQ+KIHVGIGPLIGKATILARQSS
Sbjct: 476 FPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSS 535

Query: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600
           QDPTQLDEEKFN AI+LLTKACELDPRSEQAKIGLAQL+LQMEKID AI+LF++SA LAR
Sbjct: 536 QDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILAR 595

Query: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           TMDEKLQATTFAEAAKIQKRLRADPIISAKME TLA YRA+GM+
Sbjct: 596 TMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/644 (72%), Positives = 519/644 (80%), Gaps = 9/644 (1%)

Query: 1   MAENSFSKFFARNKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTKDRQRQGEA 60
           MAENS  +F ARNK+                                  G+KD +RQ EA
Sbjct: 1   MAENSLFRFIARNKVAILATVSAGTAAVGAYVYYQQLKQQQQQHLK---GSKDHRRQSEA 57

Query: 61  LPXXXXXXXXXXXXXXSAAADXXXXXXXXXXXXXXXXPKSAEDVEYPLLPHGEPDMDRLR 120
                           + ++                  KSAED +   LP+GEPD+ +L+
Sbjct: 58  ----STNLKEDEVGLKNKSSIANENKKKKNKRKRKNRAKSAEDFQCTFLPNGEPDISQLK 113

Query: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180
           GL+  Q+Q +AVQLK+KGNHFFT K+F +AIKYYQ AIELDPNDPVFYSNISACYISTGD
Sbjct: 114 GLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGD 173

Query: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240
           L+KV+EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDG SIEPML
Sbjct: 174 LNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 233

Query: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300
           ERNLNKQAMKVLNE+L K GD + SQ+LPSNTSL SFFGIFDPDLE SRVN  S  D+A 
Sbjct: 234 ERNLNKQAMKVLNENLSK-GDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAY 292

Query: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360
           A LS+ALQ LYSAT+EGYL AD L T ATD YHSLL A++ D  ++ENAALAFCY GIF 
Sbjct: 293 ALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALAFCYTGIFH 351

Query: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420
           FLKN+LL AQALLQESINLHPTPNSY+F+ALT+ADKENSQEFFK+FQ AIDLD EYPPTY
Sbjct: 352 FLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTY 411

Query: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480
           YHRGQMYFILQDY+NAK+DFQKAQ+L P N+YPYIQLACLLYKQ KF+E+E+LFNE KLK
Sbjct: 412 YHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLK 471

Query: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540
           FP LPEVP F+AEILTDKGDF+ AIKQYDIAKRLEEVQ+KIHVGIGPLIGKATILARQSS
Sbjct: 472 FPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSS 531

Query: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600
           QDPTQLDEEKFN AI LLTKACELDPRSEQAKIGLAQL+LQMEKID AI+LFQ+SA LAR
Sbjct: 532 QDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILAR 591

Query: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           TMDEKLQATTFAEAAKIQKRLRADPIISAKME TLA+YRA+GMI
Sbjct: 592 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/539 (58%), Positives = 398/539 (73%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+   GEP +D +  +S  Q+++++  LKDKGN FF  K + +A+KYY YA+ L   DP
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDP 139

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSNISACY+S   LDKVVE +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVL
Sbjct: 140 VFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SLNGDF G+SIEPMLERNLNKQAM VL + L   G  K+ Q+LPS+T+LASFFGIF P+ 
Sbjct: 200 SLNGDFGGSSIEPMLERNLNKQAMTVLKDKL---GQQKN-QLLPSDTALASFFGIFTPET 255

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
           E +  +  S    A   L   L++LY  +SEGY  AD+  ++A D Y  L   N +D  +
Sbjct: 256 EFANYDETS---EADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAAL 312

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           +E  A+A  + GIF+FLKND L A   +Q++I+LHP  NSY++MAL +ADK  ++E+++F
Sbjct: 313 KEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEF 372

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F  AI LDP+    YYHRGQMYFI   Y  A  DF KA+ LN  N++PYIQLACL Y+++
Sbjct: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYREN 432

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF + E+LF+EAK KF   PEVP F+AEIL DKGD   A+KQYDIAKRLEE    IHVGI
Sbjct: 433 KFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGI 492

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PL+GKAT+LARQ S        E F  A +LL +AC  DPRSEQ K+GLAQL+LQ E I
Sbjct: 493 SPLVGKATLLARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDI 545

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AIKLF+E+A+LART+DEKLQATTFAEAAK+QKR+RADP++SAK+E+TLA Y+AQG+I
Sbjct: 546 DDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/539 (57%), Positives = 394/539 (73%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEP ++ +  LS   R+ +A  LKD+GN FF  K + +A+KYY YA+ +   DP
Sbjct: 76  YPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVV-KKDP 134

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSNISACY+S G LDKVVE +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVL
Sbjct: 135 VFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSVL 194

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SLNGDF+G+SIEPMLERNLNKQAM VL + L  N     SQ LPSNT+LASFFGIF P+ 
Sbjct: 195 SLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNN----VSQQLPSNTALASFFGIFPPET 250

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
             +  N     D A   L   L+ LY  +SEGY +AD+   K+   + + L    +D V+
Sbjct: 251 TFANYNEN---DEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVL 307

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           +E  A+A  + GIF+FLKND L+A   ++++I LHP  NSY++MAL +ADK  ++E++++
Sbjct: 308 KEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQY 367

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F  AI LDP Y P YYHRGQMY+I   Y  A  DF KA+  +  N++PYIQLACL Y++D
Sbjct: 368 FDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYRED 427

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF + E+LF+EAK KFP  PEVP FYAEIL DKGD   A+KQY+IAKRLEE    IHVG+
Sbjct: 428 KFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGV 487

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PL+GKAT+LARQ S        E F  A  LL +AC  DP SEQAK+GLAQL+LQ E++
Sbjct: 488 APLVGKATLLARQPSV-------ENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEV 540

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AI LF+E+A LART+DEKLQATTFAEAAK+QKR++ADP++SAK+E+TLA YRAQGM+
Sbjct: 541 DEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/540 (56%), Positives = 400/540 (74%), Gaps = 12/540 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP     +PDM ++  L   +++  ++QLKDKGN +F AK + +AIKYY  A++L+  DP
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDP 155

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           +FYSNISACY+S G LDKV+E +TKALE+ P++SKALLRRASANESL N++DA+FDLSVL
Sbjct: 156 IFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLK-NGDDKSSQILPSNTSLASFFGIFDPD 284
           SLNGD+ G SIEP+LERNLNKQA+KVLNE + K  G +K  Q+LPS TSL SFFGIFDP+
Sbjct: 216 SLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPE 275

Query: 285 LETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRV 344
           L     N     D A   L   L +L+  T +GYL AD    KA+  +   L  N +D+ 
Sbjct: 276 LTFQNYNEN---DQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKH 332

Query: 345 IRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFK 404
           + E  A+A  Y GIF+FLKNDLL AQ  ++++I   P  NSY+++AL  ADK  SQE+ K
Sbjct: 333 LLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392

Query: 405 FFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQ 464
           +F  A++L+P+    YYHRGQ+YFI QDY  AK +F+KA+ L+  N++PYIQLACL Y++
Sbjct: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452

Query: 465 DKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVG 524
           + F   + LF+E + KFP  PEVPTFYAEIL DKGDF  AIKQYDIA RLE+ QK IHVG
Sbjct: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVG 512

Query: 525 IGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEK 584
           I PL+GKAT+LARQ    P  L+      A +L+ KACE+DPRSEQA +GLAQL+LQ E+
Sbjct: 513 IAPLVGKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEE 565

Query: 585 IDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           +D+AI+LF+++A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK+++ LA+YR+QG+I
Sbjct: 566 VDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/539 (58%), Positives = 394/539 (73%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEP +D +  L+  Q++ +A+ LKDKGN FF  K F DAIKYY  A+EL   DP
Sbjct: 77  YPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALEL-KKDP 135

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN SACY+S G L+KVVE TT AL++K D+SK LLRRASANESLGN+ DAMFDLS L
Sbjct: 136 VFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSAL 195

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SL GDF+G SIEPMLERN+NKQAM VL E L    ++K    LPSNTSLASFFGIF+P  
Sbjct: 196 SLYGDFNGASIEPMLERNMNKQAMLVLKEKL----EEKKDHRLPSNTSLASFFGIFEP-- 249

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
           ETS  N    ++ A   L + L +LY  TSEGY  AD+  TKA   Y +LL  + E+ ++
Sbjct: 250 ETSFENYDESVE-ADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEIL 308

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           ++ AA+A  + GIF+FLKND L A   L++++  HP  NSY+++AL +ADK  + E+F+ 
Sbjct: 309 KQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFEN 368

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F  A++LDP     YYHRGQMYFI Q Y NA  DF KA+  N  N++PYIQLACL Y+++
Sbjct: 369 FDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYREN 428

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF + E+LF+EA+ KFP  PEVP FYAEIL+DKGD   A KQY+IA++LE+    IHVGI
Sbjct: 429 KFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGI 488

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PL+GKAT+LAR+    PT    E F  A +   +ACE DPRSEQAKIGLAQL+LQ E++
Sbjct: 489 APLVGKATLLARE----PTV---ENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEV 541

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AI LF+E+A LAR+ DEKLQATTFAEA KIQK++RADPIISAK+E+TLA YRAQGMI
Sbjct: 542 DEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/539 (56%), Positives = 392/539 (72%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEPD+      +  Q++ ++V LKDKGN FF  + + DA+KYY YA++L   DP
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDP 132

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSNISACY+S G+L+KVVE +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVL
Sbjct: 133 VFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SLNGDF+  SIEPMLERNLNKQAM+VL + +  +    + Q LPSNT LASFFGIF P+ 
Sbjct: 193 SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSD----AKQQLPSNTFLASFFGIFTPET 248

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
                +     + A   L  AL +LY   SE YLIAD+  +KA + Y   L AN +D V+
Sbjct: 249 TLKNFDES---NEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVL 305

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           +E  A A  Y GIF+FLKND L +   +Q SI LHP  N+Y++ AL +ADK  S+ +F F
Sbjct: 306 KEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDF 365

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F  A+D+DP   P YYHRGQM+F+ Q Y  A +DF+KA+  +  N++PYIQLACL Y + 
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF + E+LF+EAK KFP  PEVP FYAE+LTDKGDF+ A KQYDIAKRLEE    IHVG+
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGV 485

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PL+GKAT+LARQ    PT    E    +  LL +AC++D RSEQAKIGLAQL+LQ E+I
Sbjct: 486 SPLVGKATLLARQ----PTV---ENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEI 538

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AI LF+E++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA YR QG+I
Sbjct: 539 DEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/537 (56%), Positives = 392/537 (72%), Gaps = 18/537 (3%)

Query: 113 EPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNIS 172
           +PDM  +   S  Q++ +A  LKDKGN  F  K F DAI++Y +AI+L   DPVF+SNIS
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133

Query: 173 ACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 232
           ACY+S GDLDKVVE +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193

Query: 233 GTSIEPMLERNLNKQAMKVLNE------SLLKNGDDKSSQILPSNTSLASFFGIFDPDLE 286
           G+SIEPMLERNLNKQA++VL E      S+ +    +  Q LPSNTSL+SFFGIF P+ E
Sbjct: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253

Query: 287 TSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIR 346
               +     + A  TL   L++LY ATS+GY +AD+   KA   Y   L AN  D   +
Sbjct: 254 IPAYDES---NEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFK 309

Query: 347 ENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFF 406
           E AA A  Y GIF FLKNDL +++  L+E++ LHP  N+Y+++ALT+AD+  S+++F +F
Sbjct: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYF 369

Query: 407 QNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDK 466
           + AI LDP     YYHRGQMYFI Q+Y  A  DF+K++  +P N++PYIQLACL Y+++K
Sbjct: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429

Query: 467 FSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIG 526
            +E E LF EA+  FP  PEVP FYAEIL DKGD + A+KQY+IA RLE +QK+IHVGI 
Sbjct: 430 MAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIA 489

Query: 527 PLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKID 586
           PL+GKATILARQ    PT    E F    +LL  AC+ DPRSEQAK+GLAQL LQ EK+D
Sbjct: 490 PLVGKATILARQ----PTP---ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVD 542

Query: 587 VAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGM 643
            AI+LF+E+A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E+TLA Y+AQ M
Sbjct: 543 EAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/539 (57%), Positives = 387/539 (71%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           +P+   GEPD+ ++  LSA ++  FA+ LKDKGN FF  K F DA+KYY  AIE+   DP
Sbjct: 71  FPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDP 129

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN SACY+S G  +KVVE TT AL++KPD+SK LLRRASANESLG F DAMFDLS +
Sbjct: 130 VFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAV 189

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SL GDF+G+SIEP+LERN+NKQAM VL E L K  + K    LPSNTSLASFFGIF P+ 
Sbjct: 190 SLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYK----LPSNTSLASFFGIFQPET 245

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
                +  S  D A   L + L +LY  TS GY  AD   +KA DEY +LL  N ED  +
Sbjct: 246 SFENYDENSEADKA---LLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASL 302

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           ++ AA+A  + GIF+FLKND + A   L++++   P PN+Y++MAL +ADK  + E+F  
Sbjct: 303 KQKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDN 362

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F+ A++LDP     YYHRGQM+FI Q +  A  DF+KA+ LN  N++PYIQLACL Y++ 
Sbjct: 363 FEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREG 422

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KFS++E+LF+EA+ KFP  PEVP FYAE L+DKGD   A K+YDIA +LE     IHVG+
Sbjct: 423 KFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGV 482

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PLIGKAT+L+R+ S        E F  A  L  +ACE DPRSEQAKIGLAQL+LQ E I
Sbjct: 483 SPLIGKATLLSREPSV-------ENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDI 535

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AI LF+E+A LAR+ DEKLQATTFAEA KIQK++RADPI+SAK+E+TLA YRAQGMI
Sbjct: 536 DEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/539 (56%), Positives = 381/539 (70%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+   GEPD+  L  LS  Q+  +A+ LKDKGN FF  K + +AI+YY +AIE+   DP
Sbjct: 70  YPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVK-EDP 128

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN SACY+S G  +KVVE TT AL++KPD+SK LLRRASANESLGNF DAMFDLS +
Sbjct: 129 VFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAV 188

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SL GDF G SIEP+LERN+NKQ+M VL E L K  + K    LPSNTSLASFFGIF P+ 
Sbjct: 189 SLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYK----LPSNTSLASFFGIFQPET 244

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
                +  S    A   L E L +LY  T++GY  AD    KA D +  LL  N ED  +
Sbjct: 245 TFENYDDNS---EADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADL 301

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           +  AA+A  + GIF+FLKND + A   L++++   P PN+Y++MAL +ADK  + E+F  
Sbjct: 302 KRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDN 361

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F+ A+ LDP     YYHRGQMYFI Q +  A  DF+KA+ L+  N++PYIQLACL Y++ 
Sbjct: 362 FEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREG 421

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF ++E+LF+EA+ KFP  PEVP FYAE L+DKGD   A KQYDIA +LE+    IHVG+
Sbjct: 422 KFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGV 481

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PLIGKAT+L+R+ S        E F  A +L  KAC+ DPRSEQAKIGLAQL+LQ E I
Sbjct: 482 SPLIGKATLLSREPSV-------ENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDI 534

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AI LF+E+A LAR+ DEKLQATTFAEA KIQK++RADP++SAK+E+TLA YRAQGMI
Sbjct: 535 DEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/546 (55%), Positives = 386/546 (70%), Gaps = 19/546 (3%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+   GEPD+ +L   +  QR+ +A+ LKDKGN  F  K+  +AIKYYQ+A+E    DP
Sbjct: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDP 139

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFY+NISACY+S  D +KV+E   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVL
Sbjct: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SLN DF G SIEPMLERNLNKQAMK+L E L +N  DK  Q LPS+TS+ASFFGIF P+ 
Sbjct: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERL-ENTQDKFEQPLPSDTSMASFFGIFKPET 258

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLL-RANKEDRV 344
           E    +       A  TL   L  L++AT  G++ AD    +A ++Y  L  +A+ E+++
Sbjct: 259 EFKGYDETC---EADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKL 315

Query: 345 ---IRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQE 401
              + E  A+A  Y+GIF+FLKND++ AQA + E+I L P  NSY+++ALT AD   S E
Sbjct: 316 AQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSE 375

Query: 402 FFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLL 461
           +   F  A++L+P    TYYHRGQ+YFI QDY  AK+DF KA+ L+  N++ YIQLACL 
Sbjct: 376 YVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLC 435

Query: 462 YKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEE---VQ 518
           Y++    E + LF+EA+ KFP+ PEVPTFYAEIL DKGDF+ A KQYD+AKRLEE    +
Sbjct: 436 YREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAK 495

Query: 519 KKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQL 578
             I VG+ PL+GKAT+LARQ S        E F  A  L  +AC+ DPRSEQAK+GLAQL
Sbjct: 496 TGIRVGVAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQL 548

Query: 579 ELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANY 638
            LQ E +D AIK+F+E+A LART DEKLQA TFAEAAK+QK++RADPII AK+E+ LA Y
Sbjct: 549 LLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEY 608

Query: 639 RAQGMI 644
           RAQGMI
Sbjct: 609 RAQGMI 614

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/556 (53%), Positives = 385/556 (69%), Gaps = 29/556 (5%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEPD  +    +A ++  +A+ LKDKGN +F  K + DAIKYY +A+EL   DP
Sbjct: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN+SACY+S GDL KVVE +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLL-----------------KNGDDKSSQIL 268
           SLNGDF+  SIEPMLERNLNKQAM  L E                    K   DK    L
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQEN-L 251

Query: 269 PSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKA 328
           PS TS+ASFFGIF P+L  +  +     + A   L + L +LY  + E Y  AD+  TKA
Sbjct: 252 PSITSMASFFGIFKPELTFANYDE---FNKADKELMDGLANLYKRSPESYDRADESFTKA 308

Query: 329 TDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVF 388
              +   L  + ED  ++E  A++  + GIF+FLKND L A   ++++I L P  NSY++
Sbjct: 309 AKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368

Query: 389 MALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNP 448
           MAL +AD+ +S E++ +F  A+ L+P     YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 449 GNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQY 508
            N++PYIQLACL Y+++KF + E+LF+EAK KFP  PEVP F+AEILTDK DF+ A+KQY
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 509 DIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRS 568
           D+A  LE    +I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRS
Sbjct: 489 DLAIELENKLDRIYVGIAPLVGKATLLTR----NPTV---ENFVEATNLLEKASKLDPRS 541

Query: 569 EQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 628
           EQAKIGLAQ++LQ E ID AI LF+ESA LARTM+EKLQA TFAEAAK+Q+++R+DPI++
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILA 601

Query: 629 AKMEQTLANYRAQGMI 644
           AK+++TLA  R QG++
Sbjct: 602 AKIQETLAKLREQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/559 (54%), Positives = 383/559 (68%), Gaps = 35/559 (6%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +G+PD       +A ++  +A+ LKDKGN FF  K + DAIKYY +A+EL  +DP
Sbjct: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDP 132

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGD--------------------DKSS 265
           SLNGDF+  SIEPMLERNLNKQAM  L E   K GD                    DK+ 
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKE---KFGDIDTATATPTELSTQAPKELKDKTE 249

Query: 266 QILPSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLL 325
             LPS TS+ASFFGIF P+L  +  +     + A   L   L +LY  + E Y  AD+  
Sbjct: 250 N-LPSITSMASFFGIFKPELTFANYDES---NEADKDLMNGLTNLYKRSPESYDKADESF 305

Query: 326 TKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNS 385
           TKA   +   L  N ED   +E  A++  + GIF+FLKND L A   ++++I L P  NS
Sbjct: 306 TKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNS 365

Query: 386 YVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQS 445
           Y++MAL +AD+ +S E++ +F  A+ LD      YYHRGQM FILQ+Y  A  DF KA+ 
Sbjct: 366 YIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425

Query: 446 LNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAI 505
           L+P N++PYIQLACL Y+++KF + E+LF+EAK KFP  PEVP F+AEILTDK DF  A+
Sbjct: 426 LDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKAL 485

Query: 506 KQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELD 565
           KQYD+A  LE     I+VGI PL+GKAT+L R    +PT    E F  A  LL +A +LD
Sbjct: 486 KQYDLAIELENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEEASKLD 538

Query: 566 PRSEQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADP 625
           PRSEQAKIGLAQ++LQ E ID AI LF+ESA LARTM+EKLQA TFAEAAK+QKR+R+DP
Sbjct: 539 PRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDP 598

Query: 626 IISAKMEQTLANYRAQGMI 644
           I++AK+++TLA  R QG++
Sbjct: 599 ILAAKIQETLAKLREQGLM 617

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/538 (54%), Positives = 383/538 (71%), Gaps = 16/538 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEP++D     +  +++ +++ LKDKGN  F A  F +AIKYY +AIEL  N P
Sbjct: 86  YPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN-P 144

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           +FYSN+SACY+S   L+++++Y  KALE+KPD+SK LLRRA+ANE L N+ DAMFDLSVL
Sbjct: 145 IFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVL 204

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SLNGD++G SIEP+LERNLNKQAM VL + L  + DD+    LPS+TSL++FFGIF P+L
Sbjct: 205 SLNGDYNGASIEPILERNLNKQAMSVLKDKLKNSKDDQ----LPSDTSLSAFFGIFKPEL 260

