Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.3085.423ON37837820140.0
YHR112C5.423ON37837819060.0
Skud_8.1735.423ON37837818890.0
Smik_8.1905.423ON42037818760.0
NDAI0B055905.423ON38037516560.0
NCAS0F032905.423ON40437616510.0
KAFR0E038605.423ON37837816250.0
SAKL0G02222g5.423ON37837615450.0
CAGL0I01276g5.423ON38037315420.0
Kpol_1031.235.423ON37937814730.0
TBLA0A036805.423ON38437314570.0
CAGL0K05665gsingletonON37937614290.0
KLLA0E21319g5.423ON38037814080.0
KNAG0C049905.423ON38037713980.0
ZYRO0F09768g5.423ON37337413930.0
ZYRO0F15664gsingletonON37337413710.0
KNAG0F01580singletonON37937513290.0
NDAI0F00140singletonON37837713110.0
TBLA0B03020singletonON37937213100.0
TDEL0G00140singletonON38137912631e-174
Ecym_55235.423ON38137612531e-172
TDEL0G04970singletonON38137912291e-169
AER250C5.423ON37437412141e-166
TPHA0A06070na 1ON37336012021e-165
NDAI0B00595singletonON37837711921e-163
KLTH0E16566g5.423ON38137111371e-155
Kwal_55.222215.423ON38037111331e-154
TPHA0L005707.97ON3914003803e-41
NDAI0H024007.97ON3934003794e-41
Kpol_1044.107.97ON3914003733e-40
KAFR0K007607.97ON3924063733e-40
KLLA0F07909g7.97ON3914003654e-39
CAGL0H06369g7.97ON3914063645e-39
NCAS0F015207.97ON4294013641e-38
SAKL0B09614g7.97ON3923973602e-38
TDEL0H035307.97ON3913963515e-37
Ecym_26297.97ON3923963499e-37
YAL012W (CYS3)7.97ON3944043411e-35
TBLA0E022407.97ON3873963411e-35
Smik_1.557.97ON3944043374e-35
AEL341W7.97ON3933973351e-34
KLTH0D02728g7.97ON3924053322e-34
Suva_1.567.97ON3954053313e-34
Skud_1.497.97ON3944043304e-34
ZYRO0D05742g7.97ON3913963289e-34
KNAG0D047407.97ON3904003209e-33
CAGL0L06094g8.145ON4503922651e-24
Skud_7.888.145ON4654122437e-22
Skud_19.6singletonON4013802392e-21
Smik_7.898.145ON4654122375e-21
YGL184C (STR3)8.145ON4654122366e-21
ZYRO0G19162g8.145ON4552832341e-20
Suva_7.798.145ON4654182322e-20
ACL059C8.145ON4532562252e-19
KLLA0C17028g8.145ON4604152233e-19
SAKL0H24882g8.145ON4594072154e-18
Kwal_47.172218.145ON4634142144e-18
KLTH0E06644g8.145ON4604102136e-18
TDEL0B046608.145ON4643892121e-17
Suva_17.6singletonON4014012101e-17
Ecym_84058.145ON4722612102e-17
Smik_7.375na 1ON4013512082e-17
TDEL0D06630singletonON4023512055e-17
NDAI0D028804.53ON4474572031e-16
NCAS0A058104.53ON4474561905e-15
KAFR0F030704.53ON4454481871e-14
KNAG0I029204.53ON4454531782e-13
ADL031W4.53ON4674521746e-13
TPHA0F004204.53ON4424491738e-13
TBLA0C044004.53ON4453111622e-11
SAKL0H23892g4.53ON4423151622e-11
YFR055W (IRC7)na 1ON3402831593e-11
ZYRO0G22198g4.53ON4454591613e-11
Kpol_1041.444.53ON4444491604e-11
AER164C4.354ON6453371604e-11
KLTH0D17930g4.354ON6522751571e-10
NCAS0A062704.354ON6592841552e-10
Ecym_83654.53ON4443941481e-09
Kpol_1028.804.354ON6892941472e-09
KLTH0G00418gsingletonON5682621462e-09
Smik_12.3834.53ON4444461452e-09
Suva_10.3974.53ON4444461443e-09
TDEL0E05710singletonON5562601444e-09
YLR303W (MET17)4.53ON4444461434e-09
CAGL0D06402g4.53ON4424381426e-09
KLTH0D03652g4.53ON4444441417e-09
Skud_12.3844.53ON4444461417e-09
Kwal_14.791na 2ON5712711418e-09
Ecym_51694.354ON6812441401e-08
YML082W4.354ON6492631382e-08
ZYRO0B08338g4.354ON6402691364e-08
Skud_10.3534.354ON6402621364e-08
Kwal_26.74374.53ON4443061354e-08
TDEL0D006104.354ON6522761364e-08
Skud_12.10na 2ON5712631355e-08
NDAI0D032604.354ON6962701355e-08
YJR130C (STR2)4.354ON6394051355e-08
Smik_10.4234.354ON6392571348e-08
TDEL0E056204.53ON4463151311e-07
Suva_12.2214.354ON6392591321e-07
TPHA0L003304.354ON7172681321e-07
Smik_13.554.354ON6992541311e-07
SAKL0G18172g4.354ON6732531312e-07
KLLA0D04037g4.53ON4444251292e-07
Suva_13.684.354ON6882561293e-07
Skud_13.594.354ON6492631293e-07
YLL058Wna 2ON5752621259e-07
Kwal_47.166444.354ON6523161251e-06
Suva_10.8na 2ON5722701232e-06
CAGL0M00550g4.354ON5692471212e-06
KNAG0M003304.354ON6313001212e-06
KLLA0B04378g4.354ON6882571195e-06
KAFR0B068304.354ON6672611142e-05
Smik_12.3na 2ON5662061123e-05
Kwal_26.7197singletonOFF8767926e-04
KAFR0E043904.370ON1431112830.11
KAFR0E04410na 3ON1436112800.29
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.308
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   780   0.0  
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   738   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   732   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   727   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   642   0.0  
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   640   0.0  
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   630   0.0  
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   599   0.0  
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   598   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   572   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   565   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   555   0.0  
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   546   0.0  
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   543   0.0  
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   541   0.0  
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   532   0.0  
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   516   0.0  
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                509   0.0  
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   509   0.0  
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      491   e-174
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   487   e-172
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   478   e-169
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   472   e-166
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   467   e-165
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              463   e-163
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   442   e-155
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   441   e-154
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   150   3e-41
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   150   4e-41
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   148   3e-40
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   148   3e-40
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   145   4e-39
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   144   5e-39
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   144   1e-38
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   143   2e-38
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   139   5e-37
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   139   9e-37
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   135   1e-35
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   135   1e-35
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   134   4e-35
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   133   1e-34
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   132   2e-34
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   132   3e-34
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   131   4e-34
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   130   9e-34
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   127   9e-33
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...   106   1e-24
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    98   7e-22
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    97   2e-21
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    96   5e-21
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...    96   6e-21
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    95   1e-20
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    94   2e-20
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    91   2e-19
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    91   3e-19
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    87   4e-18
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    87   4e-18
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    87   6e-18
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    86   1e-17
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    86   1e-17
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    86   2e-17
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    85   2e-17
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    84   5e-17
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      83   1e-16
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    78   5e-15
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    77   1e-14
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    73   2e-13
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    72   6e-13
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    71   8e-13
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    67   2e-11
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    67   2e-11
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    66   3e-11
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    67   3e-11
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    66   4e-11
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    66   4e-11
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    65   1e-10
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    64   2e-10
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    62   1e-09
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    61   2e-09
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    61   2e-09
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    60   2e-09
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    60   3e-09
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    60   4e-09
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    60   4e-09
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    59   6e-09
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    59   7e-09
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    59   7e-09
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    59   8e-09
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    59   1e-08
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    58   2e-08
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    57   4e-08
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    57   4e-08
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    57   4e-08
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    57   4e-08
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    57   5e-08
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    57   5e-08
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    57   5e-08
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    56   8e-08
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    55   1e-07
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    55   1e-07
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    55   1e-07
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    55   1e-07
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    55   2e-07
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    54   2e-07
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    54   3e-07
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    54   3e-07
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    53   9e-07
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    53   1e-06
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    52   2e-06
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    51   2e-06
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    51   2e-06
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    50   5e-06
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    49   2e-05
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     48   3e-05
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    40   6e-04
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    37   0.11 
KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {...    35   0.29 

