Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.3132.153ON1321015416e-72
Skud_8.1772.153ON1301014903e-64
Smik_8.1942.153ON129974877e-64
YHR116W (COX23)2.153ON151964776e-62
Ecym_82052.153ON1141003591e-44
NDAI0B043302.153ON1271003505e-43
SAKL0E10934g2.153ON113933495e-43
TDEL0B051502.153ON1191013411e-41
KLLA0F24024g2.153ON122923374e-41
KLTH0B05148g2.153ON111933364e-41
KNAG0H035202.153ON1091003312e-40
CAGL0I02728g2.153ON111923295e-40
Kwal_33.147762.153ON111933295e-40
ZYRO0G06534g2.153ON112943271e-39
NCAS0B070002.153ON1081023217e-39
ABR130W2.153ON111923095e-37
Kpol_505.202.153ON112933001e-35
KAFR0F007302.153ON108962955e-35
TPHA0F018702.153ON180912712e-30
TBLA0B012402.153ON119871863e-18
ZYRO0F04642gsingletonON54923730.19
Ecym_82875.205ON5827611.6
TBLA0C061305.205ON6727612.4
NDAI0A051503.357ON19923642.8
KLTH0H02552g6.284ON7738603.2
AAL161W5.205ON6426585.5
Suva_10.665.205ON7226585.7
YKL033W (TTI1)2.541ON103824617.3
KAFR0D018505.205ON6327577.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.313
         (132 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   213   6e-72
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   193   3e-64
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   192   7e-64
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   188   6e-62
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   142   1e-44
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   139   5e-43
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   139   5e-43
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   135   1e-41
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   134   4e-41
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   134   4e-41
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   132   2e-40
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   131   5e-40
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   131   5e-40
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   130   1e-39
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   128   7e-39
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   123   5e-37
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   120   1e-35
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   118   5e-35
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   108   2e-30
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    76   3e-18
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    33   0.19 
Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to ...    28   1.6  
TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {O...    28   2.4  
NDAI0A05150 Chr1 complement(1169160..1169759) [600 bp, 199 aa] {...    29   2.8  
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    28   3.2  
AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolo...    27   5.5  
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    27   5.7  
YKL033W Chr11 (375456..378572) [3117 bp, 1038 aa] {ON}  TTI1Subu...    28   7.3  
KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}...    27   7.6  

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  213 bits (541), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 32  QPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKL 91
           QPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKL
Sbjct: 32  QPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKL 91

Query: 92  SFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           SFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE
Sbjct: 92  SFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  193 bits (490), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%)

Query: 32  QPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKL 91
           +PA RGP+TDR+KVNYVP++NDPSSFQYYPDDPENP+NKYKFALK DSQYYDPCEESSKL
Sbjct: 30  EPAPRGPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKL 89

Query: 92  SFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           SFQCLERN YDR+KCQ+YFDAYRECKKQWLTARR NRQQWE
Sbjct: 90  SFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  192 bits (487), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 89/97 (91%), Positives = 95/97 (97%)

Query: 36  RGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQC 95
           +GPVTDR+KVNYVP+S+DPSSFQYYPDDPENPVNKYKFALK DSQYYDPCEESSKLSFQC
Sbjct: 33  KGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQC 92

Query: 96  LERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           LERN YDR+KCQ+YFDAYRECKKQWLTARRNNRQQWE
Sbjct: 93  LERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  188 bits (477), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 88/96 (91%), Positives = 93/96 (96%)

Query: 37  GPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCL 96
           GPVTDR+KVNYVP+S+DPSSFQYYPDDPENPVNKYKFALK DSQYYDPCEESSKLSFQCL
Sbjct: 56  GPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCL 115

Query: 97  ERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           ERN YDR+KCQ+YFDAYRECKKQWLTARR NRQQWE
Sbjct: 116 ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  142 bits (359), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 80/100 (80%)

Query: 33  PARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLS 92
           P +   VTD++KVN+ P SND S+FQ+YPDDPE  +N++KF  KG S YYDPCEESSK+S
Sbjct: 15  PPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMS 74

Query: 93  FQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           F+CLE N+YDR+ C DYFDAYRECKKQWL ARR +  +W+
Sbjct: 75  FKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  139 bits (350), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%)

Query: 33  PARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLS 92
           P +    T +  VN+ P   D S+F+YYPDDPE  +NKYKF +K  S+YYDPC+ESS++S
Sbjct: 27  PRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMS 86

Query: 93  FQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           F+CL+RN++DR KC +YFDAYRECKKQWL ARRNNR QW+
Sbjct: 87  FKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  139 bits (349), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 61/93 (65%), Positives = 80/93 (86%)

Query: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99
           TD+ KVN+ PQ+ND SSF++YPD+PE+ +NK++FA K  S+Y+DPC+ESSK+SF+CLE N
Sbjct: 21  TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMN 80