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
                +     + A   L   L  L+   SE YLIAD     A + Y   L    +D  +
Sbjct: 261 SFENYDET---NDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDL 317

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           +  A++A+ YAGIF FLKNDL  A   + +SI L+P  NSY++ AL +ADK  SQ++  +
Sbjct: 318 KVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDY 377

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F  A+ LD +    YYHR Q+ F+ QD+  A  DF+KA+  +P N++PYIQLACL Y+++
Sbjct: 378 FDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYREN 437

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKK-IHVG 524
           KF + E+LF+EAK KFP LPEVP FYAE+LTDKGDF+ A+K Y+ A+RLEE  K  IHVG
Sbjct: 438 KFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVG 497

Query: 525 IGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEK 584
           + PLIGKAT+LAR+    PT    E    A +LL +A  +DPRSEQAKIGLAQL+LQ E+
Sbjct: 498 VAPLIGKATLLARE----PTL---ENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEE 550

Query: 585 IDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQG 642
           ID +I+LF+ESA LARTM+EKLQATTFAEAAK+QK +RADPIIS K+E+TLA YRAQ 
Sbjct: 551 IDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/556 (53%), Positives = 379/556 (68%), Gaps = 29/556 (5%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEPD       +A ++  +A+ LKDKGN FF  K + DAIKYY +A+EL   DP
Sbjct: 74  YPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LG F DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVL 192

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESL-----------------LKNGDDKSSQIL 268
           SLNGDF+  SIEPMLERNLNKQAM  L E                    K   DK    L
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQEN-L 251

Query: 269 PSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKA 328
           PS TS+ASFFGIF P+L  +  +     + A   L   L +LY  + E Y  AD+  TKA
Sbjct: 252 PSVTSMASFFGIFKPELTFANYDES---NEADKELMNGLSNLYKRSPESYDKADESFTKA 308

Query: 329 TDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVF 388
              +   L  N ED  ++E  A++  + GIF+FLKND L A   ++++I L P  NSY++
Sbjct: 309 ARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368

Query: 389 MALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNP 448
           MAL +AD+ +S E++ +F  A+ LD      YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 449 GNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQY 508
            N++PYIQLACL Y+++KF + E+LF+EAK KFP  PEVP F+AEILTDK DF+ A+KQY
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 509 DIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRS 568
           D+A  LE     I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRS
Sbjct: 489 DLAIELENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRS 541

Query: 569 EQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 628
           EQAKIGLAQ++LQ E ID AI LF+ESA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLA 601

Query: 629 AKMEQTLANYRAQGMI 644
            K+++TLA  R QG++
Sbjct: 602 KKIQETLAKLREQGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/556 (53%), Positives = 383/556 (68%), Gaps = 29/556 (5%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEPD  +    +A ++  +A+ LKDKGN +F  K + DAIKYY +A+EL   DP
Sbjct: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLL-----------------KNGDDKSSQIL 268
           SLNGDF+  SIEPMLERNLNKQAM  L E                    K   DK  + L
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQ-ESL 251

Query: 269 PSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKA 328
           PS TS+ASFFGIF P+L  +  +     + A   L   L +LY  + + Y  AD+  TKA
Sbjct: 252 PSVTSMASFFGIFKPELTFANCDES---NEADKELMNGLANLYKRSPDSYDRADESFTKA 308

Query: 329 TDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVF 388
              +   L  + ED  ++E  A++  + GIF+FLKND L A   + ++I+L P  NSY++
Sbjct: 309 VKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIY 368

Query: 389 MALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNP 448
           MAL +AD+ +S E++ +F  A+ LD      YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 449 GNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQY 508
            N++PYIQLACL Y+++KF + E+LF+EAK KFP  PEVP F+AEILTDK DF+ A+KQY
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 509 DIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRS 568
           D+A  LE   + I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRS
Sbjct: 489 DLAIELENKLEGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRS 541

Query: 569 EQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 628
           EQAKIGLAQ++LQ E ID AI LF+ESA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLA 601

Query: 629 AKMEQTLANYRAQGMI 644
            K+++TLA  R QG++
Sbjct: 602 TKIQETLAKLREQGLM 617

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/540 (53%), Positives = 381/540 (70%), Gaps = 13/540 (2%)

Query: 105 EYPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPND 164
           ++P   +GEPD   +  L+A Q+  +A++LKDKGN +F  K + +A+K+Y +A+ L   D
Sbjct: 82  QFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKD 140

Query: 165 PVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 224
           PVFYSN+SACY+S  +LDKV+E +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSV
Sbjct: 141 PVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSV 200

Query: 225 LSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPD 284
           LSLN DF+G +IEPMLERNLNKQA+KVL++   KN     S+ LPSNTS+ASFF IF P+
Sbjct: 201 LSLNNDFNGATIEPMLERNLNKQAIKVLDQKS-KNPSKNESE-LPSNTSMASFFSIFTPE 258

Query: 285 LETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRV 344
           +     +  S    A   L   L+ LYSA +  Y IA+    K+ + Y  LL + ++   
Sbjct: 259 ISFDSYDEES---DADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKET 315

Query: 345 IRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFK 404
           I +  A+A  Y GIF FL+NDL+ AQ L  +SI+  P  NSY+++AL  ADK    E  K
Sbjct: 316 ISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNK 375

Query: 405 FFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQ 464
           +F  A+ LDP   P YYHRGQ+ F+ QDY+NAK+DF KA+ L+  N++PYIQLACL Y++
Sbjct: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435

Query: 465 DKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVG 524
             F + ++ F  A+ KFP+ PE+PTF  EIL DKGD + A KQY+   RLE  QK IHVG
Sbjct: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVG 495

Query: 525 IGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEK 584
           I PLIGKAT LARQ    PT    E F+ A +LL  A E DPRSEQA +GLAQL+LQ E 
Sbjct: 496 IAPLIGKATALARQ----PTP---ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEED 548

Query: 585 IDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           +D AI+LF++++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E+TLA Y AQG +
Sbjct: 549 VDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/541 (54%), Positives = 389/541 (71%), Gaps = 15/541 (2%)

Query: 104 VEYPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPN 163
           V YP+  +GEPD+      S   ++ +A+ LKDKGN +F  + F +A+KYY YA+ L   
Sbjct: 78  VIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTL-KQ 136

Query: 164 DPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS 223
           DPVFYSNISACY+S G L+KVVE +T+AL++K D+SKALLRRASA ESL N+ DAM DLS
Sbjct: 137 DPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLS 196

Query: 224 VLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDP 283
           VLSLNGDF+G SIEPMLERNLNKQAM+VL E + +N      Q+LPSNTSLASFFG+F P
Sbjct: 197 VLSLNGDFNGASIEPMLERNLNKQAMQVLKEKIAEN----KPQLLPSNTSLASFFGVFKP 252

Query: 284 DLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDR 343
           ++  +  N  S    +   L   L +LYS T++GYL+AD+   KA          NKE+ 
Sbjct: 253 EVSLNNFNENS---ESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENN 309

Query: 344 VIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFF 403
            I+E  A+A  Y GI +FLKND LDA   +Q++I + P  NSY++ +L +ADK  ++E  
Sbjct: 310 DIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESI 369

Query: 404 KFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYK 463
           K F  AI+LD     TYYHRGQ+YF+ Q Y  A  DF KA+ L+  N+ PYIQLACL YK
Sbjct: 370 KNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYK 429

Query: 464 QDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHV 523
           ++KF++ E+LF+EA+ KFP  PEVP FYA++L ++ +F+ A+KQYDI+K+LEE  + IHV
Sbjct: 430 ENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHV 489

Query: 524 GIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQME 583
           GI P+IGKAT+LAR    +P     E    + EL  +AC+LDPRSEQAKIGLAQL+LQ E
Sbjct: 490 GIAPMIGKATLLAR----NPIV---ENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQE 542

Query: 584 KIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGM 643
           ++D AI LF+E+A LAR MDEKLQATTFAEA+K+QK++R+DP+I+ K+++TLA Y+ QG+
Sbjct: 543 EVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGL 602

Query: 644 I 644
           +
Sbjct: 603 M 603

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/539 (51%), Positives = 377/539 (69%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEPD+  +   +  Q++ +++ +KDKGN  F  K + +AIKYY  A+ L   DP
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLK-KDP 131

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN SAC++    L+KVVE TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +
Sbjct: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SL G ++  SIEP+LERN+NKQAM+VL   L     D S   LPSNTSLASFFGIF  + 
Sbjct: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKLA----DGSKHQLPSNTSLASFFGIFPSET 247

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
             +  +  S  D+    L + L+ L    +  Y ++D+   KA D      +A+ ED  +
Sbjct: 248 SFANYDEQSEADN---FLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPAL 304

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           R   A+A  + GIF+FLKN+ L+A  LLQ++++LHP PNSY++MAL +ADK  + E+ ++
Sbjct: 305 RMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQY 364

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F  A++L P     YYHRGQMYF+ Q +  +  DF KA+  NP N++PYIQLACL Y+++
Sbjct: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF + E+LF+EA+ KFP  PEVP FYAEIL+DKGD   A+K+Y+ A++LE+ Q+ IHVG+
Sbjct: 425 KFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGV 484

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PL+GKAT+LARQS           F  A  L  +AC+ DPRSEQAKIGLAQL+LQ E++
Sbjct: 485 APLVGKATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQV 537

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AI+LF+E+  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK+++TL  YR QG++
Sbjct: 538 DEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/539 (51%), Positives = 379/539 (70%), Gaps = 15/539 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEPD+  +   +  Q++ +A+ LKDKGN  F  + + +AIK+Y  A++L   DP
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDP 128

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           VFYSN SACY+    L+KVVE TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +
Sbjct: 129 VFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SL G +   +IEP+LERN+NKQAM+VL + L  +G +K    LPSNTSLASFF IF  + 
Sbjct: 189 SLYGGYSSQTIEPVLERNMNKQAMQVLKQKL--SGGEKHE--LPSNTSLASFFRIFPSET 244

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
                +  S    A   L + L +L++  +  Y IAD+  T A +++ +   AN ++  +
Sbjct: 245 SLENYDETS---EADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAAL 301

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           ++  A+A  + GI +FLKN+ L+A  LLQ++I+L P PNSY++M L +ADK  + E+ + 
Sbjct: 302 KQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQN 361

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F+ A++LDP+    YYHR QM F++Q +  A  DF KA+  +P  VYPYIQLACL Y++ 
Sbjct: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF + E+LF+EA+ +FP  PEVP FYAEIL+DKGDF  A+K+YD A++LE+ Q+ IHVG+
Sbjct: 422 KFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGV 481

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PL+GKA +LARQ S          F  A +L   ACE DPRSEQAKIGLAQL+LQ E++
Sbjct: 482 APLVGKAALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEV 534

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644
           D AIKLF+ +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK+++TL  YRAQGM+
Sbjct: 535 DEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/540 (51%), Positives = 381/540 (70%), Gaps = 13/540 (2%)

Query: 104 VEYPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPN 163
           V YP+  +G+PD+ +    +  Q   +A+ LKDKGN FF AK F  AI+YY  AI L   
Sbjct: 77  VVYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KE 135

Query: 164 DPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS 223
           DPVFYSN SA Y+S  + +KVVE TT AL++KPD+SK  LRRASA E+LG F+DAMFDLS
Sbjct: 136 DPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLS 195

Query: 224 VLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDP 283
            +SL G++ G S+E +LERN+NKQA KVL E L +N   +S   LPSNTSLASFFGIF+P
Sbjct: 196 AVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESP--LPSNTSLASFFGIFNP 253

Query: 284 DLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDR 343
             ETS  +     + A   L + L++LY   +  Y +AD+  TKA + Y   L ++ ++ 
Sbjct: 254 --ETS-FDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNE 310

Query: 344 VIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFF 403
            +++ AA+AF + GIF+F KND + A   L+ES++L+P P++Y++MAL +ADK  + ++ 
Sbjct: 311 SLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYK 370

Query: 404 KFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYK 463
           ++F  A++LDP     YYHRGQM+F+++++  A +DF KA+ LNP N++ YIQ ACL ++
Sbjct: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFR 430

Query: 464 QDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHV 523
            D+F + E+LF+EA+ KFP  PEVP FYAEIL  K   + AIKQYDIA +LE+    IHV
Sbjct: 431 DDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHV 490

Query: 524 GIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQME 583
           GI P+IGKAT L R    +PT    E F  A EL  +AC++DPRSEQAKIGLAQL+LQ E
Sbjct: 491 GIAPMIGKATALIR----NPTV---ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQE 543

Query: 584 KIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGM 643
           +ID AI+LF+++A L+R+ DEKLQATTFAEA K+QK++RADP I  K+++ +A YRAQG+
Sbjct: 544 EIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  529 bits (1362), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 287/550 (52%), Positives = 376/550 (68%), Gaps = 26/550 (4%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQ---RQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDP 162
           YPL    +PD + +  L A     +  FA +LK+KGN +F +K   +AIKYY+YA+ LD 
Sbjct: 130 YPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLD- 188

Query: 163 NDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 222
            DPVFYSNISACY +   LDKV+E + KALE+KPD+SKALLRRA+A E+LGN  +A++D 
Sbjct: 189 QDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDF 248

Query: 223 SVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQ--ILPSNTSLASFFGI 280
           S+LSL G++ G  +EP+L R L+K +  VL   L    D+K +   IL S+++L SFFGI
Sbjct: 249 SILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKL----DNKKTDNFILLSDSALVSFFGI 304

Query: 281 FDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRA-- 338
           F P+   +  N     D A   L + L++L   TSEG+L AD    KA + +   L +  
Sbjct: 305 FPPETTITNYNPD---DEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSE 361

Query: 339 -NKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKE 397
            N E+  + E  A+A  Y+G+F+FLK DLL ++  LQ++I+L+P PNSY++MA+ VADK 
Sbjct: 362 DNDENSGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKN 421

Query: 398 NSQ---EFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPY 454
           N +   ++FK+F  A  L+P + PTYYHRGQ+  + Q +  A++ F KA+ L+  NVYPY
Sbjct: 422 NDKNDLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPY 481

Query: 455 IQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRL 514
           IQLAC+ Y    F + + LF+EA+ KFP LPEVPTFYAEIL DKG+   A+KQYDIA RL
Sbjct: 482 IQLACVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRL 541

Query: 515 EEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIG 574
           E   K IHVGI PLIGKA  LAR     PTQ   E F+   ELL KACELDPRSEQAKI 
Sbjct: 542 ETAYKYIHVGIAPLIGKAAALARI----PTQ---ENFDTMTELLEKACELDPRSEQAKIS 594

Query: 575 LAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQT 634
           LAQL+LQ E ID AI LF+E+A LART  +KLQATTFAEAAKIQKR++ +PI +AK+E+T
Sbjct: 595 LAQLKLQTEDIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEET 654

Query: 635 LANYRAQGMI 644
           LA YRA G+I
Sbjct: 655 LATYRADGII 664

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  525 bits (1353), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 282/535 (52%), Positives = 369/535 (68%), Gaps = 14/535 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           YP+  +GEP +  +  L+   ++ +A  LK+KGN  F  K F +AIKYY +A+ L   DP
Sbjct: 70  YPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSL-KEDP 128

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           V+YSNISACY S  + +KV+E  TKAL ++PD+SK L+RRA+A E LGNF DAMFDLSV 
Sbjct: 129 VYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVC 188

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SLN D    SIEP+LERNLN+QAM VLN  L     DK SQ LPSNT+L SFFGIF P+L
Sbjct: 189 SLNTDMSDASIEPILERNLNQQAMFVLNTKL--GVTDKKSQ-LPSNTALTSFFGIFKPEL 245

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
             +  +     D     L   L++LY  T+EGY  AD   TKAT+ +   L    +D  +
Sbjct: 246 SFANYDDTCEGDK---ELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETV 302

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           +E  A+A  + GIF+FLKN+ L+A   +++++ LHP  NSY++MAL +ADK ++  +F  
Sbjct: 303 KEKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFAN 362

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           ++ A+ LD +    YYHRGQMYFI Q Y  A  DF KA+ L+P N++PYIQLACL Y+++
Sbjct: 363 YEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYREN 422

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
           KF + E+LF+EA+ KFP   EVP FYAEIL DKGDF+ A+K+Y+ A  LE+ Q  +HVGI
Sbjct: 423 KFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGI 482

Query: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585
            PL+GKAT+L R     PT    E F  A  LL +A + DPRSEQAKI L QL+LQ E I
Sbjct: 483 APLVGKATLLVRT----PTV---ENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDI 535

Query: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRA 640
           D AI+LF+ +ATLART +EKLQATTFAEAAKIQKR+RADP +SAK+++T+A  RA
Sbjct: 536 DEAIELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRA 590

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  499 bits (1284), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 263/537 (48%), Positives = 358/537 (66%), Gaps = 16/537 (2%)

Query: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165
           Y +  +GEP++  +  L+   +  +A+ LKDKGN  F    F DAIKYY YA++L  +DP
Sbjct: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDP 143

Query: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           ++YSNISACY S    +KV+EY TKAL+++P  SK L+RRA A E++GNF DAMFD+S  
Sbjct: 144 IYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISAC 203

Query: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285
           SLNGD +  SIEP+LER LNKQA  VL E +  N +    Q LPS+T LASFF +F P  
Sbjct: 204 SLNGDMNDASIEPILERILNKQAEFVLKEKISANKE----QNLPSSTPLASFFRVFKP-- 257

Query: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345
           ETS  N     + A   L   L +LY  + EG+ IAD    KA + +   L  NK++  I
Sbjct: 258 ETSFANYEES-NEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAI 316

Query: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405
           +E  A+A  Y+GI  ++KN+ L A   ++ +I LHP  NSY++ +L  +D   + E+ + 
Sbjct: 317 KEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQN 376

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F  A++L+P  P  YYHRGQ YFI Q Y  A  DF K + L+  N++ YIQLACL Y++ 
Sbjct: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRES 436

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLE-EVQKKIHVG 524
           KF + E+LF+EA+ KFP  PEVP F+AE+L D+G+   A+K++D A  LE +  ++IHVG
Sbjct: 437 KFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVG 496

Query: 525 IGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEK 584
           I PLIGKAT+L  +    PT    E F   I+LL +AC+ DPRSEQA++GLAQL+LQ E 
Sbjct: 497 IAPLIGKATLLISK----PTV---ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQED 549

Query: 585 IDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQ 641
           ID AI+LF+E+A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+ QT+   R+Q
Sbjct: 550 IDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  488 bits (1255), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 255/540 (47%), Positives = 356/540 (65%), Gaps = 15/540 (2%)

Query: 104 VEYP-LLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDP 162
           VEY  L+ + EPD++ ++     ++  +A +LK +GN +F  K + +AI YY++A++L  
Sbjct: 58  VEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-K 116

Query: 163 NDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 222
           NDPVFYSN++ACYIS     + +E  +KALE+ PD+SK LL+RA+  E++G F DA+ DL
Sbjct: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDL 176

Query: 223 SVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFD 282
           + +SLNGD++  +I+P++ER LNKQAM  L + L  +  +K   +LPS TS+A+FFG+FD
Sbjct: 177 TAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNK---VLPSYTSMAAFFGVFD 233

Query: 283 PDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKED 342
            + +   +      + +   LS+AL  LYS T EGY   D   TKAT+ Y + L  ++ +
Sbjct: 234 AETD---IPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTN 290

Query: 343 RVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEF 402
            V  E AA+AF +  I  FLKND L A+ L+ E+I LHP P SY+++ L +ADK   +E+
Sbjct: 291 SVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEY 350

Query: 403 FKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLY 462
           +  FQ AIDLDP     YYHRGQM FI+Q Y  A  DF KA+  +P N++PYIQLAC+ Y
Sbjct: 351 YSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSY 410

Query: 463 KQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           ++  F + E+LF+EA+ KFP  PEVP F+AEIL+DKG+   A  +YD A  LE   + IH
Sbjct: 411 REGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIH 470

Query: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQM 582
           VGI PL+GKAT L +     PT    E F  A +L  +A   DPRSE+AK+GLAQ +LQ 
Sbjct: 471 VGIAPLVGKATTLLKY----PTV---ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQ 523

Query: 583 EKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQG 642
           E +D AI+LF+E+A L RT+DEKLQATTFAEA K+Q R+RAD  + AK  + L   R  G
Sbjct: 524 EDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 83/184 (45%), Gaps = 15/184 (8%)

Query: 107 PLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPV 166
           P L   EP  +      AP+    A  LK +GN  F AK F  A+K Y  AIEL PN+ V
Sbjct: 73  PTLSSSEPTGNNTDA-HAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131

Query: 167 FYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVL 225
           FY N +A Y S    ++ V     A+ I P +S+   R   A  +LG   +AM     VL
Sbjct: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191

Query: 226 SLNGDFDGTSIEPMLE--RNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDP 283
            + GD    + E M     +  K+  + LN   L  G+++        TS  S  G F P
Sbjct: 192 DIEGD---NATEAMKRDYESAKKKVEESLNLEALPKGEEQQ-------TSEGSSAGGF-P 240

Query: 284 DLET 287
           DL +
Sbjct: 241 DLSS 244

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 85/187 (45%), Gaps = 9/187 (4%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A++ KD+GN F  +K +G AI+ Y  AIELD    +F+SN +   +        +E ++K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGT------SIEPMLERNL 244
           A+E+   + K   RR  A   L +F  A  DL V+      + T      + E M+ R  
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATAKRTLLACERMIRRER 128