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/378 (100%), Positives = 378/378 (100%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA
Sbjct: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP
Sbjct: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG
Sbjct: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIRDLASALKELQDAA 378
           DDLIRDLASALKELQDAA
Sbjct: 361 DDLIRDLASALKELQDAA 378

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/378 (93%), Positives = 368/378 (97%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MVDLSTALIH DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEK+PVYSRLA
Sbjct: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS+ILDGYAV+YSSGLAAF+AAMVHYNPKKIFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           Y I+QHPLEDIE+ A+EGDIVHLESPVNPYGTS DIES ARRAHAKGALLI+DSTFASPP
Sbjct: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK+EA SR+LKDDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYE+RI KQSENATK+V+FLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAITL TKEQCK  PLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIRDLASALKELQDAA 378
           +DLI+DLASALKELQDAA
Sbjct: 361 NDLIKDLASALKELQDAA 378

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/378 (91%), Positives = 364/378 (96%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MV+LST LIH DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEK+PVYSRLA
Sbjct: 1   MVNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESVFS+ILDGYAV+YSSGLAAF+AAMVHYNPKKIFIGQSYHGVRAI NIL RN
Sbjct: 61  HPNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           YD+KQ+PLEDIE+YA+EGDIVHLESPVNPYGTSYDIES A RAH KGALLI+DSTFASPP
Sbjct: 121 YDVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQYAWNFGAD+VLYSATKYFGGHSDLLSGVLVVKDEAVSR+LKDDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYE+RI KQSENATK+VKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAI L  KEQCK  PLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 301 PVFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIRDLASALKELQDAA 378
           +DLI+DL+SALKELQD A
Sbjct: 361 EDLIKDLSSALKELQDTA 378

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/378 (90%), Positives = 365/378 (96%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MVDLST+LIH DDKDNRVTDVAPPINVSTTFRYDDDDL+PWTERENLDFMEK+P+YSRLA
Sbjct: 43  MVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLA 102

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS+ILDGYAV+YSSGLAAF+AAMVHYNPK+IFIGQSYHGVRAIANIL+RN
Sbjct: 103 HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRN 162

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           YDIKQ+PLEDIE+YA+EGDIVHLE+PVNPYGTS DIES A RAHAKGALLI+DSTFASPP
Sbjct: 163 YDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPP 222

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQY WNFGADIVLYSATKYFGGHSDLLSGVLVVK+E  SR+LKDDRIYLGTNVANLESFM
Sbjct: 223 LQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFM 282

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYE+RI KQSENATK+VKFLSDHQSEF KVLK IYHSSLQ EEFVKKQLVGGYG
Sbjct: 283 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYG 342

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAITL+TKEQCK  PLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 343 PVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 402

Query: 361 DDLIRDLASALKELQDAA 378
           +DLI+DLASALKELQDAA
Sbjct: 403 NDLIKDLASALKELQDAA 420

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/375 (78%), Positives = 344/375 (91%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           M  LSTALIH+DDKDNRV+DVAPPINV+TTFRYD+DDL+PWTERENLDFMEK P+YSRLA
Sbjct: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS+ILDG+AV+YSSGLAAFFAAM+HYNPK+IFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           +  KQH L++IE++A  GDIVHLE+PVNP+GTS D+E FA++AH KGALL++DSTFA PP
Sbjct: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQ  W+F  DI+++SATKYFGGHSDLLSGVLVVK+EAV+R+L+DDRIYLGTNVANLESFM
Sbjct: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT+E+R+ KQSENATKIV FL  ++ ++DKVLK+I HSSLQ E FVKKQL GGYG
Sbjct: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+I+L  KEQCK FP  LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIRVS+GCE+A
Sbjct: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360