Query: 100 SYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           +YDR  C++YFDAYRECKKQWL +RR NR QWE
Sbjct: 81  NYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  135 bits (341), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%)

Query: 32  QPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKL 91
           +P   G V D SKV+Y P+  DPS FQYYP++PE+ VN+  FA+KG SQYYDPC+ES+++
Sbjct: 19  EPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQM 78

Query: 92  SFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           S  CL+RN Y++  C++YFDAYRECKKQWL +RR +R QWE
Sbjct: 79  SLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  134 bits (337), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 78/92 (84%)

Query: 41  DRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERNS 100
           +++KVN+ P+  D +++++YPDDPE+ +N+Y+FA+KG S+YYDPC+ESSK+SF+CLE N+
Sbjct: 31  NKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMSFKCLELNN 90

Query: 101 YDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           YDR  C DYFDAYRECKKQWL ARR  R+ WE
Sbjct: 91  YDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  134 bits (336), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (82%)

Query: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99
            D++KV+Y P++ +  SF++YPD+PE+  NKY+FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQFYDPCQESSKMSMKCLELN 78

Query: 100 SYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           +YDR+ CQ+YFDAYRECKKQWL ARR NR QWE
Sbjct: 79  NYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  132 bits (331), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 1/100 (1%)

Query: 33  PARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLS 92
           PA  G V+ +  V++ P   +P  F+Y+PD P++  +KYKF  KGDS++YDPC+ESSK+S
Sbjct: 11  PAVEG-VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMS 69

Query: 93  FQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           F CLE+N YDR+KC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 70  FTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  131 bits (329), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 76/92 (82%)

Query: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99
           TD+ KV+Y P+  D + ++YYPD+PE+ +NKY+FA+K  SQYYDPC+ES+K+SF+CLE N
Sbjct: 19  TDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQESAKMSFKCLELN 78

Query: 100 SYDRTKCQDYFDAYRECKKQWLTARRNNRQQW 131
            YDR +C++YFDAYRECKKQWL ARR +R  W
Sbjct: 79  DYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  131 bits (329), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (79%)

Query: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99
            D+SK++Y PQ     S+++YPD+PE+  NK++FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCLELN 78

Query: 100 SYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
            YDR+ CQ+YFDAYRECKKQWL ARR NR QWE
Sbjct: 79  DYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  130 bits (327), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 58/94 (61%), Positives = 75/94 (79%)

Query: 39  VTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLER 98
           V +  KV+Y PQ + P  FQYYPD PE+ +++Y+FA+K  SQY+DPC+ESS++SF CL+R
Sbjct: 19  VVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMSFNCLDR 78

Query: 99  NSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           N+YDR  C++YFDAYRECKKQWL ARR NR  WE
Sbjct: 79  NNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  128 bits (321), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 56/102 (54%), Positives = 80/102 (78%), Gaps = 1/102 (0%)

Query: 32  QPARRGPVTDRSK-VNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSK 90
           QP  +G  ++R + VN+ P   +P S++Y+PDDP   +NKYKF +KGDS+YYDPC+E S+
Sbjct: 6   QPEEKGNNSNRKQDVNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQECSE 65

Query: 91  LSFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           +S +CLERN +D+++CQ+YFDAYR+CKK W+  RR NR+QWE
Sbjct: 66  MSRKCLERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  123 bits (309), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 74/92 (80%), Gaps = 1/92 (1%)

Query: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99
           TDR+ VN+ P S D SSFQ+YPD+ E+P+ +Y+ A KG SQY DPC+ES+ +S +CLERN
Sbjct: 20  TDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMSMKCLERN 78

Query: 100 SYDRTKCQDYFDAYRECKKQWLTARRNNRQQW 131
           +YDR  C++YFDAYRECKKQWL+ARR +  QW
Sbjct: 79  NYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  120 bits (300), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 75/93 (80%), Gaps = 1/93 (1%)

Query: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99
           TD+SKV++  + +D    ++YPD+PE+ + KY+F  K  SQYYDPC+ES+++SF CL+RN
Sbjct: 21  TDKSKVDFANK-DDKKDLKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMSFNCLDRN 79

Query: 100 SYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           +YD++KC+ YFDAYRECKKQWL ARR +R QWE
Sbjct: 80  NYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  118 bits (295), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 77/96 (80%), Gaps = 2/96 (2%)

Query: 39  VTDRSKVNYVPQ--SNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCL 96
           VTD++KVN+V +    + + F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+CL
Sbjct: 13  VTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCL 72

Query: 97  ERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132
           E N+YDR+ C+DYFDAYRECKKQWL AR+ +R +WE
Sbjct: 73  ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  108 bits (271), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (75%), Gaps = 2/91 (2%)