Query: 245 NKQAMKVL--NESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSASAT 302
            ++A++    NE   +     S ++   NT +  + GI + +LE  R   G         
Sbjct: 129 FEKAIRASGGNEEQQRLCKTLSLEMFAGNTDVGKYGGI-ELELEQVRDAAGGAAGVRVCN 187

Query: 303 LSEALQS 309
           +S+   S
Sbjct: 188 MSQVFIS 194

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 409 AIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYP-YIQLAC-LLYKQDK 466
           AI+LD      Y+ RG  Y  LQD+I+AK D +    + PG        LAC  + ++++
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATAKRTLLACERMIRRER 128

Query: 467 FSEA 470
           F +A
Sbjct: 129 FEKA 132

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAI--ELDPNDPVFYSNISACYISTGDLDKVVEYT 188
           A +LK KGN  F +K F  AI+Y+  AI     PN  V YSN SACY S     + +   
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNH-VLYSNRSACYTSLKQFQEALNDA 62

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I PD SK   R  +A+  LG+  DA
Sbjct: 63  QQCVKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + ++   KA+E  P
Sbjct: 396 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDP 455

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A LR+A+A  ++ +F  A+  L
Sbjct: 456 NFVRAYLRKATAQIAIKDFVKALETL 481

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 71/151 (47%), Gaps = 6/151 (3%)

Query: 129 AFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYT 188
           A AV+ K++GN F   +++  AI+ Y  AIELDPN  +FYSN +   +   +        
Sbjct: 10  AKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPM--LERNLNK 246
            +AL +   + KA  RR  AN  L  F  A  DL+V+      D T++  +   ER + +
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVVLKAKPSDATALRALNVCERFIRE 129

Query: 247 QAMKVLNESLLKNGDDKSSQILPSNTSLASF 277
           +  K      +  G D     L    +L+SF
Sbjct: 130 ERFK----KAIGGGIDGEQVKLCQTLNLSSF 156

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 74/150 (49%), Gaps = 9/150 (6%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A+ LK++GN +   K +  A++YY  AIELD    +F+SN +   +   +    ++    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMK 250
           ALE+ P + KA  RR  +   L +F  A  DLS++      D T+     +R L+    K
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDATA-----KRALD-MCEK 126

Query: 251 VLNESLLKN--GDDKSSQILPSNT-SLASF 277
           V+ E   K   G D + ++ P    +L+SF
Sbjct: 127 VIREERFKKAIGGDDTDRVNPCQVLNLSSF 156

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  FTAK +G AI  +  AIE+   PN  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNH-VLYSNRSACYTSLKKFTDALNDA 63

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
           T+ ++I P  SK   R  +A+  LG+  DA
Sbjct: 64  TECVKINPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + +    KA+E  P
Sbjct: 399 EGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 458

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++  F  A+  L
Sbjct: 459 NFVRAYIRKATAQIAVQEFAGALETL 484

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK F  AI+ +  AIE+   PN  V YSN SACY ST   +K +E  
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNH-VLYSNRSACYTSTKQFNKALEDA 61

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + ++    A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++  F   +  L
Sbjct: 459 NFIRAYIRKATAQIAVREFVSVIETL 484

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 7/120 (5%)

Query: 112 GEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNI 171
           GEP       ++A + +  A  LK +GN    AK +  AI+ Y  AIE+ P D V+Y+N 
Sbjct: 77  GEPK------VAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 172 SACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGD 230
           +A Y S    +K VE   KA ++   +SK   R   A  +LG   +A+     VL + GD
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + KD+GN  F AK++ +AI+ +  AIE+   PN  V YSN SACY S     K +E  
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNH-VLYSNRSACYTSKKQFVKGLEDA 63

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I  DP+D   YSN +A         + +     A+E  P
Sbjct: 395 EGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDP 454

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++ +F  A+  L
Sbjct: 455 NFIRAYIRKATAQIAIKDFVPAIETL 480

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 74/187 (39%), Gaps = 11/187 (5%)

Query: 328 ATDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYV 387
           A +  H  +   +E R   +  A +F          ND+  A    Q+S+  H T     
Sbjct: 307 AIETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSLTEHRT----- 361

Query: 388 FMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLN 447
             A  +    N+++  K  ++   ++PE        G+ YF   D+ NA   + +  + +
Sbjct: 362 --AEVLTKLRNAEKLLKKQESEAYINPEKAEEARLEGKEYFTKGDWPNAVKAYTEMIARD 419

Query: 448 PGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFP--ILPEVPTFYAEILTDKGDFNPAI 505
           P +   Y   A  L K   F EA +  N A  K P  I   +    A+I     DF PAI
Sbjct: 420 PSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRKATAQIAIK--DFVPAI 477

Query: 506 KQYDIAK 512
           +  D A+
Sbjct: 478 ETLDAAR 484

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A++ K++GN F   K + +A++YY  AIELD    +F+SN +   +   +    +E   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           ++E+ P + KA+ RR  +   L  F+ A  DL  +
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK F  AI+ +  AIE+   PN  V YSN SACY S     + +   
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNH-VLYSNRSACYASMRKFREALADA 62

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + + IKPD SK   R  +A+  LG+  +A
Sbjct: 63  QECVRIKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 99  KSAEDVEYPLLPHGEPD-MDRLRGLSAPQRQAFAVQLKD---------KGNHFFTAKSFG 148
           K+ E  E  L  H  P+ +++LR L   Q++  A    D         +G  +FT   + 
Sbjct: 346 KAIEYYEKSLTEHRTPEVLNKLRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWP 405

Query: 149 DAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASA 208
           +A+K Y   I+  P D   YSN +A           ++    A++  P+  +A +R+A+A
Sbjct: 406 NAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATA 465

Query: 209 NESLGNFTDAMFDL 222
             ++  +  A+  L
Sbjct: 466 QIAVQEYAAAIETL 479

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           +A A  LK +GN    +K F  AIK Y  AIE+ P++ V+Y+N +A Y S    ++ V+ 
Sbjct: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQD 153

Query: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
              A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 154 AESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPN-DPVFYSNISACYISTGDLDKVVEYTT 189
           A + K +GN  FT+K F  AI+ +  AIE+ P  + V YSN SA Y S     + +   T
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 190 KALEIKPDHSKALLRRASANESLGNFTDA 218
           + ++I P  SK   R  +A   LGN  +A
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 42/83 (50%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + ++    A++  P
Sbjct: 395 EGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDP 454

Query: 197 DHSKALLRRASANESLGNFTDAM 219
           +  +A +R+A+A  ++  + +A+
Sbjct: 455 NFVRAYIRKATAQIAIKEYANAL 477

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           +++A A++L+  GN   + K++  AI  Y  AIE+ P++P +YSN +A Y    D    V
Sbjct: 95  KKEAEALKLE--GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAV 152

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
                A+++ P +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 153 LDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A +LK +GN     K F  AI  Y  AI + PN+ ++Y+N +A Y S  D +K  E    
Sbjct: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAES 158

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK F  A + +  AIE    PN  V YSN SACY S     + +E  
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNH-VLYSNRSACYTSLKKFKEALEDA 61

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A   LGN  DA
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 5/106 (4%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  FFT   +  A+  Y   I+  P D   YSN +A           ++    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 197 DHSKALLRRASANESLGNFTDAMFDLSV-----LSLNGDFDGTSIE 237
           +  +A +R+ASA  ++  F  AM  L       L +N   +   IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A Q K +GN  F +K +  AI+ +  AIE+   PN  V +SN SACY S  D  K ++  
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNH-VLFSNRSACYASNKDFVKALDDA 61

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  +K   R  +A+  LG+  +A
Sbjct: 62  NECVKINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 10/128 (7%)

Query: 105 EYPLLPHGEPD-MDRLRGLSAPQRQAFAVQLKD---------KGNHFFTAKSFGDAIKYY 154
           E  L  H  PD + +LR      +Q  A    D         +G  +FT   +  A++ Y
Sbjct: 353 EKSLTEHRTPDILTKLRNTEKELKQKEAESYMDPEKAEEARLQGKEYFTKADWPKAVEAY 412

Query: 155 QYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGN 214
              I+ +PND   YSN +A           +    KA+E  P+  +A +R+A+   ++ +
Sbjct: 413 TEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRKATGQIAIKD 472

Query: 215 FTDAMFDL 222
           +  A+  L
Sbjct: 473 YAGAIETL 480

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 12/132 (9%)

Query: 99  KSAEDVEYPLLPHGEPDMDRLRGLSAPQR----QAFAVQLKDKGNHFFTAKSFGDAIKYY 154
           KS    E    P  EP ++  +    P      ++ A   K +GN  +  + F +AI+ Y
Sbjct: 219 KSEPKAEPKAEPKAEPKVETKKPEPEPMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKY 278

Query: 155 QYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKAL----EIKPDH---SKALLRRAS 207
             A E   ND  + +N +A     GD +  +E  TKA+    E++ D+   SK+  R  +
Sbjct: 279 NEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGN 337

Query: 208 ANESLGNFTDAM 219
           +   LG+   A+
Sbjct: 338 SYHKLGDLKKAI 349

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +GN    AK F +AI+ Y  AIE+ P++ V+YSN +A Y S    ++ V+   +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 197 DHSKALLR 204
            +SK   R
Sbjct: 161 TYSKGFSR 168

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 1/106 (0%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           +++A A  LK +GN     K +  AIK Y  AIE+ P + V+Y+N +A Y S    D  V
Sbjct: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAV 147

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 72/157 (45%), Gaps = 8/157 (5%)

Query: 123 SAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLD 182
           S P  +A A++ KD+GN +  ++ +  AI+ Y  AIELD    +FYSN +  ++   +  
Sbjct: 5   SKPDAEA-ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQ 63

Query: 183 KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLER 242
             +     A+++  ++ KA  RR  A   L  F  A  DL++L      D T+     +R
Sbjct: 64  SALHDCNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKYKPNDATA-----KR 118

Query: 243 NLNKQAMKVLNESLLK--NGDDKSSQILPSNTSLASF 277
            L      +  E   K   GDD     L    SL+SF
Sbjct: 119 GLEMCESFIREERFKKAIGGDDHGKVKLCQTVSLSSF 155

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 10/166 (6%)

Query: 123 SAPQRQ----AFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYIST 178
           S P+R     A A+  K++GN +  AK +  A++ Y  AIE D    +F+SN +   +  
Sbjct: 26  SPPRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKL 85

Query: 179 GDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL--SLNGDFDGTSI 236
                 +E + +A+E+   + KA  RR  A+  L  +  A  DL V+  +  GD      
Sbjct: 86  DRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRA 145

Query: 237 EPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFD 282
             + ER L ++      E  ++   D+  + L    SLASF G  D
Sbjct: 146 LEVCERMLRRERF----ERAIRADGDEEQRRLCKTLSLASFAGNAD 187

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 46/95 (48%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A   KD+GN F   + F  A + Y  AIE DP   +FYSN +   +   +    +   T 
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           A+E+   + KA  RR  AN  L NF  A  D +++
Sbjct: 69  AIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 1/104 (0%)

Query: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           +A A   K +GN    AK +  AI+ Y  AI+  P + ++Y+N +A Y S  + D  ++ 
Sbjct: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155

Query: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGD 230
             KA+EI P +SK   R A A  +L    +A+ +   VL + GD
Sbjct: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A++ K++GN     + +  AI+ Y  AIELD    V++SN + C++   +     +   K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           AL + P + KA  RR  A   L  F  A  DL+V+
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A++ K++GN F   K+F  A + Y  AIELD    +++SN +  ++   +    +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           A+E+ P + KA  RR  +   L  F  A  DL ++
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  FTAK +  AI+ +  AIE+   PN  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNH-VLYSNRSACYTSLKKFSDALNDA 63

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A+  LG+  +A
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + +    KA+E  P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++  +  A+  L
Sbjct: 462 NFVRAYIRKATAQIAVKEYASALETL 487

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  FTAK +  AI+ +  AIE+   PN  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNH-VLYSNRSACYASLKKFSDALNDA 63

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 64  KECININPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + +    KA+E  P
Sbjct: 402 EGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++  +  A+  L
Sbjct: 462 NFVRAYIRKATAQIAVQEYAAALETL 487

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK +  AI  +  AIE+   PN  VFYSN SACY S     + +   
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNH-VFYSNRSACYASLKKFPEALNDA 62

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A+  LG+  +A
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + +E   KA+E  P
Sbjct: 396 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDP 455

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++  F  A+  L
Sbjct: 456 NFIRAYIRKATAQIAVKEFAAAIETL 481

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPN-DPVFYSNISACYISTGDLDKVVEYTT 189
           A + K +GN  F+AK +  A+  +  AIE+ P  + V YSN SACY S       +    
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 190 KALEIKPDHSKALLRRASANESLGNFTDA 218
           +  +I P  SK   R  +A+  LG+  +A
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A + + +G  FF    + DA+K Y   I   P+D   YSN +A         + +    K
Sbjct: 392 AEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEK 451

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 224
           ALE  P+  KA +R+A+A  ++  ++ A+  L +
Sbjct: 452 ALEKDPNFVKAYIRKATAQIAIKEYSSALETLDI 485

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 8/91 (8%)

Query: 135 KDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKAL-- 192
           KD+GN  + A  F +AI++Y  A EL  ND  + +N +A     GD +  ++    A+  
Sbjct: 262 KDEGNKLYKAHKFDEAIEHYDKAWELH-NDITYLNNKAAAQYEKGDYETTIKTLEDAIEK 320

Query: 193 --EIKPDH---SKALLRRASANESLGNFTDA 218
             E++ D+   +KA  R  +A E L +   A
Sbjct: 321 GRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%)

Query: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           +A A++ K++GN F   K F  AI+ Y  AI+LD    +++SN +  +    +    +  
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
             +AL++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 69  CDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           AV  K++GN +   +++  AI+ Y  AIELDP   +F+SN +   +   +    +     
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDV 71

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMK 250
           AL + P + KA  RR  ++  L     A  DL V+      D T+   +          K
Sbjct: 72  ALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDATAKRAL------AMCEK 125

Query: 251 VLNESLLK---NGDDKSSQILPSNTSLASF 277
           V+ E   K    GDD+         SL SF
Sbjct: 126 VIREERFKKAIGGDDQDKLNFCQTMSLKSF 155

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           + +A A  LK +GN     K F  AIK Y  AIE+ P + V+Y+N +A + S    ++ +
Sbjct: 92  ETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAI 151

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           +    A++  P +SK   R   A  +LG   DA+     VL + GD
Sbjct: 152 KDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           AV   ++     + K++ +AIK  + AI+ DP     YS +     + G  +  +E   K
Sbjct: 131 AVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKK 190

Query: 191 ALEIKPDHSKALLRR 205
            L+I+ D +  +++R
Sbjct: 191 VLDIEGDKASDVMKR 205

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKAL 192
           Q K++GN  F   S+  A + YQ  ++++P +P+ YSN +   I  G   +VVE   K L
Sbjct: 5   QYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGL 64

Query: 193 EIKPDHSKALLRR 205
              P+ +  + ++
Sbjct: 65  TFTPNTTDTVYKK 77

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIE--LDPNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK F  A++ +  AI+   +PN  V YSN S  Y S    D+ +   
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNH-VLYSNRSGAYASLKKFDEALSDA 62

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
           T+ ++IK D SK   R  +A+  LGN  +A
Sbjct: 63  TECVKIKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 63/136 (46%), Gaps = 10/136 (7%)

Query: 99  KSAEDVEYPLLPHGEPD-MDRLRGLSA--PQRQAFAVQLKDK-------GNHFFTAKSFG 148
           K+ E  E  L  H  PD +++LR L     +R+A A    +K       G  +FT   + 
Sbjct: 350 KAVEYYEKSLTEHRTPDVLNKLRNLEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWP 409

Query: 149 DAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASA 208
            A+K Y   I   P+D   YSN +A           ++   KA+EI P   +A +R+A+A
Sbjct: 410 SAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKATA 469

Query: 209 NESLGNFTDAMFDLSV 224
             ++  ++ A+  L V
Sbjct: 470 QIAVQEYSAAIETLDV 485

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 51/95 (53%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A++LK++GN F   K +  A +YY  AIE DP + + YSN +   +   +    ++   +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKR 72

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           A+E+  ++ KA  RRA +   L  F  A  DL ++
Sbjct: 73  AIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPN-DPVFYSNISACYISTGDLDKVVEYTT 189
           A + K +GN  FTAK++  AI+ +  AIE+      V +SN SACY S       +    
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 190 KALEIKPDHSKALLRRASANESLGNFTDAMFD 221
           + ++I P  SK   R  +A+  LG+  +A  D
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 10/136 (7%)

Query: 99  KSAEDVEYPLLPHGEPD-MDRLRGLSAPQRQA---------FAVQLKDKGNHFFTAKSFG 148
           K+ E  +  L  H   D + +LR +   Q++A          A + + +G  +FT   + 
Sbjct: 354 KTIEYYQKSLTEHRTADILAKLRNVEKEQKKAEAEAYINPDKAEEARLEGKEYFTKSDWP 413

Query: 149 DAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASA 208
           +A+K Y   I+  P D   YSN +A         + +    KA+E  P+  +A +R A+A
Sbjct: 414 NAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAA 473

Query: 209 NESLGNFTDAMFDLSV 224
             ++  F  A+  L V
Sbjct: 474 QIAVKEFAAALETLDV 489

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK + +A+  +  AIE+   PN  V YSN SA Y S    ++ ++  
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNH-VLYSNRSASYASEQKFNEALKDA 63

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            +  +I P  +K   R  +A+  +GN  DA
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV----E 186
           A + K +GN  + A++F +AI  Y  A ELD N+  + +N SA     G+ D  +    E
Sbjct: 251 AEEAKVEGNKAYKARNFDEAIACYNKAWELD-NNITYLNNRSAAEFEKGEYDTAINTLNE 309

Query: 187 YTTKALEIKPDH---SKALLRRASANESLGNFTDAM 219
              K  E++ D+   +K+  R  +A   +GN  +A+
Sbjct: 310 AIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   +  A+K Y   I+  P D   YSN +A           +    KA+E  P
Sbjct: 391 EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDP 450

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++ +F+ A+  L
Sbjct: 451 NFVRAYIRKATAQIAVKDFSYAIETL 476

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 4/131 (3%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           + +A A  LK +GN    AK F  A+  Y  AI++ P + V+Y+N +A + S    ++ V
Sbjct: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLN 245
           +    A+++ P +SK   R   A  +LG   +A   L       D +G +    ++R+ +
Sbjct: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA---LDAYKKVLDIEGEAATDAMKRDYD 208

Query: 246 KQAMKVLNESL 256
             AMK + +SL
Sbjct: 209 -TAMKKVGQSL 218

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 53/98 (54%)

Query: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           +A A++ K++GN F   K F  AI+ Y  AI+LD    +++SN +  +    +    +  
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
             +A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTT 189
            A   KD+GN    ++ +  AI+ Y  AI   P DP++YSN S  Y+   D +  +    
Sbjct: 136 IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195

Query: 190 KALEIKPDHSKALLRRASANESLGNFTDAM 219
             + I  + SKA +R A+       + DA+
Sbjct: 196 FCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A++ K++GN +   K + +A++YY  AIELD    +++SN +   +   +     E   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           A+ + P + KA+ RR  +   L  F  A  DL V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 129 AFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYT 188
           A A++ K++GN F   K F  AI+ Y  AI+LD    +++SN +  +    +    +   
Sbjct: 10  AKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
            +A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           + +A A  LK +GN     K F  AI  Y  AIE+ P + ++Y+N +A + S    D+ V
Sbjct: 88  ETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAV 147

Query: 186 EYTTKALEIKPDHSKALLR 204
               KA+EI P +SK   R
Sbjct: 148 VDAEKAIEIDPAYSKGYSR 166

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 122 LSAPQRQ--AFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTG 179
           +S+P ++  A A+  K+KGN +     +  AI++Y  AI LD    +++SN +  ++   
Sbjct: 1   MSSPSQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQD 60

Query: 180 DLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           +    V     AL++ P + KA  RR  +   +  F  A  DL+V+
Sbjct: 61  NFYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 134 LKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE 193
           LK +GN     K +  AIK Y  AI   P + V+++N +A Y S    D+ VE    A++
Sbjct: 103 LKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162

Query: 194 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           I P +SK   R   A  + G   DA+     VL + GD
Sbjct: 163 INPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKAL 192
           +LK KGN  F   S+ +AI +Y   I +DP++P+ YSN +   +     D+ +    K L
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGL 64

Query: 193 EI 194
           ++
Sbjct: 65  QL 66

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 59/106 (55%), Gaps = 1/106 (0%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           + +A A  LK +GN    +K +  A++ Y  AI++ P + V+++N +A Y ++ + D+ V
Sbjct: 96  ETKAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAV 155

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           +   +A+++ P +SK   R A A     NF +++     VL + GD
Sbjct: 156 KDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%)

Query: 129 AFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYT 188
           A A++ K++GN     + +  AI+ Y  AI+LD    +++SN +  ++   +    +   
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
            KALEI P + KA  RR  +   L  F +A  DL ++
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%)

Query: 129 AFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYT 188
           A A  LK +GN    AK +  A++ Y  AI+L P   V+Y+N +A Y S    D+ ++  
Sbjct: 101 AKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDA 160