Query: 361 DDLIRDLASALKELQ 375
           DDLI+DLA+AL+ LQ
Sbjct: 361 DDLIQDLANALETLQ 375

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/376 (78%), Positives = 342/376 (90%)

Query: 2   VDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAH 61
           + LST LIH DDKDNRV+DVAPPINV+TTFRYD +DLIPW+ERENLDFM+K P+YSRL H
Sbjct: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87

Query: 62  PNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNY 121
           PNSTRLES+FS++L+G+AV+YSSG++AFFAAMVHYNPK++F+GQSYHG RAIANILTRNY
Sbjct: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147

Query: 122 DIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPL 181
           +++QHPLEDIE+YA +GDIVHLE+PVNPYGTS DI  FARRAHAKGALL +DSTFA PPL
Sbjct: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207

Query: 182 QYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFML 241
           Q  W F ADIV++SATKYFGGHSDLLSGVLVVKDE V+R+L+DDRIYLGTNVANLES++L
Sbjct: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267

Query: 242 LRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGP 301
           LRSLRT+++RI +QSENATK+VKFL+D++ +F  VL  IYHSSLQTE FVKKQL GGY P
Sbjct: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327

Query: 302 VFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAD 361
           VF+ITL+ KEQCK FPL LKYFHHATSLGGIESLVEWRAMTDPYIDQTLIR+S+GCE AD
Sbjct: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387

Query: 362 DLIRDLASALKELQDA 377
           DLI DL++AL +LQD 
Sbjct: 388 DLINDLSAALNKLQDT 403

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 345/378 (91%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           M  L T+LIHADDKDNRV+DVAPPINVSTT+RYD+ DLIPW ERENLDFMEK+PVYSRLA
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN+TRLES+FS+IL+G+AV+YSSG AAF+AAMVHYNPKKIF+GQ YHG+RAIANI+TRN
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           Y ++Q+ L+DIE+YA EGDIV +ESP+NPYGTS DI+S A +AH+KGA++++DSTFA PP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQYAW+ GAD+VL+SATKYFGGHSDLLSGV+VVKDE V ++L+DDRIYLGTNV NLES+M
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLR+YELRI KQSENATK+V+FL+ ++  FDKVLK +YHSSLQ E FVKKQLVGGYG
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+++L+T +QCK FP KLKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIRVS+G E+A
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 361 DDLIRDLASALKELQDAA 378
           DDLI+DL +AL+EL + A
Sbjct: 361 DDLIKDLETALQELHNGA 378

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/376 (72%), Positives = 329/376 (87%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MV L T LIHADDKDNRVTD+  PINV+TTFRYD+++LI W +REN DF+E  PVYSRLA
Sbjct: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN+TRLES+FS+IL G+AV+YSSGLAA+FA + HYNPKK+FIGQSYHG   IA+I TRN
Sbjct: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
             +KQ+PL+ IE  A+EGDIVHLE+PVNP+GTSYDIE FAR+AHAKGALL++DSTFA PP
Sbjct: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQ  W FGAD+V++S TKYFGGHSDLLSGV+VVK   V++++K+DRIYLGTN+ANLES++
Sbjct: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT+E+R+ KQSENAT +VK+L DH+SEF+KVL  IYHSSLQTE+FVKKQL GGYG
Sbjct: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+I L++K QCK  P KL+ F HATSLGG+ESLVEWRA+TDPYI+QTLIRVSVGCE  
Sbjct: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360

Query: 361 DDLIRDLASALKELQD 376
           +DLI+DLA ALK+LQD
Sbjct: 361 EDLIKDLAGALKQLQD 376

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/373 (72%), Positives = 330/373 (88%)

Query: 3   DLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHP 62
           DL+T LIH DD  NRV DVAPPINV+TTFRYD++DL+PW ERE+L+FM++ P+YSRL HP
Sbjct: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64

Query: 63  NSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYD 122
           N+TRLES+FS+IL+G+AV+YSSGLAAF AAM H+NPK++FIGQSYHGV  IA+IL+RNY 
Sbjct: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124

Query: 123 IKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQ 182
           + Q  L+DIE YA +GDIVH+E+PVNP+GTSYD++SFA +AH++GALL++DSTFA PPLQ
Sbjct: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184

Query: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLL 242
           YAWNFGADI+++SATK+FGGHSDLLSGVLV KDE VS+RLKDDRIYLGTNVANLES +LL
Sbjct: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244

Query: 243 RSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           RSLRT+E+RI KQS+N TKIV+ L  ++ ++ KVL+ ++HSSLQ E FVKKQL+GGY PV
Sbjct: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304

Query: 303 FAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADD 362
           F+ITL  KEQCK  PLKLKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR S+GCESADD
Sbjct: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADD 364

Query: 363 LIRDLASALKELQ 375
           LI DL +A  EL+
Sbjct: 365 LIADLDAAFIELE 377

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/378 (70%), Positives = 328/378 (86%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MV+LST LIHADDK+NRVTDVAPPINV+TTFRY++ DLIP  ERE++ F+++RPVYSR  
Sbjct: 1   MVELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREG 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN TRLE++FS+ L G+AV+YSSGL+A+FAA++ +NPK+IF+ Q+YHG  AIA +  RN
Sbjct: 61  HPNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
             +K++ L++IE+YA +GDIVHLESPVNP+GTSYDIE+FA+RAHAKGALL++D TFA PP
Sbjct: 121 GMVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQ  W+FGADIV++SATKYFGGHSDLL GVLVVKD+     LK+DRI LGTN+ANLES++
Sbjct: 181 LQNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYL 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT+E+RI KQSEN TKIVK+L +++ ++ KVL+ I HSSLQ E+FVKKQL GGY 
Sbjct: 241 LLRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYN 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+ITL T EQCK F  +LKYF HATSLGG+ESLVEWRA++DP+IDQTL+RVSVGCESA
Sbjct: 301 PVFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESA 360