Query: 39  VTDRSKVNYVP--QSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCL 96
           VT++  V++     + + + F++YPD+PE+   KY+F  K  SQYYDPC+ES+K+SF+CL
Sbjct: 83  VTNKESVDFTKPDITLNENRFKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKCL 142

Query: 97  ERNSYDRTKCQDYFDAYRECKKQWLTARRNN 127
           + N YDR KC+ YFDAYRECKKQWL ARRNN
Sbjct: 143 DMNDYDRDKCRAYFDAYRECKKQWLRARRNN 173

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 76.3 bits (186), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 60/87 (68%), Gaps = 2/87 (2%)

Query: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99
           T+ S V++ P  N  ++FQY+PD P + + ++ FA K  S++YDPC ES+++S +C+  +
Sbjct: 30  TNVSFVHHDPD-NHVTTFQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQMSVRCMTDH 88

Query: 100 SYD-RTKCQDYFDAYRECKKQWLTARR 125
             D +T C ++F AYR+CKK W+ A++
Sbjct: 89  PDDHKTVCAEFFAAYRDCKKAWIDAKK 115

>ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} similar
          to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
          Plasma membrane multidrug transporter member of the
          major facilitator superfamily involved in efflux of
          fluconazole diazaborine benomyl methotrexate and other
          drugs
          Length = 549

 Score = 32.7 bits (73), Expect = 0.19,   Method: Composition-based stats.
 Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 1/23 (4%)

Query: 48 VPQSNDPSSFQYY-PDDPENPVN 69
          VPQ  DP   +Y  PDDPE PVN
Sbjct: 76 VPQQKDPFLVEYTGPDDPERPVN 98

>Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to
           Ashbya gossypii AAL161W
          Length = 58

 Score = 28.1 bits (61), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 94  QCLERNSYDRTKCQDYFDAYRECKKQW 120
           +CL  N  + TKC++  D YR C K +
Sbjct: 28  ECLLFNGLESTKCKELVDKYRSCMKGY 54

>TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {ON}
           Anc_5.205 YLL009C
          Length = 67

 Score = 28.1 bits (61), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 94  QCLERNSYDRTKCQDYFDAYRECKKQW 120
           QC+  N  + TKC ++ + Y+EC K +
Sbjct: 37  QCILFNGQESTKCTEFINKYKECMKGY 63

>NDAI0A05150 Chr1 complement(1169160..1169759) [600 bp, 199 aa] {ON}
           Anc_3.357 YPR067W
          Length = 199

 Score = 29.3 bits (64), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%)

Query: 46  NYVPQSNDPSSFQYYPDDPENPV 68
           N++ QS D + F+Y PDD  N +
Sbjct: 116 NFMEQSTDDAEFKYVPDDSSNII 138

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 19/38 (50%)

Query: 83  DPCEESSKLSFQCLERNSYDRTKCQDYFDAYRECKKQW 120
           DPC+  +     CL +  +D +KC    D+  EC  ++
Sbjct: 3   DPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKF 40

>AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL009C (COX17)
          Length = 64

 Score = 26.9 bits (58), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 95  CLERNSYDRTKCQDYFDAYRECKKQW 120
           CL  N  D  KCQ+    Y++C K +
Sbjct: 35  CLLFNGVDAVKCQELVQKYKDCMKGY 60

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
           YLL009C (REAL)
          Length = 72

 Score = 26.9 bits (58), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 95  CLERNSYDRTKCQDYFDAYRECKKQW 120
           C+  N  D  KC+++ D Y+EC K +
Sbjct: 39  CILFNGQDSDKCKEFIDKYKECMKGY 64

>YKL033W Chr11 (375456..378572) [3117 bp, 1038 aa] {ON}  TTI1Subunit
           of the ASTRA complex, involved in chromatin remodeling;
           telomere length regulator involved in the stability or
           biogenesis of PIKKs such as TORC1; similar to S. pombe
           Tti1p; detected in highly purified mitochondria in
           high-throughput studies
          Length = 1038

 Score = 28.1 bits (61), Expect = 7.3,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 17/24 (70%)

Query: 39  VTDRSKVNYVPQSNDPSSFQYYPD 62
           +TD + V+++   N+PS+FQ Y D
Sbjct: 786 ITDENDVDFLKDDNEPSNFQEYFD 809

>KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}
           Anc_5.205 YLL009C
          Length = 63

 Score = 26.6 bits (57), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 94  QCLERNSYDRTKCQDYFDAYRECKKQW 120
           QCL     D  KC++Y + YR C K +
Sbjct: 33  QCLLFKGADDGKCKEYIEKYRMCMKSF 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,320,498
Number of extensions: 561000
Number of successful extensions: 1264
Number of sequences better than 10.0: 47
Number of HSP's gapped: 1261
Number of HSP's successfully gapped: 47
Length of query: 132
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 35
Effective length of database: 42,358,797
Effective search space: 1482557895
Effective search space used: 1482557895
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)