Query: 189 TKALEIKPDHSKALLR 204
             A++++P+ SK   R
Sbjct: 161 ESAIKVEPNWSKGYSR 176

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 1/104 (0%)

Query: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           +A A   K +GN     K F  A++ Y  AI++ P + ++Y+N +A + S  + ++ ++ 
Sbjct: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157

Query: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
              A++I P +SK   R A A   LG   +A+     VL + GD
Sbjct: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 52/100 (52%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           ++ A A++LK++GN F   + F  AI  Y  AI LD    +++SN +  ++   +    +
Sbjct: 7   EQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSL 66

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
               +AL++ P ++KA  RR  +   L  F  A  DL ++
Sbjct: 67  NDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 38/89 (42%), Gaps = 1/89 (1%)

Query: 363 KNDLLDAQALLQESINLHPTPNSYVF-MALTVADKENSQEFFKFFQNAIDLDPEYPPTYY 421
           K D   A  L  ++I L  T + Y    AL     +N Q        A+ LDP+    Y+
Sbjct: 25  KQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNAKAYH 84

Query: 422 HRGQMYFILQDYINAKSDFQKAQSLNPGN 450
            RG  Y  L ++  AK+D Q      PG+
Sbjct: 85  RRGLSYIGLLEFKKAKNDLQIVLKAKPGD 113

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK +  AI  +  AIE+   PN  V YSN SACY S    ++ ++  
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNH-VLYSNRSACYASNKKFEEALKDA 61

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A   L    +A
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  FFT   + +A+K Y   ++  P D   +SN +A         + +E   KA+ I P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 197 DHSKALLRRASANESLGNFTDAMFDLSV 224
           +  +A +R+A+A  ++  F  A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK +  AI  +  AI++   PN  V YSN SACY S       ++  
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNH-VLYSNRSACYTSLKKFVNALKDA 63

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P D   YSN +A         + ++   KA+E  P
Sbjct: 403 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDP 462

Query: 197 DHSKALLRRASANESLGNFTDAMFDL 222
           +  +A +R+A+A  ++  F+ A+  L
Sbjct: 463 NFVRAYIRKATAQIAVREFSSALETL 488

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 54/135 (40%), Gaps = 14/135 (10%)

Query: 349 AALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQN 408
           A +  CY  +     NDL  A    ++S+  H TP   +   L  A+K+         Q 
Sbjct: 341 ARMGNCYTKL-----NDLKKAIDFYKKSLTEHRTPE--ILSKLRAAEKQVK------IQE 387

Query: 409 AID-LDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKF 467
           A D ++PE        G+ YF   D+ NA   + +     P +   Y   A +L K   F
Sbjct: 388 AEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSF 447

Query: 468 SEAESLFNEAKLKFP 482
            EA    N+A  K P
Sbjct: 448 PEAIDDCNKAIEKDP 462

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 96/233 (41%), Gaps = 29/233 (12%)

Query: 348 NAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFF---- 403
           NA   +C  G F  L+ D  DA    +++  + P   ++ +       + +S + F    
Sbjct: 533 NAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDP---NFAYAYTLQGHEHSSNDSFDTAK 589

Query: 404 KFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYK 463
             ++ A+  DP++   YY  G     L  Y  A   F+KA+S+NP NV   I + C    
Sbjct: 590 NCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV---ILICCCGVA 646

Query: 464 QDKFSEAESLFNEAKLKFPILP--EVPTF-YAEILTDKGDFNPAIKQYDIAKRLEEVQKK 520
            +K    E   +  +L   + P   +  F  A +L   G ++ A++ ++   +L   +  
Sbjct: 647 LEKLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEAT 706

Query: 521 IHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKI 573
           +H  +G L     IL R+               A++  T A  LDP+  Q  I
Sbjct: 707 VHFLLGQLY---QILGRKKD-------------AVKEFTIAMNLDPKGNQLII 743

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 73/188 (38%), Gaps = 20/188 (10%)

Query: 414 PEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESL 473
           P  P T+   G    + +D+ +A   F+KA  ++P   Y Y          D F  A++ 
Sbjct: 532 PNAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNC 591

Query: 474 FNEAKLKFPILPEVPTFYAEILT--DKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGK 531
           + +A    P       +Y   ++    G ++ A+  ++ A+ +  +   +    G  + K
Sbjct: 592 YRKALACDP--QHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEK 649

Query: 532 ATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKL 591
                        Q  E+    A+     ACEL P S  A    A L   M +  VA++ 
Sbjct: 650 L------------QYQEK----ALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQY 693

Query: 592 FQESATLA 599
           F+E   LA
Sbjct: 694 FEELTKLA 701

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 33/83 (39%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           GN     K   DAIK ++ A ++DPN    Y+     + S    D       KAL   P 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 198 HSKALLRRASANESLGNFTDAMF 220
           H  A      +   LG + +A+ 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALL 624

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 134 LKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE 193
           LK KGN FF    +  A+ YYQ AI  DP++P+ YSN +   I      + V+   K L+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 194 -IKPDHSK 200
            I P++ K
Sbjct: 67  MICPENDK 74

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 423 RGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFP 482
           +G ++F   DY  A   +QKA + +P N   Y   A  L K +K+SEA    N+  LK  
Sbjct: 10  KGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKG-LKM- 67

Query: 483 ILPE 486
           I PE
Sbjct: 68  ICPE 71

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%)

Query: 129 AFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYT 188
           A A++ KD+GN F   + F  A + Y  AIELD    +F+SN +  ++   +    +   
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
            KALE+   + KA  RR  +   L  F  A  DL  +
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 3/111 (2%)

Query: 363 KNDLLDAQALLQESINLHPTPNSYVF-MALTVADKENSQEFFKFFQNAIDLDPEYPPTYY 421
           K D + A  L  ++I L  T + +    AL    ++N Q        A++LD +    Y+
Sbjct: 25  KQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSKNIKAYH 84

Query: 422 HRGQMYFILQDYINAKSDFQKAQSLNPGNVYP--YIQLACLLYKQDKFSEA 470
            RG  Y  L ++  A++D +      PG+V     +Q+     ++++F +A
Sbjct: 85  RRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEKFIREERFKKA 135

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK +  AI  +  AIE+   PN  V YSN SA Y S+   ++ +   
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNH-VLYSNRSAAYTSSKQYEQALSDA 63

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  +K   R+ +A + L  + +A
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +FT   + +A+K Y   I+  P+D   YSN +A           +    KA+E  P
Sbjct: 391 EGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDP 450

Query: 197 DHSKALLRRASANESLGNFTDAMFDLSV 224
              +A LR+A+   ++  F  A+  L +
Sbjct: 451 SFIRAYLRKATCQIAVKEFAGAIETLDL 478

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 7/149 (4%)

Query: 364 NDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHR 423
           +DL  A    Q+S+  H TP+  +   L  A+K+  Q+  + +     L PE        
Sbjct: 339 DDLKKAIEYYQKSLTEHRTPD--ILSKLRKAEKDLKQQEAEAY-----LSPEKAEEARLE 391

Query: 424 GQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPI 483
           G+ YF   D+ NA   + +     P +   Y   A  L K   F +A S  N+A  K P 
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 484 LPEVPTFYAEILTDKGDFNPAIKQYDIAK 512
                   A       +F  AI+  D+A+
Sbjct: 452 FIRAYLRKATCQIAVKEFAGAIETLDLAR 480

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A + K++GN     K F  AI+ Y  AI+LD    +++SN +  +    +    +    +
Sbjct: 12  AHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDE 71

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225
           A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK +  A + +  AI++   PN  V YSN SACY S     + ++  
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNH-VLYSNRSACYTSLKKFAEGLKDA 62

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A   L N  DA
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  +F+   + +A+K Y   I+  P D   YSN +A         + +    +A+E  P
Sbjct: 388 EGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDP 447

Query: 197 DHSKALLRRASANESLGNFTDAMFDLSVL 225
           +  +A +R+ASA  ++  F  A+  L  +
Sbjct: 448 NFIRAYIRKASAQIAVKEFAAAVETLDTV 476

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%)

Query: 134 LKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE 193
           LK +GN FF    +  A  YY   I+L+P +P+ YSN +   I  G+    VE   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 194 IKPDHSK 200
                +K
Sbjct: 66  YTSSSTK 72

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPN----DPVFYSNISACYISTGDLDKVV 185
            A   K++GN  +  K F DA   Y  A+++  +    +   Y N++AC +   +    +
Sbjct: 69  IATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCI 128

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAM 219
            Y  +AL++   + KA  R   A   LG F D++
Sbjct: 129 NYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 41/72 (56%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
            D+I+++Q AI +DPND   +  +   Y+  G ++  ++   KA+E+   H+ A   ++ 
Sbjct: 682 SDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSI 741

Query: 208 ANESLGNFTDAM 219
           A   +G FT+++
Sbjct: 742 ALSEMGEFTESI 753

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 20/114 (17%)

Query: 490 FYAEILTDKGDFNPAIKQYDIAKRL---EEVQKKIHVGIGP--LIGKATILARQSSQDPT 544
           +  E+     +++ A++   IA+RL   E+ ++ +     P  +IG    L RQ   D  
Sbjct: 630 YMTEVYAKSNNWSSAVQ---IAERLVKAEKAKRVLQTMNWPYRVIGIGN-LERQQESD-- 683

Query: 545 QLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATL 598
                    +IE    A  +DP   ++ IGL Q  L   +I+ +IK+F+++  L
Sbjct: 684 ---------SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIEL 728

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 10/120 (8%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPND----PVFYSNISACYISTGDLDKVVE 186
           A   K++ N  + AK F +A + Y+  IE+  ND       ++N++AC +   +  + + 
Sbjct: 78  AENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCIN 137

Query: 187 YTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDLSVLSLNGDFDGTSIEPMLER 242
              KAL+  P + K   R A A   L    +A     F L++ S N      ++E +++R
Sbjct: 138 LCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSL--QTLEGVIDR 195

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 59/141 (41%), Gaps = 11/141 (7%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPV----FYSNISACYISTGDLDKVV 185
            A   K +GN  + AK F DA + Y   I ++  D       ++N +AC +   +  + +
Sbjct: 82  IAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCI 141

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLN 245
           E  +KAL I P + K   R + A  SL    +A            F   SIEP  +  LN
Sbjct: 142 EDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA-------KSAAIFANQSIEPENKSILN 194

Query: 246 KQAMKVLNESLLKNGDDKSSQ 266
             ++    E  LK  + K  Q
Sbjct: 195 MLSVIERKEQELKIKEQKKQQ 215

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A +LK+KGN    AK +  AI  Y  AI+L P +  +Y+N +  YI   + D  +    K
Sbjct: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193

Query: 191 ALE----IKPDHSKALLRRASANESLGNFTDAM 219
           ++E    I P + KA  R   A   +G++  ++
Sbjct: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELD--PNDPVFYSNISACYISTGDLDKVVEYT 188
           A + K +GN  F AK +  A + +  AIE    PN  V YSN SAC+ S    ++ +   
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNH-VLYSNRSACFTSLKKFNEALNDA 61

Query: 189 TKALEIKPDHSKALLRRASANESLGNFTDA 218
            + ++I P  SK   R  +A   LG   +A
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 10/125 (8%)

Query: 108 LLPHGEPD-MDRLRGLSAPQR----QAF-----AVQLKDKGNHFFTAKSFGDAIKYYQYA 157
           L  H  PD + +LR     Q+    QA+     A + + +G  +FT   + +A+K Y   
Sbjct: 368 LTEHRTPDILTKLRNCEKEQKVREAQAYIDPEKAEEARLQGKEYFTKGDWPNAVKAYTEM 427

Query: 158 IELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTD 217
            +  P D   YSN +A         + ++    A+   P+  +A +R+A+A  ++  F  
Sbjct: 428 TKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFAS 487

Query: 218 AMFDL 222
           A+  L
Sbjct: 488 AIETL 492

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEI 194
           F + K F +A+      ++++P     Y+ + A Y   G LD+  +   KALEI
Sbjct: 48  FTSLKKFNEALNDANECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEI 101

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 7/89 (7%)

Query: 134 LKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKAL- 192
           +K++GN  F   +F  A +YY   I L+P +P+ YSN +   I      + ++   + L 
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLG 66

Query: 193 ------EIKPDHSKALLRRASANESLGNF 215
                 + +P   K L R   A ESL  F
Sbjct: 67  KLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+T   F   I  ++ A++++PND + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 468 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 527

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSLN 228
           A    A ++ ++G F +A  + LSVLS++
Sbjct: 528 ARYNLAVSSMNIGCFKEAAGYLLSVLSMH 556

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+T   F   I  ++ A+ ++PND + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSL 227
           A    A ++ ++G F +A  + LSVLS+
Sbjct: 527 ARYNLAVSSMNIGCFKEAAGYLLSVLSM 554

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G  F+  + FG  I  ++ A+E++PND + ++ + A   ++   ++ ++   KAL +KP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 198 HSKALLRRASANESLGNFTDAMFD-LSVLSLN 228
             +A    A ++ ++G + +A    LS LS++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 73/191 (38%), Gaps = 20/191 (10%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
            PN+Y    + + +     E    F+ A+  DP +   +   G +    +  +N  S  +
Sbjct: 277 NPNAYEIGCILMENGAKLSEAALAFEAAVQEDPAHVDAWLKLGLVQTQNEKEMNGISALE 336

Query: 442 KAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA-KLKFPILPEVPTFYAEILTDKGD 500
           +  SL+P N    + ++     +     A S+ N     K+P L   PT   E   D+ +
Sbjct: 337 QCLSLDPTNQQALMTISISYINEGYDLTAFSMLNRWLDSKYPELTRSPTI-DEANIDRFN 395

Query: 501 FNPAI--KQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELL 558
            +  +  K   +A  L +V  ++ +G+G L                    E+F   I+  
Sbjct: 396 LSKQVITKYLQVANALPQVDPEVQLGLGTLF----------------YANEEFGKTIDCF 439

Query: 559 TKACELDPRSE 569
             A E++P  E
Sbjct: 440 RTALEVNPNDE 450

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 42/72 (58%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
            D+I+++Q A+ +DPND   +  +   Y + G ++  ++   KA+E++P H+ A   RA 
Sbjct: 712 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPSHTYARYFRAL 771

Query: 208 ANESLGNFTDAM 219
           +   +G + +++
Sbjct: 772 SLCDMGEYLESL 783

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 51/121 (42%), Gaps = 4/121 (3%)

Query: 406  FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
            F  A  L+P+    +++   +     D   A+    + QSL P +  P++ +A +L +Q 
Sbjct: 1001 FIKATALEPKATDIWFNLAMLGLKKNDTEFAQQVLNRLQSLAPQDSSPWLGMALILEEQG 1060

Query: 466  KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
               E+  LF  +     IL    +  A++L  K      I   D  + +E V+K   V I
Sbjct: 1061 NIVESSKLFAHSY----ILSNGRSKAAQVLYAKSVLENHIDNGDDERDIETVEKLTTVSI 1116

Query: 526  G 526
             
Sbjct: 1117 A 1117

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           + +A A +LK +GN     K +  AIK Y  AI++ P + ++Y+N +A + S  + D+ +
Sbjct: 97  ETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAI 156

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           +    A+ + P + +   R   A  + G   +A+     VL + GD
Sbjct: 157 KDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 52/111 (46%), Gaps = 8/111 (7%)

Query: 109 LPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFY 168
           L   E     LR +S P R          G  +   +   ++I+++Q A+ +DP D   +
Sbjct: 665 LVKSEKSKKALRKVSWPYRIL--------GVAYLEKQQDAESIQWFQLALRIDPTDVESW 716

Query: 169 SNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 219
             +   Y++ G ++  ++   +AL++   HS AL  +A  +  LG + +++
Sbjct: 717 IGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAVCHSQLGEYEESL 767

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 406  FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
            F  A+ L P  P   +    +     D   A     KAQ+++P    P++ LA L  K++
Sbjct: 985  FIKAMSLSPRDPTIIFAYAMLSLRCNDIDLATQLINKAQTISPAESSPWLGLALLNEKKN 1044

Query: 466  KFSEAESLFNEA 477
              S + SLF+ A
Sbjct: 1045 GSSNSVSLFSHA 1056

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 4/115 (3%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPV----FYSNISACYISTGDLDKVV 185
            A   K +GN  + AK F DA + Y   + ++  D       Y+N +AC +   +  + +
Sbjct: 82  IAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCI 141

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240
           E  +KAL I P + K   R + A   L    +A    +  +   D +  SI  ML
Sbjct: 142 EDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATFANQRIDPENKSILNML 196

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%)

Query: 135 KDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEI 194
           K++GN  +    + DAI  Y   I   P +PV +SN +   I  G+  + +E   + L++
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 195 KPDHSKALLR 204
                 A LR
Sbjct: 68  AASPQHAALR 77

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 9/128 (7%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   ++++DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 289 QKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 348

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKRLE 515
           L Y+  ++ +A   +  A    P + EV     T Y    T     N A+  Y  A RL+
Sbjct: 349 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYE---TCNNQLNDALDAYKQAARLD 405

Query: 516 EVQKKIHV 523
              + +H+
Sbjct: 406 P--ENVHI 411

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A  LK +GN     K +  AIK Y  AI + P + V+Y+N +A + S  + D+ ++    
Sbjct: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152

Query: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           A+++   +SK   R   A  + G   +A+     VL + GD
Sbjct: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 37/64 (57%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G  F   ++  D+I+++Q A+ +DPND   +  +   Y + G ++  ++   KA+E+ PD
Sbjct: 691 GISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPD 750

Query: 198 HSKA 201
           H+ A
Sbjct: 751 HNYA 754

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 386 YVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQS 445
           Y  M ++  + +N  +  ++FQ+A+ +DP    ++   GQ YF       +   F+KA  
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 446 LNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFN 502
           L+P + Y     +  L + D+F  A  +     LK    PE   F  E+ T   D++
Sbjct: 747 LSPDHNYAKYFNSVALAQMDEFERAIDILRHV-LKDE--PEKEVFKMELATQIVDYS 800

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%)

Query: 406  FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
            F  A+ L P+    +++   +     D + A     +AQS+ P N  P++ +A L  K+ 
Sbjct: 993  FIKAMVLSPKDVEIWFNLALLALQNNDTVLAGEIMSRAQSMAPQNSSPWLGMALLYEKEG 1052

Query: 466  KFSEAESLFNEA 477
            K +E+ ++F  +
Sbjct: 1053 KSTESANMFGHS 1064

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 4/129 (3%)

Query: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           +A A  LK +GN     K F  AI  Y  AI   P++ V+++N +A Y S     + VE 
Sbjct: 95  KAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVED 154

Query: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQ 247
              A+++ P +SK   R   A  +LG   +A   L       D +G++    ++R+ +  
Sbjct: 155 AEAAIKVNPSYSKGYSRLGFAQYALGRPEEA---LDAYKKVLDIEGSNATDAMKRDYD-T 210

Query: 248 AMKVLNESL 256
           AMK + +SL
Sbjct: 211 AMKKVEQSL 219

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSN 170
             K +GN +F   ++  AIK Y+  IE++P +P+ YSN
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSN 42

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190
           A  LK KGN FF    +  AI YY+ A  LD ++P+++SN++   I      + V    K
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDK 100

Query: 191 AL 192
            L
Sbjct: 101 GL 102

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 73/170 (42%), Gaps = 22/170 (12%)

Query: 404 KFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYK 463
           + ++ AI  DP +   YY  G +   L  Y  A   F+KA+S+NP NV   + + C    
Sbjct: 583 RCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINV---VLVCCGGVA 639

Query: 464 QDKFSEAESLFNEAKLKFPILP--EVPTF-YAEILTDKGDFNPAIKQYDIAKRLEEVQKK 520
            +K S  E      +L   + P   + TF  A +L   G +  A+K ++  K +   +  
Sbjct: 640 LEKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEAT 699

Query: 521 IHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQ 570
           +H  +G +    +IL R+               AI+  T A  LDP+  Q
Sbjct: 700 VHFLLGQIY---SILGRKKD-------------AIKEYTIALNLDPKGRQ 733

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 91/246 (36%), Gaps = 52/246 (21%)

Query: 355 YAGIFQFLKNDLLDAQALLQESINLHP-TPNSYVFMALTVADKENSQEFFKFFQNAIDLD 413
           Y+ +   L ND      L  E I  +P  P ++  +   ++ ++N  E  K F+ A  +D
Sbjct: 500 YSTLLWHL-NDKSKLSILSSELITSNPRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVD 558

Query: 414 PEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESL 473
           P++   Y  +G  Y     +  AK  ++KA + +PG+   Y  L  +  K  ++ EA   
Sbjct: 559 PKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLF 618

Query: 474 FNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKAT 533
           F +A+                       NP                   + +  +     
Sbjct: 619 FEKAR---------------------SINP-------------------INVVLVCCGGV 638

Query: 534 ILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQ 593
            L + S Q+           A++    ACEL P S  A    A L   M +  +A+K F+
Sbjct: 639 ALEKLSYQEK----------ALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFE 688

Query: 594 ESATLA 599
           E   +A
Sbjct: 689 ELKHVA 694

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 73/175 (41%), Gaps = 16/175 (9%)

Query: 424 GQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPI 483
           G++++ L +Y  +   F   ++L P  V      + LL+  +  S+   L +E     P 
Sbjct: 467 GKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPR 526