Query: 361 DDLIRDLASALKELQDAA 378
           DDLI+DLASAL+ LQD A
Sbjct: 361 DDLIKDLASALQNLQDEA 378

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/373 (69%), Positives = 319/373 (85%)

Query: 3   DLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHP 62
           DL T LIH DD +NRVTDVAPPIN++TTFRYD++DLIPW ER +L FME +P+YSRLAHP
Sbjct: 8   DLETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHP 67

Query: 63  NSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYD 122
           NS+RLE++FS ILDG AV+Y+SG++AFFAAM ++NPK++F+GQ+YHG  A  NIL RN  
Sbjct: 68  NSSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGT 127

Query: 123 IKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQ 182
           +K+H  ++IE +A +GDIVHLESPVNPYGTSYDIE F ++AH+KG L+++DSTFA PPLQ
Sbjct: 128 LKKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQ 187

Query: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLL 242
           Y W+F  DIV++SATK+FGGHSDLLSGVLVVKDE +++ L++DRIYLGTN+ANLES++LL
Sbjct: 188 YVWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLL 247

Query: 243 RSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           RSLRT+E+RI KQS +AT+IVKFL+D++ +F+KVLK IYHSSLQ E+FVKKQL GGY PV
Sbjct: 248 RSLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPV 307

Query: 303 FAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADD 362
           F+I L  KEQCK  P  LKYF HATSLGG+ESL+EWRA+TDPYI QTLIRVSVGCE+  D
Sbjct: 308 FSIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQD 367

Query: 363 LIRDLASALKELQ 375
           LI DL  AL  +Q
Sbjct: 368 LINDLDQALTVIQ 380

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/376 (65%), Positives = 320/376 (85%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MV+L+T LIH DDK NRV+DVAPPINVSTT+RY ++DLIPW +REN DFM++ PVYSR  
Sbjct: 1   MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREG 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN TRLE++FSDIL+G+AV+Y+SGLAAFFAAM+HYNPK++F+GQ YHGV  I+++ TRN
Sbjct: 61  HPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           ++++Q  LEDI  +A +GD+VHLESPVNP+GT  D++  A  AH+KGA++I+DSTFA PP
Sbjct: 121 FNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQYAW+ GAD++++SATKYFGGHSDLL G+LV KD+ +SR LK+DRI LG+ + NLES++
Sbjct: 181 LQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYL 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           L+RSLRTYE+RI KQSEN  KIVK+L+D++ ++  VL  IYHSS+Q++ FVK QLVGGY 
Sbjct: 241 LMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYN 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
            VF+  L+++EQCK FP KLKYFHHATSLGGIESL+EWRA++D  IDQ L+RVSVGCESA
Sbjct: 301 SVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESA 360

Query: 361 DDLIRDLASALKELQD 376
            DLI DL+ AL+EL++
Sbjct: 361 KDLIDDLSQALQELEN 376

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/378 (65%), Positives = 321/378 (84%), Gaps = 2/378 (0%)

Query: 2   VDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAH 61
           + LST L+HADDK NRVTD+  PINV+TTFRY++ DLIPW ERE+   +EK+P+YSRLAH
Sbjct: 1   MSLSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAH 60

Query: 62  PNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNY 121
           PNS R+ESV S +L+G AVVY++GLAA+FA + +YNPK++FIG+ YHG R+IA+I TRN+
Sbjct: 61  PNSLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNW 120

Query: 122 DIKQHPLE--DIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASP 179
           +++QH LE  +I ++A +GD+VH+E+PVNPYGTS+DI++FA   H+KGA+L++DSTFA P
Sbjct: 121 NLEQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ  W+FG D++L+SATKYFGGHSDLL+GVL VKD+ V+ +L+ DRIYLGTN+ANLE+F
Sbjct: 181 PLQNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAF 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRT+E+RI  QSENATK+V +L +H+S+F+ VL+ ++HSSLQTE FVK+QL GGY
Sbjct: 241 LLLRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGY 300

Query: 300 GPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           GPVFA+TL +KEQC+ FP  L  F HATSLGG+ESLVEWRA+TDPYI  TLIRVSVG E+
Sbjct: 301 GPVFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVEN 360

Query: 360 ADDLIRDLASALKELQDA 377
            DDLI+D A+ALK LQ A
Sbjct: 361 VDDLIKDFANALKTLQGA 378

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/377 (67%), Positives = 314/377 (83%), Gaps = 2/377 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           M  L+T LIHADD+DNRV DVAPPINVSTT+RYD DDL+PW +RE+L+FM+KRP+YSRLA
Sbjct: 1   MEHLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS IL G+AVVY+SGLAAFFAA++HYNPK++FI QSYHG RAIA+ILTR 
Sbjct: 61  HPNSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRT 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGT-SYDIESFARRAHAKGALLILDSTFASP 179
             ++Q  L+D+ + A  GD+VHLESPVNP GT   D+   A +AH +GA+LI+DSTFA P
Sbjct: 121 TGMQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ  W FG D+V++SATKYFGGHSDLLSGVLV +D+  +  L+DDRIYLGTNVANLE++
Sbjct: 181 PLQDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAY 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGG 298
           +LLRSLRT+ELRI +QS N T +V +L+DH+ ++  VL  +YHSSLQT E +V +QL GG
Sbjct: 241 LLLRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGG 300

Query: 299 YGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCE 358
           + PVFA+TLR+ +QCK FP  L YF HATSLGG+ESLVEWRAMTDP+IDQTL+RVSVGCE
Sbjct: 301 HPPVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCE 360

Query: 359 SADDLIRDLASALKELQ 375
           +A+DLI DL +AL  LQ
Sbjct: 361 NAEDLIADLTTALNALQ 377

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/374 (64%), Positives = 313/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MVDL T L+H DD+ NRVTDVAPPINV++TFRYD+D+LIPW ++ NLDF+++ PVYSR  
Sbjct: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN  RLE++FS  L G+A+ YS GL  F   MVH+NPK++F+ Q YHGV+ I  IL RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           Y ++++ L DIE++A +GDIVH+E+P+NP+GTS DI   ARRAH+KGALL++DSTFA PP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQ AW+FGAD++++SATKYF GHSDLLSGVLVVKD+ V+ +LK+DRIYLG+N+ANLES++
Sbjct: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTY+LRI +Q+ENATK+VK+L+DH+ ++  +++ +YHSSLQTEEFVKKQL GGY 
Sbjct: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVE-LYHSSLQTEEFVKKQLSGGYT 299