Query: 484 LPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDP 543
           +PE        L+ + + + AIK ++ A +++           P    A  L     Q  
Sbjct: 527 IPETWCCLGNFLSLQKNHHEAIKAFEKATQVD-----------PKFAYAYTL-----QGH 570

Query: 544 TQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATL 598
                + F++A     KA   DP    A  GL  + +++ + + A+  F+++ ++
Sbjct: 571 EYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G  +   +   D+I+++Q AI +D +D   +  +   Y S G ++  ++   K LE+ P 
Sbjct: 682 GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 198 HSKALLRRASANESLGNFTDAM 219
           H  AL  +A     +G F +++
Sbjct: 742 HPHALYFKALGLSDVGQFVESI 763

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 42/72 (58%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
            D+I+++Q A+ +DPND   +  +   Y + G ++  ++   KA++++P H+ A   +A 
Sbjct: 704 SDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTYAQYFKAV 763

Query: 208 ANESLGNFTDAM 219
           +   +G + +++
Sbjct: 764 SLCDIGEYLESL 775

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%)

Query: 406  FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
            F  A  L+P+   T+++   +     D   A+    K QSL P +  P++ +A +L KQ 
Sbjct: 993  FIKATALEPKATDTWFNLAMLGLKKNDAEFAQQVLNKLQSLAPQDSSPWLGMALILEKQG 1052

Query: 466  KFSEAESLF 474
               E+  LF
Sbjct: 1053 NVIESSKLF 1061

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+T   F   I  ++ A++++PND + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSLN 228
           A    A ++ ++G + +A  + L+VLS++
Sbjct: 527 ARYNLAVSSMNIGCYKEAAGYLLTVLSMH 555

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+T   F   I  ++ A++++PND + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSLN 228
           A    A ++ ++G   +A  + LSVLS++
Sbjct: 527 ARYNLAVSSMNIGCLKEAAGYLLSVLSMH 555

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPV----FYSNISACYISTGDLDKVV 185
            A   K +GN  + AK F DA + Y   + ++  D       ++N +AC +   +  + +
Sbjct: 82  IAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCI 141

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDA 218
           E  +KAL I P ++K   R + A   L    +A
Sbjct: 142 EDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   F   ++++DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 287 QKALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 346

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV 487
           L Y+  ++ +A   +  A    P + EV
Sbjct: 347 LYYQISQYRDALDAYTRAIRLNPYISEV 374

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYI 176
           + K KGN  +   +F DA+ +Y+ AI  DP +PV YSN +   I
Sbjct: 6   EFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALI 49

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 116 MDRLRGLS-APQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPND----PVFYSN 170
           +D L+ L+   +    A   K++GN  +  K F DA + Y  AI++  +D       Y+N
Sbjct: 58  LDALKALAYEGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYAN 117

Query: 171 ISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 218
            +AC +   +  + +     AL + P + K   R A A  ++  F D 
Sbjct: 118 RAACELELKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 118 RLRGLSAPQRQAFAVQLKDK--GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACY 175
           RL G    +R++  V    +  G  +   +    +I+++Q A+ +DP D   +  +   Y
Sbjct: 651 RLLGSEKAKRKSKEVNWAYRVVGIFYLETQEEASSIEWFQSALRIDPKDVESWVGLGQAY 710

Query: 176 ISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 219
            + G ++  ++   +ALE+  +H      +A +  +LG F D++
Sbjct: 711 YACGRIEASMKVFERALELDSEHQHCRYLKAQSLAALGQFVDSI 754

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
            DAI+++Q A+ ++PN+   +  +   Y+S G ++  +    KA E+ PDH  A    A 
Sbjct: 685 SDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLYAKYFTAQ 744

Query: 208 ANESLGNFTDAM 219
           +   +G +  ++
Sbjct: 745 SLSEMGEYVKSI 756

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 385 SYVFMALTVADKENSQE--FFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQK 442
            + F  + +A+ E  QE    ++FQ+A+ ++P    ++   GQ Y        +   F+K
Sbjct: 668 CWPFRVIGIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEK 727

Query: 443 AQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEIL 495
           A  L+P ++Y     A  L +  ++ ++ S+F E  ++ P        Y+E L
Sbjct: 728 ATELDPDHLYAKYFTAQSLSEMGEYVKSISIFEEIIMETPKEESFQVSYSETL 780

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 50/111 (45%), Gaps = 14/111 (12%)

Query: 490 FYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGP--LIGKATILARQSSQDPTQLD 547
           +  E   + G+++ A     I  + +  +K +     P  +IG A  L RQ   D     
Sbjct: 633 YMVETYCNSGNWSAAESISKILVKTDGAKKYLRYTCWPFRVIGIAN-LERQQESD----- 686

Query: 548 EEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATL 598
                 AIE    A  ++P + ++ +GL Q  L   +I+ +I++F+++  L
Sbjct: 687 ------AIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATEL 731

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 41/72 (56%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
            D+I+++Q A+ +DPND   +  +   Y + G ++  ++   KA+ +KP H+ A   +A 
Sbjct: 712 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIGLKPSHTYAQYFKAV 771

Query: 208 ANESLGNFTDAM 219
           +   +G + +++
Sbjct: 772 SLCDMGEYLESL 783

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 4/121 (3%)

Query: 406  FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
            F  A  L+P+    +++   +     D   A+    K+QSL P +  P++ +A +L KQ 
Sbjct: 1001 FIKATALEPKATDIWFNLAMLGLKKNDTDFAQQVLNKSQSLAPQDSSPWLGMALILEKQG 1060

Query: 466  KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
               E+  LF  +     IL    +  A++L  K      I   D  + +E ++K   V I
Sbjct: 1061 NIVESSKLFAHS----FILSNGRSKAAQLLYAKNVLENHIDNGDDERDIETIEKLTAVSI 1116

Query: 526  G 526
             
Sbjct: 1117 A 1117

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           +A A  LK +GN     K +  AI  Y  AI++ P + ++Y+N +A + S    D+ VE 
Sbjct: 99  KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVED 158

Query: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
              A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           + +A A  LK +GN     K +  AI  Y  AI++ P + ++Y+N +A + S  + D+ V
Sbjct: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           +    A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 157 KDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 42/72 (58%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
            D+I+++Q A+ +DPND   +  +   Y + G ++  ++   KA++++P H+ A   +A 
Sbjct: 719 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAI 778

Query: 208 ANESLGNFTDAM 219
           +   +G + +++
Sbjct: 779 SLCDVGEYLESL 790

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 9/128 (7%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   ++++DP    T+YH G+++ +  DY  A   FQ+A + +  N   +  +  
Sbjct: 298 QKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 357

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKRLE 515
           L Y+  ++ +A   +  A    P + EV     T Y    T       A+  Y  A RL+
Sbjct: 358 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYE---TCNNQLTDALDAYKQAARLD 414

Query: 516 EVQKKIHV 523
              + IH+
Sbjct: 415 P--ENIHI 420

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPND----PVFYSNISACYISTGDLDKVVE 186
           A   K++GN F+  K + DA + Y   I++  +D       Y+N +AC +   +  K +E
Sbjct: 74  AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIE 133

Query: 187 YTTKALEIKPDHSKALLRRASANESLGNFTDA 218
              KAL     + K   R   A  S+  F ++
Sbjct: 134 DCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 150 AIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASAN 209
           +I+++Q AI +DPND   +  +   Y++ G ++  ++   KA+E+   H  A   +A A 
Sbjct: 688 SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSHLHAQYFKALAL 747

Query: 210 ESLGNFTDAMFDL--SVLSLN 228
             +G F+ A  DL  SV  LN
Sbjct: 748 ADMGEFS-ASIDLLTSVTELN 767

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYI 176
           +LK +GN  +  + +  A+++Y   +E D  +P+ +SN + C I
Sbjct: 6   RLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLI 49

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 43/105 (40%), Gaps = 3/105 (2%)

Query: 117 DRLRGLSAPQR--QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISAC 174
           + L  L A Q+     A  LK +GN       + +AIK Y  AI+   N   +YSN S  
Sbjct: 66  ENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLA 124

Query: 175 YISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 219
           Y   G  +  V   T A+ I P  SKA  R   A        D M
Sbjct: 125 YSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 91/245 (37%), Gaps = 57/245 (23%)

Query: 364 NDLLDAQALLQESINLHP-TPNSYVFMALTVADKENSQEFFKFFQNAIDLDP-------- 414
           ND      L  E + ++   P ++  +    + K++ +E  K FQ +  LDP        
Sbjct: 390 NDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTL 449

Query: 415 ---EYPP-----------------------TYYHRGQMYFILQDYINAKSDFQKAQSLNP 448
              EY                          YY  G     L  Y      F+KA+S+NP
Sbjct: 450 QGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINP 509

Query: 449 GNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILP--EVPTF-YAEILTDKGDFNPAI 505
            NV   I + C     +K S  E       L   + P   +  F  A++L   G +N A+
Sbjct: 510 VNV---ILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYAL 566

Query: 506 KQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELD 565
           + ++   ++   +  IH  +G L     I+ R+  QD           A++ LT A  LD
Sbjct: 567 ESFEKLVKIAPDEATIHFLLGQLY---QIVGRK--QD-----------AVKELTIAMNLD 610

Query: 566 PRSEQ 570
           P+  Q
Sbjct: 611 PKGSQ 615

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 4/79 (5%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPV----FYSNISACYISTGDLDKVV 185
            A   K +GN  + AK F DA + Y   + ++  D       ++N +AC +   +  K V
Sbjct: 82  IAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCV 141

Query: 186 EYTTKALEIKPDHSKALLR 204
           E   KAL I P + K   R
Sbjct: 142 EDCGKALTINPKNIKCYYR 160

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 1/106 (0%)

Query: 373 LQESINLHPT-PNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQ 431
            + ++ L+ T  N++  M     + +NS    + ++ A+D++P     +Y  GQ Y +L 
Sbjct: 407 FRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLD 466

Query: 432 DYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA 477
            ++ A    QKA SL P +   +  LA    K D+ ++A   F  A
Sbjct: 467 RHLYALYYLQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRA 512

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 54/121 (44%), Gaps = 7/121 (5%)

Query: 386 YVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQS 445
           Y  + +   +K+   E  ++FQ+A+ ++P    ++   GQ Y+       +   F+KA  
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 446 LNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFP-------ILPEVPTFYAEILTDK 498
           ++PGN Y +   A  L K   + E+  +F E   + P        + EV   +  +L  +
Sbjct: 744 VSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVEHCNVLCSQ 803

Query: 499 G 499
           G
Sbjct: 804 G 804

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 40/71 (56%)

Query: 149 DAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASA 208
           ++I+++Q A+ ++P D   +  +   Y S G ++  V+   KALE+ P ++ A   +A +
Sbjct: 699 ESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKALS 758

Query: 209 NESLGNFTDAM 219
              +G + +++
Sbjct: 759 LSKMGLYDESI 769

>NDAI0C00160 Chr3 complement(21850..24186) [2337 bp, 778 aa] {ON}
           Anc_2.665 YKL022C
          Length = 778

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 116 MDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGD---AIKYYQYAIELDPNDPVFYSNIS 172
           ++ LR  +   + AF++Q+    N   T +  G+   AIK ++  +E   +D   Y ++ 
Sbjct: 619 LESLRASNMTSKMAFSIQM----NLAHTYRKLGENERAIKCFKAVLEESGHDADIYCSLG 674

Query: 173 ACYISTGDLDKVVEYTTKALEIKPDHSKA 201
             Y+ T  L+K V+Y   +L +KP ++ A
Sbjct: 675 FLYLKTNQLEKAVDYLHNSLSLKPTNNSA 703

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 5/129 (3%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIEL--DPN--DPVFYSNISACYISTGDLDKVVE 186
           A   K++GN  +  K + DA + Y   IE+  D N  +   +SN +AC +   +  + V 
Sbjct: 78  AENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVN 137

Query: 187 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNK 246
              +AL+  P + K   R A A   L    DA   +    L  D +  +++ +L++ + +
Sbjct: 138 DCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQKVIKR 196

Query: 247 QAMKVLNES 255
           +  K  +E+
Sbjct: 197 EEDKKAHEA 205

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 54/102 (52%), Gaps = 4/102 (3%)

Query: 145 KSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLR 204
           +S  ++I+++Q A+ +DP+D   +  +   Y + G ++  V+   KALE++P  + A   
Sbjct: 694 QSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYF 753

Query: 205 RASANESLGNFTDAMFDLSVLS----LNGDFDGTSIEPMLER 242
           +A +   +G + D++  L  L+    L   +  + +E M+E 
Sbjct: 754 KALSLSRMGLYNDSIEILKTLAAGNPLEESYQVSLVEIMVEH 795

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 36/194 (18%), Positives = 77/194 (39%), Gaps = 31/194 (15%)

Query: 386 YVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQS 445
           Y  + +   +K++  E  ++FQ+A+ +DP    ++   GQ Y+       +   F+KA  
Sbjct: 683 YRVLGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALE 742

Query: 446 LNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPI-------LPEVPTFYAEILTDK 498
           + P + Y +   A  L +   ++++  +        P+       L E+   +A +L  +
Sbjct: 743 VEPTSAYAHYFKALSLSRMGLYNDSIEILKTLAAGNPLEESYQVSLVEIMVEHANVLCSQ 802

Query: 499 GDFNPAIK-QYDIAKRLE----EVQKKIH-------------------VGIGPLIGKATI 534
           G    ++    D  +++E     +  K+H                   VG+ PL     I
Sbjct: 803 GFLTRSVAIAADAVRKVEYIALNINHKLHNLWIALSNALRIFLLVQSQVGMLPLESLVNI 862

Query: 535 LARQSSQDPTQLDE 548
              +  ++ T +DE
Sbjct: 863 FEIEELKNTTAIDE 876

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 5/125 (4%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP----VFYSNISACYISTGDLDKVV 185
            A   K++GN  + AK F DA + Y   IE+  +D       Y+N +AC +   +  + +
Sbjct: 77  IAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCL 136

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLN 245
                AL+  P + K   R   A  +L    +A   +    L  D     ++ +L+  L 
Sbjct: 137 NDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLK 195

Query: 246 KQAMK 250
           KQ  K
Sbjct: 196 KQEAK 200

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185
           + +A A  LK +GN     K +  AI  Y  AI++ P + ++Y+N +A + S  + D+ V
Sbjct: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAV 156

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230
           +    ++ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 157 KDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
             N++  M     + +NS    + ++ A+D++P     +Y  GQ Y +L  ++ A    Q
Sbjct: 429 CTNAWTLMGHEFVETKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQ 488

Query: 442 KAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA 477
           KA SL P +   +  LA    K D+ ++A   F  A
Sbjct: 489 KACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRA 524

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 52/96 (54%), Gaps = 4/96 (4%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+    F   I  +Q A++++PND + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 434 FYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 493

Query: 201 ALLRRASANESLGNFTDA----MFDLSVLSLNGDFD 232
           A    A ++ ++G + +A    +  LS+  + G+F+
Sbjct: 494 ARYNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEFE 529

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 7/120 (5%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+       ++++DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 288 QKALNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGV 347

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKRLE 515
           L Y+  ++ +A   +  A    P + EV     T Y    T     N A+  Y  A RL+
Sbjct: 348 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYE---TCNKQLNDALDAYKQAARLD 404

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 5/114 (4%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+T   +   I  ++ A+ ++PND + ++ + A   ++   ++ V    +AL +KP   +
Sbjct: 503 FYTTADYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVR 562

Query: 201 ALLRRASANESLGNFTDA----MFDLSVLSLNGDFDGTSIEPMLERNLNKQAMK 250
           A    A ++ ++G F +A    +  LS+  +NG  D T +E     N    A K
Sbjct: 563 ARYNLAVSSINIGCFKEAAEHLLTALSMHEINGILD-TDLETNFSSNTLNNAYK 615

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 122 LSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDL 181
           + AP R +    L+ KGN  ++   +  A+ YY+ A   +P++PV  +N+S   +     
Sbjct: 1   MVAPARNSD--HLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERW 58

Query: 182 DKVVEYTTKALEI 194
           +  +    +ALEI
Sbjct: 59  EDALSACDRALEI 71

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (48%)

Query: 398 NSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQL 457
           + Q+   F   +++++P    T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 257 DPQKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 316

Query: 458 ACLLYKQDKFSEAESLFNEAKLKFPILPEV 487
             L Y+  ++ +A   +  A    P + EV
Sbjct: 317 GVLYYQISQYRDALDAYTRAIRLNPYISEV 346

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 9/128 (7%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   ++++D +   T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 294 QKALGYLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 353

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKRLE 515
           L Y+  ++ +A   +  A    P + EV     T Y    T     N A+  Y  A RL+
Sbjct: 354 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYE---TCNNQLNDALDAYKQAARLD 410

Query: 516 EVQKKIHV 523
              + IH+
Sbjct: 411 P--ENIHI 416

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 92/229 (40%), Gaps = 23/229 (10%)

Query: 347 ENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPT-PNSYVFMALTVADKENSQEFFKF 405
           +N    +C  G    L+ D  +A    ++   L PT    Y   A      ++      +
Sbjct: 562 KNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNY 621

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F+ A+  D ++   YY  G     L ++ +A   F+KA+S+NP NV   I + C     +
Sbjct: 622 FRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNV---ILICCCGVAFE 678

Query: 466 KFSEAESLFNEAKLKFPILP--EVPTF-YAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           K S  E   +  +L   + P   +  F  A +L    ++  A++ ++   +L   +  +H
Sbjct: 679 KLSYPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVH 738

Query: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQA 571
             +G L     I+ R+               A++  T A  LDP+  Q 
Sbjct: 739 FILGQLYN---IMGRKKD-------------AVKEYTIAMNLDPKGNQV 771

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 7/61 (11%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKAL 192
           + K  GN +F   ++  A++YY+  IE++P +P+ YSN      S   L K+ +Y T+AL
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSN------SAMSLIKLTKY-TEAL 57

Query: 193 E 193
           E
Sbjct: 58  E 58

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%)

Query: 385 SYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQ 444
           ++  M     + +NSQ   + +++A+D++P     +Y  GQ Y +L  ++ +   FQKA 
Sbjct: 473 AWTLMGHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKAC 532

Query: 445 SLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA 477
           +L P +   +  LA    K   F++A   F  A
Sbjct: 533 TLKPLDKRMWQALASCYVKIGNFNDAIKSFERA 565

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G+ F   K+   AI+ Y++A++++P D   +  +   Y         + Y  KA  +KP 
Sbjct: 478 GHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 537

Query: 198 HSKALLRRASANESLGNFTDAM--FDLSV-LSLNGDFDGTSIEPMLE 241
             +     AS    +GNF DA+  F+ ++ LS+N D D + +  + E
Sbjct: 538 DKRMWQALASCYVKIGNFNDAIKSFERALQLSINTDQDSSLLYKLAE 584

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   ++++DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 287 QKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 346

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV 487
           L Y+  ++ +A   +  A    P + EV
Sbjct: 347 LYYQISQYRDALDAYTRAIRLNPYISEV 374

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPV----FYSNISACYISTGDLDKVV 185
            A   K++ N  +  K F DA + Y   I++   D       ++N +AC +   +    V
Sbjct: 84  IAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCV 143

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDA 218
               KA+EI P + K   R   A  +LG F +A
Sbjct: 144 ADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 9/128 (7%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   ++++DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 281 QKALSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 340

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKRLE 515
           L Y+  ++ +A   +  A    P + EV     T Y    T     + A+  Y  A RL+
Sbjct: 341 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYE---TCNNQLSDALDAYKQAARLD 397

Query: 516 EVQKKIHV 523
              + IH+
Sbjct: 398 --PENIHI 403

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIEL-----DPNDPVFYSNISACYISTGDLDKVV 185
           A++LK +GN     +++ DAI  Y  AI+L      P D  + SN S     +G  ++  
Sbjct: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGDFDGTSIEPMLERNL 244
           +     ++I P  SK   R A A      + DAM     VL L G+    +++   E  +
Sbjct: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE--I 201

Query: 245 NKQAMKVLN 253
            KQ  + LN
Sbjct: 202 TKQKFETLN 210

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 4/92 (4%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIEL----DPNDPVFYSNISACYISTGDLDKVVE 186
           A   K++GN  FT K F +A   Y   IE+    D  +   ++N +AC +   +    + 
Sbjct: 80  AENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCIN 139

Query: 187 YTTKALEIKPDHSKALLRRASANESLGNFTDA 218
               AL + P + K   R   A   L N  +A
Sbjct: 140 DCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   +++ DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 283 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 342

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV 487
           L Y+  ++ +A   +  A    P + EV
Sbjct: 343 LYYQISQYRDALDAYTRAIRLNPYISEV 370

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   +++ DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 279 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 338

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV 487
           L Y+  ++ +A   +  A    P + EV
Sbjct: 339 LYYQISQYRDALDAYTRAIRLNPYISEV 366

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 61/162 (37%), Gaps = 13/162 (8%)

Query: 147 FGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRA 206
           +  A   +Q A+  D  +P+F+ +I   Y         ++  T+A+ + P  S+      
Sbjct: 312 YTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLG 371

Query: 207 SANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQ 266
           +  E+  N      D    +   D +   I   LE          L + L   G+   S 
Sbjct: 372 TLYETCNNQLSDALDAYKQAARLDVNNVHIRERLE---------ALTKQLENPGNINKSN 422

Query: 267 ILPSNTSLASFFGIFDPDLET----SRVNTGSLLDSASATLS 304
             P+N S A    I  P L+     + +NT     SA+AT S
Sbjct: 423 GAPTNASPAPPPVILQPTLQPNDQGNPLNTRISAQSANATAS 464

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   +++ DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 281 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 340

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV 487
           L Y+  ++ +A   +  A    P + EV
Sbjct: 341 LYYQISQYRDALDAYTRAIRLNPYISEV 368

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 51/133 (38%), Gaps = 9/133 (6%)

Query: 154 YQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLG 213
           +Q A+  D  +P+F+ +I   Y         ++  T+A+ + P  S+      +  E+  
Sbjct: 321 FQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCN 380

Query: 214 NFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTS 273
           N      D    +   D +   I         ++ ++ L + L   G+   S   P+N S
Sbjct: 381 NQLSDALDAYKQAARLDVNNVHI---------RERLEALTKQLENPGNMNKSNGAPTNAS 431

Query: 274 LASFFGIFDPDLE 286
            A    I  P L+
Sbjct: 432 PAPPPVILQPTLQ 444

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%)

Query: 135 KDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKAL 192
           K++GN  F    + +A+  Y   I   P +PV YSN +   I  G+  + ++   + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 95/228 (41%), Gaps = 23/228 (10%)

Query: 347 ENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPT-PNSYVFMALTVADKENSQEFFKF 405
           + +A+ +C  G    L  D  +A   L+++ NL P    +Y       ++ +        
Sbjct: 454 DKSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMC 513

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           ++ A+ ++P +   +Y  G     L  Y  A   F+KA+S+NP NV   I   C     +
Sbjct: 514 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV---ILNCCCGVALE 570

Query: 466 KFSEAESLFNEAKLKFPILP--EVPTF-YAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           +    E   +  +L   + P   +  F  +++L + G ++ A++ ++  ++L   +  IH
Sbjct: 571 RLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPIH 630

Query: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQ 570
             +G L     I+ R+               AI   T A  LDP+  Q
Sbjct: 631 FLLGQLY---QIVGRKKD-------------AITQFTIAMNLDPKGIQ 662

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%)

Query: 411 DLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEA 470
           ++DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  L Y+  ++ +A
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 471 ESLFNEAKLKFPILPEV 487
              +  A    P + EV
Sbjct: 367 LDAYTRAIRLNPYISEV 383

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 4/94 (4%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAI----ELDPNDPVFYSNISACYISTGDLDKVV 185
            A   K +GN  +  K F DA + Y   I    +++  +   Y+N +AC +   +  + +
Sbjct: 80  IAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCI 139

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAM 219
               +AL++ P + K   R A A  +L    +A+
Sbjct: 140 NDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 398 NSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQL 457
           N ++   +   ++++D E   T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 267 NPEKALNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSI 326

Query: 458 ACLLYKQDKFSEAESLFNEAKLKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKR 513
             L Y+  ++ +A   +  A    P + EV     T Y    T       A+  Y  A R
Sbjct: 327 GVLYYQIYQYRDALDAYTRAIRLNPYISEVWYDLGTLYE---TCNNQLTDALDAYKQAAR 383

Query: 514 LE 515
           LE
Sbjct: 384 LE 385

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 112 GEPDMDRLR-------GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPND 164
           G  D++R R       GL      +F    KD GN  F    +  AI+ Y+  I L+P +
Sbjct: 10  GHQDVNRQRNLKHWNNGLQDKLTMSFQ-HFKDIGNEHFKKGEYDLAIEQYRKCISLEPTN 68

Query: 165 PVFYSNISACYI 176
            V YSN++  Y+
Sbjct: 69  AVGYSNLAMAYL 80

>Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} similar
           to Ashbya gossypii AEL281C
          Length = 1398

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
            +AI+++Q A+ LD  D   +  +   Y   G +   V    KALE+ P H  A    A+
Sbjct: 685 AEAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALELNPKHKFARYLLAA 744

Query: 208 ANESLGNFTDAMFDLSVLS 226
           +   +G F   +  LSVL+
Sbjct: 745 SLCQMGEFEKGIELLSVLN 763

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 11/193 (5%)

Query: 386 YVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQS 445
           Y  + +   +K+   E  ++FQ+A+ LD      +   GQ Y +      + + ++KA  
Sbjct: 671 YRVLGIFYLEKQQEAEAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALE 730

Query: 446 LNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPI----LPEVPTFYAEILTDKGDF 501
           LNP + +    LA  L +  +F +   L +    ++P+    L ++  F  +  TD  + 
Sbjct: 731 LNPKHKFARYLLAASLCQMGEFEKGIELLSVLNEEYPLEEIFLVQLSGFLVDYSTDLHNQ 790

Query: 502 NPAIKQYDIA----KRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIEL 557
              IK    A    + +E V  K++  +  +    T+    S    TQ   EKF +   L
Sbjct: 791 GYLIKSIGTALKAVRLIEVVVTKLNKKVSSVF--VTLSKVLSLFMLTQSQFEKFPLESLL 848

Query: 558 -LTKACELDPRSE 569
            + +ACEL   S+
Sbjct: 849 NILEACELKNTSK 861

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 72/175 (41%), Gaps = 22/175 (12%)

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           ++ AI  DP++   YY  G     L  Y  A   F+KA+ +NP N    I + C  +  +
Sbjct: 578 YRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA---ILICCCGHSLE 634

Query: 466 KFSEAESLFNEAKLKFPILPE--VPTF-YAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           K +  +      +L   + PE  +P +  A++L   G F+ A+  ++   +L   +  +H
Sbjct: 635 KLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEVTVH 694

Query: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQ 577
             +G +      + R+               AI+  T A  LDP   Q  I   Q
Sbjct: 695 FMLGQIY---QTMGRKKD-------------AIKEYTIALNLDPMGNQVIIDALQ 733

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+   +   +++ DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 273 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 332

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV 487
           L Y+  ++ +A   +  A    P + EV
Sbjct: 333 LYYQISQYRDALDAYTRAIRLNPYISEV 360

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F++   F   I  ++ A+++ PND + ++ + A   ++   ++ ++   KAL +KP   +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR 519

Query: 201 ALLRRASANESLGNFTD-AMFDLSVLSL 227
           A    A ++ ++G + + A + L+ LS+
Sbjct: 520 ARYNLAVSSINIGCYKEAAQYLLTALSM 547

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+    F   I  ++ A+ ++PND + ++ + A   ++   ++ ++   KAL++KP   +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSLNGDFDGTS 235
           A    A ++ ++G + +A  + LS L ++ + +G S
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKMH-EVEGVS 500

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 45/82 (54%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+    F   I  ++ A++++PND + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 456 FYANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVR 515

Query: 201 ALLRRASANESLGNFTDAMFDL 222
           A    A ++ ++G + +A+  L
Sbjct: 516 ARYNLAVSSMNIGCYKEAVEHL 537

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} similar
            to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
            dsRNA virus protection family member contains 8 copies of
            the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 38.1 bits (87), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 105/519 (20%), Positives = 211/519 (40%), Gaps = 90/519 (17%)

Query: 149  DAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASA 208
            ++I+++Q A+ +D ND   +  +   Y + G L+  ++   KA E+ PDH  A   +A +
Sbjct: 696  ESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDHLFAGYFKAIS 755

Query: 209  NESLGNFTDAM---------------FDLSVLSLNGDFDGTSIEPMLERNLNKQAMKVLN 253
               +G +   +               F +S++++  D+   S+E   +  L K   + ++
Sbjct: 756  LAGIGEYEQCIEIIAALLEKLPNEESFQVSMVNILIDY---SVELFSQGYLAKAVAQAVD 812

Query: 254  -----ESLLKNGDDKSSQILPSNTSLASFFGIFDPDLET----SRVN---TGSLLDSASA 301
                 E ++ N   K   +  S +     F +    ++     S VN      L ++ S 
Sbjct: 813  SIKRIEYIISNISHKVQNVWISLSKALKLFILVQSKVDMLPIESLVNIFEACELKNTDSV 872

Query: 302  -TLSEA-LQSLYS-------ATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALA 352
             TL E  L++L S       + +  +L+     + A+ EY ++       R +R +    
Sbjct: 873  DTLDEINLENLLSDETQDNTSIATKFLVLSAKCSLASCEYENI------PRTVRASLWYN 926

Query: 353  FCYAGIFQFLK---NDLLDAQALL-QESINLHP-TPNSYVFMALTVADKENSQEFFKFFQ 407
               A +F ++     +  DA  +  ++SI L   T  +++ + ++  D  N +     F 
Sbjct: 927  LGIAELFTYITLKAENYRDAAIICYKQSIKLQSNTTEAWIGLGISCMDV-NYRVAQHCFI 985

Query: 408  NAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKF 467
             AI L P+    +Y    +     D   A+    K+QS+ P +  P+  +A     ++  
Sbjct: 986  KAIALAPKEIGIWYDLAILALKNGDIEFARDVLMKSQSIAPQDSSPWFGMALAHEHENNL 1045

Query: 468  SEAESLFNEAKLKFPILPEVPT-FYAEILT--------DKGDFNPAIKQYDIAKRLEEVQ 518
             E+  +F  + +      +V    YA+ +         D+ D  P+ +   +A  L++  
Sbjct: 1046 EESSKMFAHSFVISNGRSKVAQLLYAKSVLRKRIGKGDDERDIEPSQEFTAVACGLDQYL 1105

Query: 519  KK-------IHVGI------------GPLIGK-ATILARQSSQDPTQLDEEKFNMAIELL 558
            KK       I   I            G L  + A++L  ++  + +Q + E FN AI   
Sbjct: 1106 KKSPNDTFAIQCAILTLERLHNFSVAGTLSDRLASVL--ENRFEKSQNEAELFNFAI--- 1160

Query: 559  TKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESAT 597
                 ++ +  + K+GL   E  +EK D+A+ +  E  T
Sbjct: 1161 -----IESQFARVKLGLKDYESAIEKADLALGILAEHET 1194

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 364 NDLLDAQALLQESINLHP-TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYH 422
           ND      L  E + ++   P ++  +    + K++ +E  K FQ +  LDP +   Y  
Sbjct: 389 NDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTL 448

Query: 423 RGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFP 482
           +G  Y     +  A + ++KA   NP +   +  L     K  ++ E    F +A+   P
Sbjct: 449 QGHEYSSNDAFDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINP 508

Query: 483 ILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEV 517
           +   +       L        A++ YD+A  L+ V
Sbjct: 509 VNVILICCCGVALEKLSHQEKALQYYDLACELQPV 543

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 135 KDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE- 193
           K +GN  F    + +A+  Y   I   P +PV YSN +   I  G+  + ++   + L+ 
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQH 71

Query: 194 ----IKPDH 198
                 PDH
Sbjct: 72  ASTTTTPDH 80

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G   F  + +  A+K Y   I+ +P  PV + N +A +       +V++   KA+ + P
Sbjct: 435 EGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDP 494

Query: 197 DHSKALLRRASA 208
            + KA +R+  A
Sbjct: 495 SYIKAYVRKGFA 506

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 407 QNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQ 464
           +N ++L P +   Y   G  Y  LQ    A+ +F+KA  LN  NV+   +LA + Y Q
Sbjct: 67  KNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNVHAKKELAYVKYLQ 124

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 8/95 (8%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAI-ELDPNDPVFYSNISACYISTGDLDKVVEYTTKA 191
           +LK+ GN  +  K +  A+ Y+  A+ +   N  + YSN +A +I      + +E     
Sbjct: 10  ELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNC 69

Query: 192 LEIKPDHSKALLRRASA-------NESLGNFTDAM 219
           +E+ P+  K   R   A       +E+  NF  A+
Sbjct: 70  VELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKAL 104

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 69/165 (41%), Gaps = 22/165 (13%)

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           ++ A+  DP++   YY  G  Y  L  Y  A   F+KA+++NP NV   I + C     +
Sbjct: 539 YRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV---ILICCCGVALE 595

Query: 466 KFSEAESLFNEAKLKFPILP--EVPTF-YAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           K S  E      +    + P   +  F  A +L     ++ A++ ++   +L   +  +H
Sbjct: 596 KLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVH 655

Query: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPR 567
             +G L     I+ R+               A++  T A  LDP+
Sbjct: 656 FLLGQLY---QIMGRKKD-------------AVKEFTVAMNLDPK 684

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 76/191 (39%), Gaps = 18/191 (9%)

Query: 410 IDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSE 469
           ++  P  P T+   G +Y + +D+ +A   F+KA  ++    Y Y          D    
Sbjct: 475 VETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDT 534

Query: 470 AESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH-VGIGPL 528
           A++ +  A       P+    Y  +    G     + QYD A    E  + I+ V +  +
Sbjct: 535 AKNCYRRA---LACDPQHYNAYYGL----GMCYMKLGQYDKALLFFEKARNINPVNVILI 587

Query: 529 IGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVA 588
                 L + S Q+           A++   +ACEL P S  AK   A L   M +   A
Sbjct: 588 CCCGVALEKLSYQEK----------ALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAA 637

Query: 589 IKLFQESATLA 599
           ++ F+E A LA
Sbjct: 638 LENFEELAKLA 648

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 28/67 (41%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTT 189
           FA     +G+   +  S   A   Y+ A+  DP     Y  +  CY+  G  DK + +  
Sbjct: 515 FAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFE 574

Query: 190 KALEIKP 196
           KA  I P
Sbjct: 575 KARNINP 581

>NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7.458
           YJR088C
          Length = 335

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 412 LDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQ 464
           LDPE   T++  G++YF L+DY  AK  F++   + P N   + +L+ +LY Q
Sbjct: 174 LDPE---TWWFMGEVYFQLKDYHKAKYCFEEILIIMPFNYEAFARLSEVLYYQ 223

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 4/93 (4%)

Query: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPN----DPVFYSNISACYISTGDLDKVV 185
            A   K++GN  +  K F DA + Y   IE+  +    +   Y+N +AC +   +    +
Sbjct: 77  IAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCI 136

Query: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDA 218
                AL   P + K   R   A  ++  F  A
Sbjct: 137 SDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 44/82 (53%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G  ++    F   I+ ++ +++++PND V ++ + A   ++   +  ++   +AL +KP
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKP 496

Query: 197 DHSKALLRRASANESLGNFTDA 218
              +A    A A+ ++G + +A
Sbjct: 497 SFVRARYNLAVASMNIGCYKEA 518

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 9/128 (7%)

Query: 400 QEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
           Q+       ++++D     ++YH G+++ I  DY +A   FQ+A + +  N   +  +  
Sbjct: 341 QKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGV 400

Query: 460 LLYKQDKFSEAESLFNEAKLKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKRLE 515
           L Y+  ++ +A   +  A    P + EV     T Y    T     N A+  Y  A RL+
Sbjct: 401 LYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYE---TCNNQVNDALDAYKQAARLD 457

Query: 516 EVQKKIHV 523
                +H+
Sbjct: 458 P--NNVHI 463

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
             +++  M     + +NS    + ++ A+D++P+    +Y  GQ Y +L+ ++ +   FQ
Sbjct: 453 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSLFYFQ 512

Query: 442 KAQSLNP 448
           KA SL P
Sbjct: 513 KACSLQP 519

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 73/187 (39%), Gaps = 18/187 (9%)

Query: 414 PEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESL 473
           P  P T+   G    + +D+ +A   F+KA  ++P   Y Y          D F  A+  
Sbjct: 548 PNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKC 607

Query: 474 FNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKAT 533
           F +A    P       +Y       G ++  +  YD A    E  ++I+     LI    
Sbjct: 608 FRKAIACDP--RHYNAYYG-----MGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCG 660

Query: 534 I-LARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLF 592
           + L +   QD           A+E    AC L P S  A+   A L   M + ++A++ F
Sbjct: 661 VALEKLEYQDK----------ALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSF 710

Query: 593 QESATLA 599
           +E + L 
Sbjct: 711 EELSKLT 717

 Score = 34.7 bits (78), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 43/215 (20%), Positives = 82/215 (38%), Gaps = 21/215 (9%)

Query: 385 SYVF-MALTVADKENSQEFFKFFQNAI--DLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
           SY+F +        ++ +  + F N I   +    P      G++++ + +Y  A   F 
Sbjct: 448 SYIFGLIAKCCSTYDAYKAIRLFHNCIPDHIVKNMPWCLAQLGKLHYEIVNYEMASIYFM 507

Query: 442 KAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDF 501
           +   L P  +      + LL+    +    SL +     +P  PE        L+ K D 
Sbjct: 508 QLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDH 567

Query: 502 NPAIKQYDIAKRLEEVQKKIHVGIGPLIGKA-TILARQSSQDPTQLDEEKFNMAIELLTK 560
             AI+ ++ A +           I P    A T+   + S +      + F+ A +   K
Sbjct: 568 EDAIEAFEKATK-----------IDPKFAYAYTLQGHECSSN------DSFDAAKKCFRK 610

Query: 561 ACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQES 595
           A   DPR   A  G+    +++   D A+  F+++
Sbjct: 611 AIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKA 645

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 22/224 (9%)

Query: 383 PNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQK 442
           P ++  +   ++ K++ ++  + F+ A  +DP++   Y  +G        +  AK  F+K
Sbjct: 551 PETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRK 610

Query: 443 AQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDF- 501
           A + +P +   Y  +     K   + EA   F +A+  +PI   V      +  +K ++ 
Sbjct: 611 AIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPI-NAVLICCCGVALEKLEYQ 669

Query: 502 NPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKA 561
           + A++ Y++A  L+               +A +L              ++N+A++   + 
Sbjct: 670 DKALEYYELACTLQPNSNLAR------FKRANLLYAMG----------RYNLALQSFEEL 713

Query: 562 CELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEK 605
            +L P        L QL   M + + AI+ F    T+A  +D K
Sbjct: 714 SKLTPEEPTVHFVLGQLYQIMGRKNEAIREF----TVAMNLDPK 753

>Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa]
           {ON} complement(185867..187786) [1920 nt, 640 aa]
          Length = 639

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%)

Query: 384 NSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKA 443
           +++  M     + +NSQ   + ++ A+D++P     +Y  GQ Y +L  ++ +   FQKA
Sbjct: 444 SAWTLMGHEFVELKNSQAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA 503

Query: 444 QSLNP 448
            +L P
Sbjct: 504 CTLKP 508

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 54/262 (20%), Positives = 98/262 (37%), Gaps = 61/262 (23%)

Query: 348 NAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFF---- 403
           N ++++C+ G +  L ND   A   L+++  ++P    + +       ++ S + F    
Sbjct: 616 NNSISWCFIGNYFSLINDHDKAIKYLKKATTINP---RFTYAYTLEGHEQASIDAFDTAK 672

Query: 404 KFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYK 463
             ++ AI  DP +   YY  G     L  Y  A   F+KA+ +NP N    I L C    
Sbjct: 673 NCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCCCGSA 729

Query: 464 QDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHV 523
            +K +  E   N  +L   + P                N +  ++ +AK L  +      
Sbjct: 730 LEKLNFNEKALNYYELACNLQP----------------NSSFAKFKLAKLLYSM------ 767

Query: 524 GIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQME 583
                                     ++N+A+E+L +  E+ P        L QL   M 
Sbjct: 768 -------------------------SRYNLALEILEQVIEMAPEEVTPHFLLGQLYQMMG 802

Query: 584 KIDVAIKLFQESATLARTMDEK 605
           +   ++K +    T+A  +D K
Sbjct: 803 RKKDSVKEY----TIAMNLDPK 820

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 146 SFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRR 205
           +F  A   Y+ AI  DPN    Y  +  C +  G  D+ + Y  KA  I P ++  L   
Sbjct: 667 AFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNAILLCCC 726

Query: 206 ASANESLGNFTDAMFDLSVLSLN 228
            SA E L NF +   +   L+ N
Sbjct: 727 GSALEKL-NFNEKALNYYELACN 748

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 76/191 (39%), Gaps = 18/191 (9%)

Query: 410 IDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSE 469
           ID  P    ++   G  + ++ D+  A    +KA ++NP   Y Y          D F  
Sbjct: 611 IDNYPNNSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDT 670

Query: 470 AESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLI 529
           A++ + +A    P       +Y       G     + QYD A    E  K I     P  
Sbjct: 671 AKNCYRKAIACDP--NHYNAYYG-----LGTCCMRLGQYDQALLYFEKAKMI----NP-- 717

Query: 530 GKATILARQSSQDPTQLDEEKFN-MAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVA 588
             A +L    S     L++  FN  A+     AC L P S  AK  LA+L   M + ++A
Sbjct: 718 SNAILLCCCGSA----LEKLNFNEKALNYYELACNLQPNSSFAKFKLAKLLYSMSRYNLA 773

Query: 589 IKLFQESATLA 599
           +++ ++   +A
Sbjct: 774 LEILEQVIEMA 784

>KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar to
           uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 621

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 71/160 (44%), Gaps = 7/160 (4%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
             +++  M     + +NS    + ++ A+D++P     +Y  GQ Y +L  ++ +   FQ
Sbjct: 424 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 483

Query: 442 KAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPT---FYAEILTDK 498
           K+ +L P +   +  LA    K D   E+   +  A L+  +  ++ T   F   +L +K
Sbjct: 484 KSCALKPLDKRMWQALASCYEKVDNLEESIKCYTRA-LQLSLDSDIDTTILFRLAVLYEK 542