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF++T +T+EQCK F   LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 DDLIRDLASALKEL 374
           DDLI DL++ L +L
Sbjct: 360 DDLINDLSTVLSQL 373

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/374 (63%), Positives = 312/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MVDL+T L+H DD+ NRVTDVAPPINV++TFRYD+D+L+PW +  NLD +++ PVYSR  
Sbjct: 1   MVDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREG 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN  RLE++FS  L G+AV YS GL  F +AMVH+NPK++F+ Q YHGV+ I  I+ RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           Y ++++ L DIE++A +GDIVH+E+P+NP+GTS DI   ARRAHAKGALL++DSTFA PP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQ AW+FGAD++++SATKYFGGHSDLLSGVLVVKD+  + +LK+DRI LG+N++NL+S++
Sbjct: 181 LQNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYL 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTY+LRI +QSE+ATKIV++L+DH+++F   L  +YHSSLQ+++FVKKQL GGYG
Sbjct: 241 LLRSLRTYDLRIKRQSESATKIVQYLNDHKNDF-PALDKLYHSSLQSDDFVKKQLSGGYG 299

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF++TL+T+EQCK F   LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 300 PVFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 DDLIRDLASALKEL 374
           +DL  DL + L +L
Sbjct: 360 EDLTNDLTTVLSQL 373

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/375 (64%), Positives = 305/375 (81%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           M   +T+ IHADD++NRV DVAPPINVS T+RYD+D+L    E+E L+ M+  PVYSR A
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN TRLESV S IL+G+AVVY+SG +AF+AA+VHYNPK++FI +SY G+ AIA+I+TRN
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           Y ++QH  ++IE+YA  GDIVHLESP+NPYG S DI++ A RAHAKGALL++DST A PP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQ  W+FG DI+++SATKYFGGHSDLL+G+LV KD+ VS +LK DRIYLGT   NLESF+
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT E+R+ KQSENATKIV++L D++  FDKVL  IYHSSLQ E FV  Q+ GGY 
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           P+F+  L+T +Q K FP KLK F HATSLGGIESL+EWR +++P +DQTL+R+SVGCE+ 
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 361 DDLIRDLASALKELQ 375
           DDLI DL +AL++ Q
Sbjct: 361 DDLIADLQNALQQAQ 375

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/377 (62%), Positives = 309/377 (81%), Gaps = 1/377 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTE-RENLDFMEKRPVYSRL 59
           M  LSTALIH DDK NRVTDVAPPINVSTTFR+D+++LIP  E ++ L  +++ PVY+R 
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARE 60

Query: 60  AHPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           +HPNS+R+++V SD+L G+AV+Y+SG +AF A M HYNPK+ F+   Y GV AIA+++TR
Sbjct: 61  SHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASP 179
           NY ++QH L++IE +A  GDIVHLE+P+NP+GTS DIE+ A+R H KGA+L +D+T A P
Sbjct: 121 NYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ AW FGADI+L+SATKYFGGHSDLL+GVLVVK +  +  L +DRI+LGTN+ NLES+
Sbjct: 181 PLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRTYE+RI KQ  N  K++ +L++++S+F+KVL  IYHSSLQ ++FV+KQL G Y
Sbjct: 241 LLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLY 300

Query: 300 GPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
            PVFAITL + +QCK  PL LKYF HATSLGG+ESL+EWRAM+D  IDQ LIRVS+GCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

Query: 360 ADDLIRDLASALKELQD 376
           ADDLI+DL +AL+ LQ+
Sbjct: 361 ADDLIKDLENALQILQN 377

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  509 bits (1310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/372 (63%), Positives = 301/372 (80%), Gaps = 1/372 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTEREN-LDFMEKRPVYSRL 59
           MV L+T LIH+DDK+NRVTDVAPPINVS+TFRYD+++LIP  E ++ L  +E+ PVYSR 
Sbjct: 1   MVHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRE 60

Query: 60  AHPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           +HPNS+R++S+ SD+L G+AV+Y+SG +AF A M HYNPK+ F+   Y GV AIA+++TR
Sbjct: 61  SHPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASP 179
           NY ++QH L++IE +A  GD+VHLESP+NP+GT+ DI++ A R H+KGA+L +DST A P
Sbjct: 121 NYGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ  WNFGADIVL+SATKYFGGHSDLL+GVL VK +  +  L +DRI+LGTN+ NLES+
Sbjct: 181 PLQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRTYE+RI KQS+NATKIVK+L +H+      LK I+H+SLQ E F+ KQL GG+
Sbjct: 241 LLLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGH 300

Query: 300 GPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           G VF+I L +  QCK  PL LKYF HATSLGGIESL+EWRAM+D  IDQ LIRVSVGCE+
Sbjct: 301 GAVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCEN 360

Query: 360 ADDLIRDLASAL 371
            +DLI+DL +AL
Sbjct: 361 VEDLIKDLENAL 372

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  491 bits (1263), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 229/379 (60%), Positives = 298/379 (78%), Gaps = 1/379 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTEREN-LDFMEKRPVYSRL 59
           M  LSTA IHADD  NRVTDVAPPINVSTTFRYD+++L+P  E EN ++ +E+ PVYSR 
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  AHPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           +HPNS RL++V SDIL G+A VY+SG++AF A + HYNPK+ F+   Y GVR IA +   
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 NYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASP 179
            + ++ + L  IE +A +GD++HLE P+NPYGT  DI + A+R H KGA+L +DST A P
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ AW+FGAD+V++SATKY GGHSDLL+GV+VVK     R+L  +RI+LGTNV NLESF
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRT+E+R+ KQSENA KIV FL ++++++ KVL  +YHSSLQ E FV++QL GG+
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 300 GPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           G VF++TLR+ EQCK  P KL YF HATSLGG+ESL+EWRA++D  ID  L+R+S+GCE+
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 360 ADDLIRDLASALKELQDAA 378
           ADDLI+DL +AL+ LQ AA
Sbjct: 361 ADDLIQDLDNALQVLQGAA 379