Query: 499 GDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATI-LAR 537
                + K+Y +  R  E Q      I     KA++ LAR
Sbjct: 543 QKDIISCKEYML--RCVEAQHSTDGFINDETTKASLWLAR 580

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 3/81 (3%)

Query: 405 FFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQ 464
           F++ AI  D  +   YY  G     L +Y  A   F+KA+S+NP N    I + C     
Sbjct: 646 FYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA---ILICCCGVTM 702

Query: 465 DKFSEAESLFNEAKLKFPILP 485
           +K    E   N  +L   I P
Sbjct: 703 EKLGNQEKALNYYELACQIQP 723

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196
           +G+ + +  S+  A  +Y+ AI  D +    Y  +  C +  G+ ++ + Y  KA  I P
Sbjct: 630 QGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINP 689

Query: 197 DHSKALLRRASANESLGNFTDAM 219
            ++  +       E LGN   A+
Sbjct: 690 SNAILICCCGVTMEKLGNQEKAL 712

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 147 FGDAIKYYQYAIELDPNDPVFYSNISACYIST---GDLDKVVEYTTKALEIKPDHSKALL 203
           +  A+ Y++ A  ++P++ +    I  C ++    G+ +K + Y   A +I+P  S A  
Sbjct: 674 YEQALVYFEKARSINPSNAIL---ICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKF 730

Query: 204 RRASANESLGNFTDAM 219
           +RA    S+  +T A+
Sbjct: 731 KRAHLLYSMAKYTQAL 746

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP----VFYSNISACYISTGDLDKVVE 186
           A   K++GN  + AK + DA + Y   I++  +D       +SN +AC +   +  + V 
Sbjct: 78  AENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVN 137

Query: 187 YTTKALEIKPDHSKALLRRASANESLGNFTDA 218
              +AL+    + K   R A A   L    DA
Sbjct: 138 DCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 55/134 (41%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
           TP ++  +    +  ++  E  K FQ A  LDP +   Y  +G  Y     +  AK+ ++
Sbjct: 413 TPQTWCCVGNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYR 472

Query: 442 KAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDF 501
           KA + N  +      L     K  ++ E+   F +A    P+   +      +    G  
Sbjct: 473 KALATNSQHYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNVILICCCGVVFEKLGHQ 532

Query: 502 NPAIKQYDIAKRLE 515
             A+K Y++A  L+
Sbjct: 533 QDALKYYELACELQ 546

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 71/199 (35%), Gaps = 16/199 (8%)

Query: 401 EFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACL 460
           E        + +D   P T+   G M+ + +D+  A   FQKA  L+P   Y Y      
Sbjct: 398 ELSHLCHELMSVDRFTPQTWCCVGNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHE 457

Query: 461 LYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKK 520
               D F  A++ + +A                     G +  ++  +  A  +  V   
Sbjct: 458 YSSNDAFDTAKTCYRKALATNSQHYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNVI 517

Query: 521 IHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLEL 580
           +    G +  K   L  Q  QD           A++    ACEL P S  A    +QL L
Sbjct: 518 LICCCGVVFEK---LGHQ--QD-----------ALKYYELACELQPTSSLALFKKSQLLL 561

Query: 581 QMEKIDVAIKLFQESATLA 599
            M   + A+  F++   +A
Sbjct: 562 SMGSYNSALVNFEKLVIMA 580

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 75/193 (38%), Gaps = 22/193 (11%)

Query: 410 IDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSE 469
           +D  P  P T+   G +  + +D+  A   F+KA  L+P   Y Y          D    
Sbjct: 538 MDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDS 597

Query: 470 AESLFNEAKLKFPILPEVPTFYAEILTDK---GDFNPAIKQYDIAKRLEEVQKKIHVGIG 526
           A++ + +A       P+    Y  + T     G +  A+  ++ A+ +  V   +    G
Sbjct: 598 AKTCYRKA---LACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCG 654

Query: 527 PLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKID 586
             + K                +EK     EL   AC+L P S  +K  + QL   M + +
Sbjct: 655 GSLEKLGY-------------KEKVLQYYEL---ACQLQPTSSLSKYKMGQLLYSMTRYN 698

Query: 587 VAIKLFQESATLA 599
           VA++ F+E   L 
Sbjct: 699 VALQTFEELVKLV 711

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 67/171 (39%), Gaps = 22/171 (12%)

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           ++ A+  DP++   YY  G     L  Y  A   F+KA+S+NP NV   + + C     +
Sbjct: 602 YRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 658

Query: 466 KFSEAESLFNEAKLKFPILPEVPTF---YAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           K    E +    +L   + P          ++L     +N A++ ++   +L       H
Sbjct: 659 KLGYKEKVLQYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAH 718

Query: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKI 573
             +G       I+ R+               A++ LT A  LDP+  Q  I
Sbjct: 719 YLLG---QTYRIVGRKKD-------------AVKELTVAMNLDPKGNQVVI 753

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 9/109 (8%)

Query: 419 TYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAK 478
           T+YH G+++ +  DY  A   FQ+A + +  N   +  +  L Y+  ++ +A   +  A 
Sbjct: 380 TWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAI 439

Query: 479 LKFPILPEV----PTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHV 523
              P + EV     T Y    T     N A+  Y  A RL+     +H+
Sbjct: 440 RLNPYISEVWYDLGTLYE---TCNNQLNDALDAYKQAARLDP--NNVHI 483

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 42/82 (51%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G ++   +   ++I+++Q A+ +D +D   +  +   Y + G ++  ++   +ALE+ P+
Sbjct: 667 GVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPE 726

Query: 198 HSKALLRRASANESLGNFTDAM 219
           H  A L  A +   L  F  ++
Sbjct: 727 HKYAGLFLAISLCQLSEFEKSL 748

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 43/77 (55%)

Query: 142 FTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKA 201
           ++   F   ++ +Q A++++PND + ++ + A   ++   ++ ++   KA+ +KP   +A
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 202 LLRRASANESLGNFTDA 218
               A A+ ++G + +A
Sbjct: 512 RYNLAVASMNIGCYQEA 528

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F++   +   +  ++ A+ + P+D + ++ + A   ++   ++ ++   KAL++KP   +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSLN 228
           A    A +  ++G F +A  + L+ LS++
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 32/66 (48%)

Query: 148 GDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRAS 207
           G  + Y   ++   P       N++AC+    DL + + Y+ K ++++P + K  +RR  
Sbjct: 50  GAVVSYNDKSLTHHPRYIKLLDNLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGK 109

Query: 208 ANESLG 213
             + LG
Sbjct: 110 VLQKLG 115

>KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}
           Anc_2.665 YKL022C
          Length = 780

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 9/92 (9%)

Query: 120 RGLSAPQRQAFAVQLKDKGNHFFTAKSFGD---AIKYYQYAIELDPNDPVFYSNISACYI 176
           R L +  + A ++Q     N   T K  GD   AIK ++Y +E    D   Y  +   Y+
Sbjct: 610 RELDSNSKTAISIQT----NLGHTYKKLGDYEHAIKCFKYILEDSERDVDTYCTLGFLYL 665

Query: 177 STGDLDKVVEYTTKALEIKPDHSKA--LLRRA 206
            T  L K V+   +AL I+P +  A  +L RA
Sbjct: 666 KTNQLQKAVDILHRALAIEPSNQNANEMLVRA 697

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 74/193 (38%), Gaps = 22/193 (11%)

Query: 410 IDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSE 469
           +D  P  P T+   G +  + +D+  A   F+KA  L+P   Y Y          D    
Sbjct: 526 MDTMPNKPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDS 585

Query: 470 AESLFNEAKLKFPILPEVPTFYAEILTDK---GDFNPAIKQYDIAKRLEEVQKKIHVGIG 526
           A++ + +A       P+    Y  + T     G +  A+  ++ A+ +  V   +    G
Sbjct: 586 AKTCYRKA---LACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCG 642

Query: 527 PLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKID 586
             + K                +EK   A++    AC L P S  +K  + QL   M +  
Sbjct: 643 GSLEKLGY-------------KEK---ALQYYELACHLQPTSSLSKYKMGQLLYSMTRYS 686

Query: 587 VAIKLFQESATLA 599
           VA++ F+E   L 
Sbjct: 687 VALQTFEELVKLV 699

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 4/108 (3%)

Query: 353 FCYAGIFQFLKNDLLDAQALLQESINLHPT-PNSYVFMALTVADKENSQEFFKFFQNAID 411
           +C  G    L+ D   A    +++  L P    +Y       +  ++S      ++ A+ 
Sbjct: 536 WCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALA 595

Query: 412 LDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLAC 459
            DP++   YY  G     L  Y  A   F+KA+S+NP NV   + + C
Sbjct: 596 CDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICC 640

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/144 (18%), Positives = 71/144 (49%), Gaps = 4/144 (2%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+  + F   I  ++ A+ + P+D   ++ + A   ++   ++ ++   +A+++KP   +
Sbjct: 427 FYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVR 486

Query: 201 ALLRRASANESLGNFTDAMFD-LSVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLK- 258
           A    A ++ ++G + +A    L+ LS++ + +G ++ P      +   ++ L  + +  
Sbjct: 487 ARYNLAVSSMNIGCYREAAEHLLTALSMH-EVEGVAMAPGSGNVPSSNILETLKRAFIAM 545

Query: 259 NGDDKSSQILPSNTSLASFFGIFD 282
           +  D   +++P N  L  F G F+
Sbjct: 546 DRRDLLERVVP-NMDLQQFRGEFN 568

>Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
           T N++  M     +  NS    + ++ A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 442 KAQSLNPGN 450
           KA +L P +
Sbjct: 490 KACTLKPWD 498

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 25/125 (20%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP----VFYSNISACYISTGDLDKVVEYT 188
           + KD+G  FF A  +  A + Y+ ++   P +     V YSN++A     G+  + +   
Sbjct: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334

Query: 189 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 227
             ALE+ P                        K + RRA A E + N+  A+ D   L  
Sbjct: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394

Query: 228 NGDFD 232
             +F+
Sbjct: 395 KNNFN 399

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 41/90 (45%)

Query: 398 NSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQL 457
           N+Q        ++++D     T+YH G+++ +  DY  A   FQ A + +  N   +  +
Sbjct: 297 NTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 356

Query: 458 ACLLYKQDKFSEAESLFNEAKLKFPILPEV 487
             L Y+  ++ +A   +  A    P + EV
Sbjct: 357 GVLYYQISQYRDALDAYTRAIRLNPYISEV 386

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
           dsRNA virus protection family member contains 8 copies
           of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 45/98 (45%), Gaps = 17/98 (17%)

Query: 118 RLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYIS 177
           R+ G+S  +RQ +A                 ++I+++Q +I +  +D   +  +   Y++
Sbjct: 673 RVLGMSCLERQLYA-----------------ESIEWFQSSIRVSSSDVESWVGLGQAYLN 715

Query: 178 TGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNF 215
            G ++  ++   K LE+  +H  A    A A  +LG F
Sbjct: 716 CGRVEASIKVFKKVLELDENHHFAWYFLAIALSALGEF 753

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 29/71 (40%)

Query: 135 KDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEI 194
           K +GN  F    +  A K+Y   I  +P +P+ YSN +   I     D+ +      L  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 195 KPDHSKALLRR 205
             D     ++R
Sbjct: 67  SSDPEHEAIKR 77

>Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
           T N++  M     +  NS    + ++ A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 442 KAQSLNPGN 450
           KA +L P +
Sbjct: 490 KACTLKPWD 498

>Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
           T N++  M     +  NS    + ++ A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 442 KAQSLNPGN 450
           KA +L P +
Sbjct: 490 KACTLKPWD 498

>Smik_11.262 Chr11 (438440..438988) [549 bp, 182 aa] {ON} YKR007W
           (REAL)
          Length = 182

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 75/160 (46%), Gaps = 18/160 (11%)

Query: 173 ACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNG-DF 231
           A Y S G+ +   EY  + + +K    K L R     E + N  D + D+S+++ +G   
Sbjct: 25  AGYGSQGNANS--EYDAEQMRLKEHEQKLLAREQELREIVANTNDKLIDISMINNSGIVI 82

Query: 232 DGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSS-QILPSNTSLASFFGIFDPDLETSRV 290
            GT ++  L++   ++  +V  E     GDD +S + +PS+ S         P     R 
Sbjct: 83  QGTDLQEALDKKQQEEG-EVSPEDGRSAGDDNTSGRSVPSSRSAERSATHAAP-----RT 136

Query: 291 NTGSLLDSASAT--LSEALQSLYSATSEGYLIADDLLTKA 328
           NT ++L S  +T    E L+ L+S       I D++L+++
Sbjct: 137 NTFTVLTSPDSTRITKEQLKKLHSN------ILDEILSQS 170

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%)

Query: 398 NSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQL 457
           N Q+       +++ DP    T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 266 NPQKALSLLLKSLEFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSI 325

Query: 458 ACLLYKQDKFSEAESLFNEAKLKFPILPEV 487
             L Y+  ++ +A   +  A    P + EV
Sbjct: 326 GVLYYQISQYRDALDAYTRAIRLNPYISEV 355

>YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}
           CDC23Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 626

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
           T N++  M     +  NS    + ++ A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 442 KAQSLNPGN 450
           KA +L P +
Sbjct: 490 KACTLKPWD 498

>ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/112 (20%), Positives = 54/112 (48%), Gaps = 2/112 (1%)

Query: 117 DRLRGLSAPQR--QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISAC 174
           +RL G    +R  Q      +  G  +   +   ++I+++Q A+ ++ +D   +  +   
Sbjct: 651 ERLVGSERAKRALQTVNWPFRVIGIAYLEGQQEANSIEWFQSALRVNQSDVEAWVGLGQA 710

Query: 175 YISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLS 226
           Y + G ++  ++   KA+E+  +H  A   +A +   +G F +A+  L+ L+
Sbjct: 711 YYACGRIEASIKVFEKAIELDSEHHYAKYLKAQSLSLMGQFDEAIDILNALT 762

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 19/99 (19%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSN----ISACYISTGDLDKVVEYTTKALEIKP 196
            F  K+F  ++K +Q   EL  N+PV   +    I AC+    D    +    ++LE+ P
Sbjct: 207 LFRKKNFMASLKLFQ---ELLVNNPVLKPDPRIGIGACFWQLKDYKMAINAWERSLELDP 263

Query: 197 DHS------------KALLRRASANESLGNFTDAMFDLS 223
            +             K L+   + +E   NF DAM DLS
Sbjct: 264 TNKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%)

Query: 384 NSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKA 443
           ++++ M     + +NS    + ++ A D++P     +Y  GQ Y +L  +  A   FQKA
Sbjct: 438 HAWILMGHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKA 497

Query: 444 QSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA 477
            +L P +   +   A    K DK  +A   F  +
Sbjct: 498 CALKPLDKRMWFASASCYEKLDKTVQAIKCFQRS 531

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 554 AIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAE 613
           AIE   +A +++PR  QA  GL Q    ++K   A+  FQ++  L + +D+++   + + 
Sbjct: 456 AIECYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKACAL-KPLDKRMWFASASC 514

Query: 614 AAKIQKRLRA 623
             K+ K ++A
Sbjct: 515 YEKLDKTVQA 524

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAI----ELDPNDPVFYSNISACYISTGDLDKVVEYT 188
           + KD+G  +F    +  A + Y+ ++    +L P   +  SN+ A  + TGD   ++  +
Sbjct: 399 EFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIS 458

Query: 189 TKALEIKPDHSK 200
           T AL++ P  SK
Sbjct: 459 TSALDLFPKESK 470

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 44/96 (45%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
             +++  M     + +NS    + ++ A+D++P     +Y  GQ Y +L  ++ +   FQ
Sbjct: 431 CTSAWTLMGHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 490

Query: 442 KAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA 477
           KA +L P +   +  LA    K  K  E+   +  A
Sbjct: 491 KACALKPLDKRMWQALASCYEKLSKKDESIKCYERA 526

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 150 AIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE--IKPDHSKALLRR 205
           ++ Y+Q A  L P D   +  +++CY      D+ ++   +AL+  I  DH  A+L R
Sbjct: 485 SLYYFQKACALKPLDKRMWQALASCYEKLSKKDESIKCYERALQLSISSDHDTAILYR 542

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%)

Query: 384 NSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKA 443
           +++  M     + +NS    + ++ A+D++P     +Y  GQ Y +L  ++ +   FQKA
Sbjct: 488 SAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA 547

Query: 444 QSLNP 448
            +L P
Sbjct: 548 CALKP 552

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 61/141 (43%), Gaps = 6/141 (4%)

Query: 116 MDRLRGLS-APQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPND----PVFYSN 170
           +D L+ L+   +    A   K +GN  +  K + +A   Y+  IE++ N+     + + N
Sbjct: 58  LDALKALAYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVN 117

Query: 171 ISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 230
            +AC +   +    +    KAL   P + K   R A A  ++  + ++   +    L  D
Sbjct: 118 KAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE-FGLKVD 176

Query: 231 FDGTSIEPMLERNLNKQAMKV 251
              +S+  +L+  + KQ  K 
Sbjct: 177 SRNSSLLNLLKTIIKKQEEKT 197

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 78/183 (42%), Gaps = 7/183 (3%)

Query: 350 ALAFCYAGIFQFLKNDLLDAQALLQESINLHPT-PNSYVFMALTVADKENSQEFFKFFQN 408
            + +C  G    L  D  +A   L+++ +L+P    +Y       ++ +        ++ 
Sbjct: 438 CITWCCLGNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRK 497

Query: 409 AIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFS 468
           A+ ++P +   +Y  G     L  Y  A   F+KA+S+NP NV   I   C     ++  
Sbjct: 498 ALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV---ILNCCCGVALERLG 554

Query: 469 EAESLFNEAKLKFPILPEVPTFY---AEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525
             E   +  +L   + P         +++L + G ++ A++ ++  ++L   +  +H  +
Sbjct: 555 RREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPVHFLL 614

Query: 526 GPL 528
           G L
Sbjct: 615 GQL 617

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 43/101 (42%)

Query: 383 PNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQK 442
           P ++  M    +  ++  E    F  AI LDP +   Y  +G  Y     + NAKS F+K
Sbjct: 492 PIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRK 551

Query: 443 AQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPI 483
           A ++   +      L     K  KF EA   F +A+   P+
Sbjct: 552 ALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPV 592

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 79/192 (41%), Gaps = 18/192 (9%)

Query: 351 LAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKE--NSQEF---FKF 405
           +A+C  G    L  D  +A     ++I L P    +   A T+   E  N+  F      
Sbjct: 493 IAWCSMGNLHSLNKDHDEAITAFGKAIQLDP----FFAYAYTLQGHEYSNNDAFDNAKSC 548

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           F+ A+ ++  +    Y  G     L  +  A   F+KA++LNP NV   I   C     +
Sbjct: 549 FRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNV---ILNCCCGVALE 605

Query: 466 KFSEAESLFNEAKLKFPILPEVPTFY---AEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           +  + E   N  +L   + P         +++L + G ++ A+  ++  + L   +  +H
Sbjct: 606 RLQQPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLTPDEAHVH 665

Query: 523 VGIGPL---IGK 531
             +G L   +GK
Sbjct: 666 FLLGNLYQIVGK 677

>TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.72
           YHR166C
          Length = 622

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
             N++  M     +  NS    + ++ A+D++ +    +Y  GQ Y +L  ++ +   FQ
Sbjct: 425 CTNAWTLMGHEFVELRNSHAAIECYRRAVDMNTKDFKAWYGLGQAYEVLDMHLYSLYYFQ 484

Query: 442 KAQSLNP 448
           KA +L P
Sbjct: 485 KACTLKP 491

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 41/90 (45%)

Query: 398 NSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQL 457
           ++Q        ++++D     T+YH G+++ +  DY  A   FQ A + +  N   +  +
Sbjct: 293 DTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 352

Query: 458 ACLLYKQDKFSEAESLFNEAKLKFPILPEV 487
             L Y+  ++ +A   +  A    P + EV
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRLNPYISEV 382

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 419 TYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAK 478
           T+YH G+++ +  DY  A   FQ+A + +  N   +  +  L Y+  ++ +A   +  A 
Sbjct: 314 TWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAI 373

Query: 479 LKFPILPEV 487
              P + EV
Sbjct: 374 RLNPYISEV 382

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 35.0 bits (79), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 43/102 (42%), Gaps = 17/102 (16%)

Query: 412 LDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKF---- 467
           LD E PP   H+ Q+ F+ +       DFQK  +       PYI L  +      F    
Sbjct: 322 LDRERPPNVVHQNQLIFVNKSKQIQAFDFQKKVT-----SLPYINLKGIGELWSSFRNIS 376

Query: 468 ---SEAESLFNEAKLKFP--ILPEVPTFYAE---ILTDKGDF 501
              S+   L N A  KF   +LP+ PT   E    + DKG+F
Sbjct: 377 YNPSQHSVLVNTADDKFALVVLPKQPTGAVEPNGAIIDKGNF 418

>KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {ON}
           Anc_2.665 YKL022C
          Length = 704

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 131 AVQLKDKGNHFFTAKSFGD---AIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187
           AV ++    H  T +  GD   AI+ ++Y ++    DP  Y  +   Y+ T  L K ++ 
Sbjct: 552 AVSIQTNLGH--TYRKLGDNERAIECFKYVLQDSEKDPDLYVTLGFLYLQTKQLQKGIDC 609

Query: 188 TTKALEIKPDHSKA 201
             +AL IKP  + A
Sbjct: 610 LHRALAIKPGMTSA 623

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
           T +++  M     + +NS    + ++ A+D+DP     +Y  GQ Y +L  ++ +   FQ
Sbjct: 443 TTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQ 502

Query: 442 KAQSLNP 448
           +A  L P
Sbjct: 503 RACILKP 509

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 30/77 (38%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           GNHF   K   +AIK +  A ELDP     Y+     Y S    D    +  KAL     
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 198 HSKALLRRASANESLGN 214
           H  A     + +   GN
Sbjct: 561 HYNAYYGLGTCDSQNGN 577

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 15/78 (19%), Positives = 40/78 (51%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+    F   I  ++ A+ + PND   ++ + A   ++   ++ ++   +A+++KP   +
Sbjct: 431 FYANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVR 490

Query: 201 ALLRRASANESLGNFTDA 218
           A    A ++ ++G + +A
Sbjct: 491 ARYNLAVSSMNIGCYKEA 508

>Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]
           {ON} YHR166C (CDC23) - Cell division cycle protein
           [contig 160] FULL
          Length = 619

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 34/67 (50%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
             +++  M     + +NS    + ++ A+D++P     +Y  GQ Y +L  ++ +   FQ
Sbjct: 422 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 481

Query: 442 KAQSLNP 448
           K+ +L P
Sbjct: 482 KSCALKP 488

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/89 (19%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F++   +   +  ++ A+ + P+D + ++ + A   ++   ++ ++   KAL++KP   +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSLN 228
           A    A +  ++G + +A  + L+ LS++
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 36/71 (50%)

Query: 149 DAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASA 208
           ++++++  A+ +DPND   +  +   Y + G ++   +   KA+EI P H  A    + +
Sbjct: 703 ESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEIDPLHLYAQYFNSLS 762

Query: 209 NESLGNFTDAM 219
              +G F + +
Sbjct: 763 LAEMGCFEECI 773

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 36/76 (47%)

Query: 377 INLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINA 436
           + L  T   Y  + +   +++   E  ++F +A+ +DP    ++   GQ YF       +
Sbjct: 679 MELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEAS 738

Query: 437 KSDFQKAQSLNPGNVY 452
              F+KA  ++P ++Y
Sbjct: 739 TKVFEKAIEIDPLHLY 754

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 135 KDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE- 193
           K+ GN  F    + +A+  Y   I   P +PV YSN +   I   +    ++   + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 194 -IKPDHS 199
            + P+H+
Sbjct: 72  ALGPEHA 78

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 419 TYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAK 478
           T+YH G+++ +  DY  A   FQ+A + +  N   +  +  L Y+  ++ +A   +  A 
Sbjct: 310 TWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAI 369

Query: 479 LKFPILPEV 487
              P + EV
Sbjct: 370 RLNPYISEV 378

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/101 (19%), Positives = 52/101 (51%), Gaps = 2/101 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+    F   I  ++ A+ ++ ND + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 436 FYVDDQFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVR 495

Query: 201 ALLRRASANESLGNFTDAMFD-LSVLSLNGDFDGTSIEPML 240
           A    A ++ ++G + +A    L+ LS++ +  G +  P +
Sbjct: 496 ARYNLAVSSINIGCYKEAAEHLLTALSMH-EVSGGATNPSM 535

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 97/249 (38%), Gaps = 39/249 (15%)

Query: 362 LKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYY 421
           L N+LL+ Q            P ++  +    + + +  E  ++F+ A ++DP +   Y 
Sbjct: 497 LSNELLETQP---------DKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYT 547

Query: 422 HRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKF 481
            +G  +        AK+ ++KA + +P +   Y  L     K  ++ EA   F +A+   
Sbjct: 548 LQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSIN 607

Query: 482 PILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQ-----KKIHVGIGPLIGKATILA 536
           P+   +       L        A++ Y++A  L+        KK H+          ++A
Sbjct: 608 PVNVILICCCGVALEKMSYQEKALQYYELASELQPSSSLAKFKKAHL--------LYVMA 659

Query: 537 RQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESA 596
           R             +++A+E   +  EL P        L QL   M +   A+K F    
Sbjct: 660 R-------------YSVALENFEELAELAPDEATVHFLLGQLYQIMGRKKDAVKEF---- 702

Query: 597 TLARTMDEK 605
           T+A  +D K
Sbjct: 703 TIAMNLDPK 711

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/89 (19%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F+  + +   I  ++ A+ + P+D + ++ + A   ++   ++ ++   +AL++KP   +
Sbjct: 432 FYANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 491

Query: 201 ALLRRASANESLGNFTDAM-FDLSVLSLN 228
           A    A ++ ++G + +A  + L+ LS++
Sbjct: 492 ARYNLAVSSMNIGCYKEAAEYLLTALSMH 520

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/78 (20%), Positives = 41/78 (52%)

Query: 141 FFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSK 200
           F++   F   I  ++ A+ + P D + ++ + A   ++   ++ ++   KAL++KP   +
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR 500

Query: 201 ALLRRASANESLGNFTDA 218
           A    A ++ ++G + +A
Sbjct: 501 ARYNLAVSSINIGCYKEA 518

>KLTH0B04466g Chr2 (360380..362344) [1965 bp, 654 aa] {ON} similar
           to uniprot|P25298 Saccharomyces cerevisiae YMR061W RNA14
           Cleavage and polyadenylation factor I (CF I) component
           involved in cleavage and polyadenylation of mRNA 3' ends
           bridges interaction between Rna15p and Hrp1p in the CF I
           complex
          Length = 654

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 448 PGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTD 497
           PG++  Y++LA LL  +D+  EA  +F++   +FP+    P +  E+  D
Sbjct: 41  PGDICTYLELARLLQSRDQQEEARGVFDQLHERFPLFS--PLWTVEVGYD 88

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 38/97 (39%), Gaps = 3/97 (3%)

Query: 398 NSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQL 457
           N  E  K+F  A  LDP +   +      Y +  ++  A S +  A    PG   P++ L
Sbjct: 437 NITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYL 496

Query: 458 ACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEI 494
                + D  + AE  F    + + I P  P    E+
Sbjct: 497 GMQYSRMDTLTLAEEYF---MMAYDICPTDPLLLNEL 530

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 88/375 (23%), Positives = 148/375 (39%), Gaps = 68/375 (18%)

Query: 139 NHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDH 198
           +H+ TA+  GD +    Y++  DPND  + + +   Y + G   + VE  ++      D 
Sbjct: 150 HHYRTAEYIGDKV----YSMTRDPNDAFWLAQV---YYNMGQYIRAVELLSRD---GLDA 199

Query: 199 SKALLRRASAN--ESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESL 256
           S  + R  +A     +  + DA   L ++     F   S E +  RNL+   +K+ +   
Sbjct: 200 SSVMCRYLTALCLVKMEKYDDA---LDIVGEVNPFKDDSAEHV--RNLDG-GIKLESSLC 253

Query: 257 LKNGDDKSSQILPSNTSLAS------------FFGIFD---------PDLET---SRVNT 292
              G+  S+Q   +N  LA              F  FD         PD ET   +R++ 
Sbjct: 254 YLRGEIYSAQ---NNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDEETEFIARLDF 310

Query: 293 GSLLDSASATLSEALQSLYSATSEGYLIADDLLTKAT-----DEYHSLLRANKEDRVIRE 347
             L D+      E ++ LYS     Y   D    KA      DEYH  L  NK+   ++ 
Sbjct: 311 TDLDDN-----QELIRCLYSTKLSKY--GDLTKLKAAHRFLLDEYH--LEDNKD---VQT 358

Query: 348 NAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQ 407
                  + G  ++L+   L  + L Q+  N    P +YV     +  K    + F    
Sbjct: 359 TEIELLIFQG--KYLECLELCEKVLEQDEFNFDVLP-TYVQCLYELGGK---NKLFLVSH 412

Query: 408 NAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKF 467
              +  P+   T++  G  YF + +   A+  F KA  L+P   Y ++  A     + + 
Sbjct: 413 KLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEH 472

Query: 468 SEAESLFNEAKLKFP 482
            +A S ++ A   FP
Sbjct: 473 EQALSAYSTAARFFP 487

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 66/171 (38%), Gaps = 22/171 (12%)

Query: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465
           ++ A+  DP++   YY  G     L  Y  A   F+KA+S+NP NV   + + C     +
Sbjct: 597 YRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 653

Query: 466 KFSEAESLFNEAKLKFPILPEVPTF---YAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522
           K    E      +L   + P          ++L     +N A++ ++   +L       H
Sbjct: 654 KLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAH 713

Query: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKI 573
             +G       I+ R+               AI+ LT A  LDP+  Q  I
Sbjct: 714 YLLG---QTYRIVGRKKD-------------AIKELTVAMNLDPKGNQVII 748

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 170 NISACYISTGDLDKVVEYTTKALEIKPDHSKALLR 204
           N+SA Y   GDL K + Y TK +E+ P + K  +R
Sbjct: 78  NMSATYEKLGDLKKALSYATKMVEVDPYNLKCYIR 112

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 63/159 (39%), Gaps = 31/159 (19%)

Query: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDP----VFYSNISACYISTGDLDKVVEYTTKAL 192
           +G+ FF    +  A++ Y+ ++   P       + YSNI+A  +  G+   +V+   KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 193 EIKPDH---------------------SKALLRRASANESLGNFTDAMFDLSVLSLNGDF 231
           ++ P                       SK +LR+A A E L NF  A      L  N  F
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482

Query: 232 DGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPS 270
               ++        ++  KVLN  + K    K S   P+
Sbjct: 483 SDKIMDG------KRRCQKVLNPEIAKKTQQKPSSSKPA 515

>CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} some
           similarities with uniprot|P09798 Saccharomyces
           cerevisiae YKL022c CDC16
          Length = 743

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 27/64 (42%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G  +  + +   A +Y+  A E  P DPV  + I       G+L K   Y  KA E   D
Sbjct: 530 GMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKD 589

Query: 198 HSKA 201
             ++
Sbjct: 590 MERS 593

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G  +    +   A +Y+  A ++ PNDP+  + +   +    DL K   Y  KALE   D
Sbjct: 509 GMQYMALNTLTLAEEYFTLAYDIYPNDPLLLNEMGVLHFKKNDLQKSKRYLKKALEAAKD 568

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 120 RGLSAPQRQAFAVQLKDKGNHFFTAKSFGD---AIKYYQYAIELDPNDPVFYSNISACYI 176
           + + +  + + ++Q+    N   T +  G+   AIK ++  +E+   DP  + ++   Y+
Sbjct: 567 KDMDSTSKTSISIQM----NLAHTYRRLGEIEMAIKCFKAILEVCGKDPDIFCSLGFLYL 622

Query: 177 STGDLDKVVEYTTKALEIKPDHSKA 201
            T  L K +++   +L +KP +S A
Sbjct: 623 KTKQLQKAIDHLHLSLSLKPSNSVA 647

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE 193
           G  +    +F  A +Y+  A +  P DP+  + +   Y    DL K   Y  +ALE
Sbjct: 572 GMQYMALNTFSLAEEYFTLAYDTCPQDPLLLNEMGVMYFKRNDLHKAKRYLKRALE 627

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 3/98 (3%)

Query: 397 ENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQ 456
           E  +E  K+F  +  LDP + P +      Y I  +   A S +  A    PG   P + 
Sbjct: 511 EKIEEARKYFSKSSILDPNFAPAWLGFAHTYAIEGEQDQAISAYSTAARFFPGIHLPNLF 570

Query: 457 LACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEI 494
           L       + FS AE  F    L +   P+ P    E+
Sbjct: 571 LGMQYMALNTFSLAEEYFT---LAYDTCPQDPLLLNEM 605

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 357 GIFQFLKNDLLDAQALLQESIN----LHPTPNSYVFMALTVADK-----ENSQEFFKFFQ 407
           G+  F +NDL  A+  L+ ++     L+PT  + V + + +A       EN +   K F+
Sbjct: 606 GVMYFKRNDLHKAKRYLKRALEAVKELNPTSRTSVSIQMNLAHAYRRLGEN-ERAIKCFK 664

Query: 408 NAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNV 451
             +++  +   TY   G +Y   ++   A      A SL P N+
Sbjct: 665 TVLEVSSKDSDTYCSLGFLYLKTKELQRAIDHLHTALSLKPSNL 708

>AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL145C (CTR9)
          Length = 1057

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 83/190 (43%), Gaps = 26/190 (13%)

Query: 431 QDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTF 490
           Q ++ A   FQK   ++P N++    LA +  +  +F ++  +  + +       +V   
Sbjct: 677 QSFLKAVQLFQKVLQIDPLNIFAAQGLAIIFAESKRFGQSLDILRKVRDSLDN-EDVHMN 735

Query: 491 YAEILTDKGDFNPAIKQYDIA-KRLEEVQKKIHV-----------GIGPLIGKATILARQ 538
            A  L +  DF  AI+ Y+I   R E ++ K  +           G+        + A Q
Sbjct: 736 LAHCLLEMKDFVKAIENYEITITRFENIENKSTLLNLLGFAWYSRGLKEKSLDCFLKALQ 795

Query: 539 SSQDPTQLDEEK----------FNMA-IELLTKACELDPRSEQAKIGLAQLELQMEKIDV 587
            +++   L++EK          FN+A +E   +  E+  RS+  +  LAQLE  +  +  
Sbjct: 796 YTKEALALEQEKPESRLTSGFMFNVAFVEF--QVAEVLRRSQPKERTLAQLEASVSGLQE 853

Query: 588 AIKLFQESAT 597
           A+ L ++ A+
Sbjct: 854 AVSLLKQLAS 863

>SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 76/209 (36%), Gaps = 34/209 (16%)

Query: 404 KFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYK 463
           K+F  A  LDP +   +      Y    ++  A S +  A    PG   P + L      
Sbjct: 454 KYFSKASILDPNFGQAWIGFAHTYAAEGEHEQAVSAYSTASRFFPGTHLPNLFLGMQYIV 513

Query: 464 QDKFSEAESLFNEAKLKFPILPEVPTFYAE---ILTDKGDFNPAIKQY-----DIAKRLE 515
            +  S AE       L + I P  P    E   I   K D+ P  K+Y     + +KRL 
Sbjct: 514 MNTLSLAEEYLT---LAYDICPHDPLLLNEMGVIYFKKSDY-PKAKKYFKKAWEASKRLN 569

Query: 516 EVQK---KIHVGIGPLIGKA----------TILARQSSQDPT--------QLDEEKFNMA 554
              K    IH  +G    K            I+   S+QD +         L   K   A
Sbjct: 570 SDSKAWLSIHTNLGHTYRKMGDYERAVACFKIVLETSNQDTSVYCAIGLIYLKLRKIEKA 629

Query: 555 IELLTKACELDPRSEQAKIGLAQ-LELQM 582
           I+ L  A  L P ++ A+  L Q LE+ M
Sbjct: 630 IDSLHNALALQPSNQIAQDLLKQALEVNM 658

>ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON}
           similar to uniprot|P25298 Saccharomyces cerevisiae
           YMR061W RNA14 Cleavage and polyadenylation factor I (CF
           I) component involved in cleavage and polyadenylation of
           mRNA 3' ends bridges interaction between Rna15p and
           Hrp1p in the CF I complex
          Length = 652

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 446 LNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFP 482
           LNP ++ PY++L      +D F E+  ++N    KFP
Sbjct: 38  LNPADILPYLELVQYYESKDSFQESREVYNSLHDKFP 74

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197
           G      K F  A +  Q A+  D  +P+F+ +I   Y   G     ++  T+A+ + P 
Sbjct: 421 GRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPY 480

Query: 198 HSKALLRRASANESLGN-FTDAM 219
            S+      +  E+  +  TDA+
Sbjct: 481 ISEVWYNLGTLYETCNDQITDAL 503

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 38/97 (39%), Gaps = 3/97 (3%)

Query: 398 NSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQL 457
           N  E  K+F  A  LDP +   +      Y +  ++  A S +  A    PG   P++ L
Sbjct: 447 NIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYL 506

Query: 458 ACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEI 494
                + D  + AE  F    + + I P  P    E+
Sbjct: 507 GMQYSRMDTLTLAEEYF---MMAYDICPTDPLLLNEL 540

>KAFR0B06030 Chr2 (1247049..1247765) [717 bp, 238 aa] {ON} Anc_8.372
           YDR174W
          Length = 238

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 72/152 (47%), Gaps = 30/152 (19%)

Query: 299 ASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLL--------RANKEDRVIRENAA 350
           A  TL+E+LQ+L SAT++ + I+ DLL    DE   +         +  ++    ++   
Sbjct: 44  AFTTLTESLQTLTSATNQFHSISSDLLNPVDDEKEIIAPSKTPLKRKVERDPNAPKKPLT 103

Query: 351 LAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKE---NSQEFFKFFQ 407
           + F Y+    +++ +L DA    ++   L P  ++ +   ++   KE   N +E +K   
Sbjct: 104 VFFAYSA---YVRQELRDA----RQKAGLPPLSSTEITQEISKKWKELSDNEKEKWKQAY 156

Query: 408 NAIDLDPEYPPTYYHRGQMYFILQDYINAKSD 439
           N ++L      T+Y + +     QDY+ AK +
Sbjct: 157 N-VEL------THYQKAK-----QDYLEAKKN 176

>KLTH0D17512g Chr4 (1457372..1461661) [4290 bp, 1429 aa] {ON} highly
            similar to uniprot|P47169 Saccharomyces cerevisiae
            YJR137C ECM17 Sulfite reductase beta subunit involved in
            amino acid biosynthesis transcription repressed by
            methionine
          Length = 1429

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 79/206 (38%), Gaps = 45/206 (21%)

Query: 261  DDKSSQILPSNTSLASFFGIF---DPDLETSRVNTGSLLDSASATLSEALQSLYSATSEG 317
            DD +  I  S+  L  F GI+   D D+  +R   G  L+     +S        AT E 
Sbjct: 857  DDSTGAISASDQQLTKFHGIYMQDDRDIRDTRKAQG--LEPYYIFMSRIRLPGGKATPEQ 914

Query: 318  YLIADDL-----------LTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDL 366
            +L+ D L            T+AT + H +++ N +  +   N+ L    A      +N +
Sbjct: 915  WLVLDHLADKTGNGTVKVTTRATFQLHGVVKRNLKHTIRAMNSTLMDTLAACGDVNRNVM 974

Query: 367  LDA---QALLQESI---------NLHPTPNSYVFMALTVAD-KENSQEFFKFFQNA---- 409
            L A    A + + +         +L P   +Y  + L  AD K+ S  +   F+N     
Sbjct: 975  LSALPVNAKVHKQVSDISAKISEHLLPQTTAYHEIWLEGADEKDESPNWPSIFENRQEGP 1034

Query: 410  ------------IDLDPEYPPTYYHR 423
                        +D +P Y PTY  R
Sbjct: 1035 IKKKTLVSGNALVDQEPLYGPTYLPR 1060

>NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72
          Length = 631

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 42/97 (43%)

Query: 381 PTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDF 440
              +++  M     + +NS    + ++ A+D++      +Y  GQ Y +L  ++ +   F
Sbjct: 434 KCTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWYGLGQAYEVLDMHLYSLYYF 493

Query: 441 QKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA 477
           QKA +L P +   +  L     K    +EA   F  A
Sbjct: 494 QKACTLKPLDRRMWQALGTCYTKIGNKTEAIKCFERA 530

>CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047c TFC4
          Length = 1062

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%)

Query: 167 FYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFT 216
            Y  ++ CY    D +K  EY  K LE+ P    A L  A  N  LG+ T
Sbjct: 517 LYEPLTKCYKEIEDYEKAKEYGDKVLEMDPKSMDAKLNVAEINYYLGDKT 566

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 25/112 (22%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIE-LDPNDP---VFYSNISACYISTGDLDKVVEYT 188
           + K KG++FF    + ++++ Y+ ++  L  N P   +  SNI A  +  G+  K +E +
Sbjct: 376 EFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENS 435

Query: 189 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAM 219
           + AL + P                        K ++RRA + E L +F++A+
Sbjct: 436 SMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDP-NDP---VFYSNISACYISTGDLDKVVEYT 188
           + +++G  +F    +  + + Y+ ++   P N P   + YSNI A  +  G+  K ++ +
Sbjct: 405 EFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNS 464

Query: 189 TKALEIKPDHS 199
           + ALE+ PD +
Sbjct: 465 SSALEMFPDDT 475

>ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166C CDC23 Subunit of the anaphase-promoting
           complex/cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 628

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 33/67 (49%)

Query: 382 TPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQ 441
             +++  M     + +NS    + ++ A+D++      +Y  GQ Y +L  ++ +   FQ
Sbjct: 431 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINARDFKAWYGLGQAYEVLDMHLYSLYYFQ 490

Query: 442 KAQSLNP 448
           KA +L P
Sbjct: 491 KACTLKP 497

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 170 NISACYISTGDLDKVVEYTTKALEIKPDHSKALLR 204
           NI ACY    DL   +  + K+L++ PD++K  +R
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIR 117

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,269,944
Number of extensions: 2551462
Number of successful extensions: 10241
Number of sequences better than 10.0: 322
Number of HSP's gapped: 10236
Number of HSP's successfully gapped: 478
Length of query: 644
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 528
Effective length of database: 40,180,143
Effective search space: 21215115504
Effective search space used: 21215115504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)