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  487 bits (1253), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 232/376 (61%), Positives = 291/376 (77%), Gaps = 1/376 (0%)

Query: 1   MVDLSTALIHADDK-DNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRL 59
           M  LST LIHADD   + VTDVAPPINVSTTFRYD+D+L+      +    E  PVYSR 
Sbjct: 1   MAGLSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSRE 60

Query: 60  AHPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
            HPNS R  S+ S  L+GYAV Y+SGL+AF AA+ HYNPK++FIGQSYHG   +A+I  R
Sbjct: 61  GHPNSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVR 120

Query: 120 NYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASP 179
           NY + +  L++IE  A  GD+VH+ESP+NPYGT+ DIE +  + H KGA++++DSTFA P
Sbjct: 121 NYGLLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ AW FG DI+++S TKY GGHSDLL GVLVVKD+AV R+L  DRIYLGTN+ANL+S+
Sbjct: 181 PLQNAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSY 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +L+RSLRT ELR+ KQS+ ATK+V +L  H SEF  VL  I H+SLQ EEFVKKQL GG+
Sbjct: 241 LLIRSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGH 300

Query: 300 GPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
            PVF+I L+T +QC+  P KLK+FHHATS GG+ESL+EWRA++DP I++TL+RVSVGCE 
Sbjct: 301 TPVFSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCED 360

Query: 360 ADDLIRDLASALKELQ 375
            +DLI DLA+AL+ LQ
Sbjct: 361 HNDLINDLANALRYLQ 376

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  478 bits (1229), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 290/379 (76%), Gaps = 1/379 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTEREN-LDFMEKRPVYSRL 59
           M  LST  IHADD  NRV+DVAPPINV+TTFR+D+D+LIP  E EN ++ +E+ PVY+R 
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  AHPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
            HPNS R++S+ S IL G+A VY+SG +AF A M   NPK++F+  +Y GV  IA+++  
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 NYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASP 179
            Y +K   L+ IE +A +GD+VHLE+P+NP+G   +I + A R H KGALL +DST A P
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ AW+FGADIV++SATKY GGHSDLL+GVLVVKD    R L  +RIYLGTN+ NLESF
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRT+E+R+ KQSENA K+V FL ++ +++ KVL  +YHSSLQ EEFV+KQL GG+
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 300 GPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           G VF++ L++ EQ K  P KL YF HATSLGG+ESL+EWRAM+D  ID  L+R+SVGCE+
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 360 ADDLIRDLASALKELQDAA 378
            DDLI+DL   L+ LQ+AA
Sbjct: 361 VDDLIQDLDQGLQALQNAA 379

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  472 bits (1214), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 215/374 (57%), Positives = 283/374 (75%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60
           MV+L T+LIHADD  NRV DVAPPINV+TTFRY +DDLIP  ER           YSR++
Sbjct: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60

Query: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN  R E + ++ L G AVVYSSGLAAF AA+ H+NPK++FIG+ YHG   +A+I  RN
Sbjct: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120

Query: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180
           + +++  LE++   +  GD+VH+ESP+NPYGT  D+   A  AH KGA ++LD+TFA PP
Sbjct: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
           LQ  W  GAD+V++S TKYFGGHSDLL GV  V+D AV+R+L+ DR+YLGTN+ANLE+++
Sbjct: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           L+RS+RT E+R+ +QS +ATK+V +L  H++EF  VL  ++HSSLQTE +V++ L GG  
Sbjct: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300

Query: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+I LRT EQCK  P  LK FHHATSLGG+ESL+EWRAM+D  ++Q L+R+SVGCES 
Sbjct: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360

Query: 361 DDLIRDLASALKEL 374
           +DLI DLA A ++L
Sbjct: 361 EDLIADLAGAFRQL 374

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  467 bits (1202), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 215/360 (59%), Positives = 289/360 (80%), Gaps = 1/360 (0%)

Query: 17  RVTDVAPPINVSTTFRYDDDDLIPWTE-RENLDFMEKRPVYSRLAHPNSTRLESVFSDIL 75
           +++D+APPINVSTT+RYD+ +LIP  E ++ L  +E+ PVYSR +H NS+R++ V S +L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 76  DGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYDIKQHPLEDIERYA 135
           +G+AV+Y+SG +AF A M HYNPK+IF  +SY G++AIAN++TRNY +KQ+ L+DI+++A
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 136 AEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYS 195
            EGDI+H+E+P+NP+GT+ +I+  A +AHAK ALL +DST A PPLQ A++FGADIVL+S
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 196 ATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQ 255
           ATKY GGHSDLL+GVLVVK E  +R L +DRI+LGTN+ NLESF+LLRSLRTYE+R++ Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 256 SENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLRTKEQCKV 315
           S+N  KIV FL  ++ ++  V++ IYHSSLQ E FV +QL  G+  VFA+  +++EQCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 316 FPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLIRDLASALKELQ 375
           F   LKYF HATSLGG+ESLVEWRAM+DP ID  LIR S+GCE+A+DLI DL SAL  L+
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRLE 367

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  463 bits (1192), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 298/377 (79%), Gaps = 1/377 (0%)

Query: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTE-RENLDFMEKRPVYSRL 59
           MV LST LIH DDK NRVT VAPPINVSTTFR+D ++LIP  E ++ L  +++ PVY++ 
Sbjct: 1   MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKE 60

Query: 60  AHPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           ++PNS+R+++V SD+L G+AV+Y+SG + F A M HYNPK+ F+   Y GV AIA++LTR
Sbjct: 61  SYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTR 120

Query: 120 NYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASP 179
           NY ++Q  L++IE +A  GDIVHLE+P+NP+GTS D+E+   R H KGA+L +D+T ASP
Sbjct: 121 NYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESF 239
           PLQ AW FGADI+L+SATKY GGHSDLL+GVLVVK +  +  L +DRI+LGTN+ NLES+
Sbjct: 181 PLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLR L TYE+RI KQ +N  K++ +L++++S+F+KV+  IYHSS Q ++F++KQL G Y
Sbjct: 241 LLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLY 300

Query: 300 GPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
            PVFAITL + +QCK  PL LKYF HATSLG  ESL+EWRA++D  IDQ LI VS+GCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCEN 360

Query: 360 ADDLIRDLASALKELQD 376
           ADDLI+DL +AL+ LQ+
Sbjct: 361 ADDLIKDLENALQILQN 377

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  442 bits (1137), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/371 (55%), Positives = 278/371 (74%)

Query: 5   STALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNS 64
           STA IH DD+ NRV+DVAPPINVSTTFRYDD+ L P T        +   +YSRL HPN+
Sbjct: 5   STATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNA 64

Query: 65  TRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYDIK 124
            RLE V ++ILDG  VVY+SGLAA+ A ++H NPK++F    YHG  A+A I++R   ++
Sbjct: 65  DRLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGME 124

Query: 125 QHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYA 184
             PLE++E     GD+VHLE P NPYG   +++ FA + H  GAL+++DST A PPL+  
Sbjct: 125 ILPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPPLRNT 184

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRS 244
           W FGADIV++S TKYFGGHSDLLSG++ V+DE V+++L++DR YLGT  A+LES++LLRS
Sbjct: 185 WEFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRS 244

Query: 245 LRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304
           LRT E+R+ KQS N T++V++L+ H+  ++ V+K I H+SLQ EEFVKKQL GGYGPVF+
Sbjct: 245 LRTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYGPVFS 304

Query: 305 ITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLI 364
           + L ++EQCK+       F HATSLGG ESL+EWRAM+DP+ ++ LIRVSVG E+A+DLI
Sbjct: 305 LLLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAEDLI 364

Query: 365 RDLASALKELQ 375
            DLA  L++++
Sbjct: 365 EDLAGTLEKIE 375

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  441 bits (1133), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 283/371 (76%)

Query: 5   STALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNS 64
           +T  IH+DD  NRV+DVAPPINVSTTFRYD++ L+P T    +   +   +YSRL HPN+
Sbjct: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64

Query: 65  TRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYDIK 124
            RLE+V S +LD +AVVY+SGLAA+ A +VH+ PK++F+   YHG + +A I++R   ++
Sbjct: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124

Query: 125 QHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYA 184
              LEDIE    EGD+VH+E P+NP+G + D+  +A R H+ G L++LDST   PPL+ A
Sbjct: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRS 244
           W++GADI+++S TKYFGGHSDLLSG++ V DEA++ +LK+DR YLGT  A+LESF+LLRS
Sbjct: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRS 244

Query: 245 LRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304
           LRT ++R+ +QS+N T++V +L+++  +F  V++ I H+SLQTE FVK+Q+ GG+GPVFA
Sbjct: 245 LRTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304

Query: 305 ITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLI 364
           + L++++QC+     + +F HATSLGG+ESL+EWRAM+DP   +TLIRVSVG E+ +DLI
Sbjct: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364

Query: 365 RDLASALKELQ 375
            DLA +L+++ 
Sbjct: 365 ADLAGSLEKIN 375

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  150 bits (380), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 134/400 (33%), Positives = 193/400 (48%), Gaps = 50/400 (12%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA    +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAEPIGEYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLA--AFFAAMVHYNPKKIFIGQSYHGVR----AIANI 116
              LE   + + +G Y + +SSG A  A     +  N   I IG  Y G       +AN 
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVANT 117

Query: 117 LTRNYDIKQHPLEDIERYAAEGD-IVHLESPVNPYGTSYDIESFAR--RAHAKGALLILD 173
              + D     + D+ +   E   +V +ESP NP     DIE  A+  ++  K  LL++D
Sbjct: 118 HGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLVVD 177

Query: 174 STFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNV 233
           +TF SP L    NFGADIV++SATKY  GHSD++ GVL      +  RL+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGAIP 237

Query: 234 ANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEF--V 291
           +  ++++  R L+T  LR+ + + NATKI +FL    ++ D V+   Y       ++  V
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQAALNATKIAEFL----AQSDNVVAVNYPGLPTNPDYAIV 293

Query: 292 KKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-MTD 343
           KKQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E  A MT 
Sbjct: 294 KKQHRDALGGGM-----ISFRVKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH 348

Query: 344 PYIDQT----------LIRVSVGCESADDLIRDLASALKE 373
             I +           L+R+SVG E  DDL+ D+ +AL++
Sbjct: 349 GGIPKEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQK 388

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  150 bits (379), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 132/400 (33%), Positives = 194/400 (48%), Gaps = 52/400 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPV----YSRL 59
            +T  IHA    +    V  PI++STTF+                    +P+    YSR 
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFKQS---------------APAQPIGTYEYSRS 53

Query: 60  AHPNSTRLESVFSDILDG-YAVVYSSGLA--AFFAAMVHYNPKKIFIGQSYHGVR----A 112
            +PN   LE+  + + +G Y + +SSG A  A     +  N   I IG  Y G       
Sbjct: 54  QNPNRENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFTK 113

Query: 113 IANILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFAR--RAHAKGAL 169
           +AN            ++D+     E   +V +ESP NP     DIE+ ++  ++  K  L
Sbjct: 114 VANAHGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLNKDIL 173

Query: 170 LILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYL 229
           L++D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   ++ +  RL+  +  +
Sbjct: 174 LVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQNAV 233

Query: 230 GTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE 289
           G   +  +S++  R L+T  LR+ + S  ATKI +FLS + +     +K + +  L T E
Sbjct: 234 GAIPSPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPN-----VKAVNYPGLPTHE 288

Query: 290 ---FVKKQ---LVGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRA-MT 342
               VKKQ    +GG    F I   ++   K F    + F  A SLGGIESL+E  A MT
Sbjct: 289 NYDIVKKQHREALGGGMISFRINGGSEAAAK-FSSSTRLFTLAESLGGIESLLEVPAVMT 347

Query: 343 DPYIDQT----------LIRVSVGCESADDLIRDLASALK 372
              I +           LIR+SVG E A DL+ D+  AL+
Sbjct: 348 HGGIPKESREASGVYDDLIRLSVGIEDAGDLLDDIKQALE 387

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  148 bits (373), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 132/400 (33%), Positives = 199/400 (49%), Gaps = 52/400 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA    +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +G Y + +SSG +A  + ++   P+    + IG  Y G       +AN
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSG-SATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEGD-IVHLESPVNPYGTSYDIESFAR--RAHAKGALLIL 172
                     + +E++ +   E   +V +ESP NP     DI   ++  ++  K  +L++
Sbjct: 117 THGVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   D+ +  RL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEF-- 290
            +  +S+++ R L+T  LR+ + + NATKI +FL+ +++    V+   Y     +E F  
Sbjct: 237 PSPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASNEN----VIAVNYPGLPSSENFEV 292

Query: 291 VKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-MT 342
           VKKQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E  A MT
Sbjct: 293 VKKQHRDALGGGM-----ISFRIKGGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMT 347

Query: 343 DPYIDQT----------LIRVSVGCESADDLIRDLASALK 372
              I +           LIR+SVG E +DDL+ D+  AL+
Sbjct: 348 HGGIPKEQREASGVFDDLIRLSVGIEDSDDLLDDIKQALQ 387

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  148 bits (373), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 130/406 (32%), Positives = 198/406 (48%), Gaps = 62/406 (15%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPV----YSRL 59
            +T  IHA    +    V  PI++STTFR                    +P+    YSR 
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFRQS---------------APAQPIGTYEYSRS 53

Query: 60  AHPNSTRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR---- 111
            +PN   LE   + + +G Y + +SSG +A  A ++   P+    I IG  Y G      
Sbjct: 54  QNPNRENLEVAIASLENGKYGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFT 112

Query: 112 AIANILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFARRAHA--KGA 168
            +AN            L D+ +   E   +V +ESP NP     DIE+ +++  +  K  
Sbjct: 113 KVANAHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDI 172

Query: 169 LLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIY 228
           LL++D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   ++ +  RL+  +  
Sbjct: 173 LLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  ++++  R LRT  LR+ + S +A KI +FL ++++     ++ + +  L T 
Sbjct: 233 IGAIPSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNEN-----VEAVNYPGLPTH 287

Query: 289 ---EFVKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEW 338
              + VKKQ    L GG      I+ R K   E    F    + F  A SLGG+ESL+E 
Sbjct: 288 KDYDVVKKQHREALGGGM-----ISFRIKGGAEAAAKFSSSTRLFALAESLGGVESLLEV 342

Query: 339 RA-MTDPYIDQ----------TLIRVSVGCESADDLIRDLASALKE 373
            A MT   I +           L+R+SVG E  DDL+ D+  AL++
Sbjct: 343 PAVMTHGGIPKEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALEK 388

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  145 bits (365), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 130/400 (32%), Positives = 195/400 (48%), Gaps = 54/400 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA    +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGTHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +G Y + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFARRAHA--KGALLIL 172
                     + + ++     E   +V +E+P NP     DIE  A+ A +  K  LL++
Sbjct: 117 AHGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKSINKDILLVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   D+ +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE--- 289
            +  +S+++ R ++T  LR+ + S +A KI +FLS +++     +  + +  L T E   
Sbjct: 237 PSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNEN-----VIAVNYPGLPTHESYA 291

Query: 290 FVKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-M 341
            VKKQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E  A M
Sbjct: 292 VVKKQHRDALGGGM-----ISFRIKGGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVM 346

Query: 342 TDPYIDQT----------LIRVSVGCESADDLIRDLASAL 371
           T   I +           L+R+S+G E  DDL+ D+  AL
Sbjct: 347 THGGIPKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQAL 386

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  144 bits (364), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 128/406 (31%), Positives = 196/406 (48%), Gaps = 62/406 (15%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPV----YSRL 59
            +T  IHA   ++    V  PI++STTF+  +                 +P+    YSR 
Sbjct: 9   FATKAIHAGAHEDIHGSVIEPISLSTTFKQSE---------------PAKPIGTYEYSRS 53

Query: 60  AHPNSTRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR---- 111
            +PN   LE+  + +  G Y + +SSG +A  A ++   P+    + IG  Y G      
Sbjct: 54  QNPNRENLEAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFT 112

Query: 112 AIANILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFARRAHA--KGA 168
            +AN    +     + +ED+ +   +   +V +ESP NP     DI+  A       K  
Sbjct: 113 KVANAHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDI 172

Query: 169 LLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIY 228
           LL++D+TF SP L     FGADIV++SATKY  GHSD++ GVL    + +  RL+  +  
Sbjct: 173 LLVVDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  ++++  R L+T  LR+ + S NATKI  FL     E ++ +  + +  LQ+ 
Sbjct: 233 IGCIPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFL-----ESNENVVAVNYPGLQSH 287

Query: 289 ---EFVKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEW 338
              + VKKQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E 
Sbjct: 288 PNYDVVKKQHREALGGGM-----ISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEV 342

Query: 339 RA-MTDPYIDQT----------LIRVSVGCESADDLIRDLASALKE 373
            A MT   I +           L+R+SVG E  +DL+ D+  AL++
Sbjct: 343 PAVMTHGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  144 bits (364), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 130/401 (32%), Positives = 196/401 (48%), Gaps = 54/401 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPV----YSRL 59
            +T  IHA    +    V  PI++STTF+                     PV    YSR 
Sbjct: 46  FATKAIHAGTHTDVHGSVIEPISLSTTFKQSS---------------PANPVGIYEYSRS 90

Query: 60  AHPNSTRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR---- 111
            +PN   LE+  + + +G Y + +SSG +A  A ++   P+    I IG  Y G      
Sbjct: 91  QNPNRENLENAIAALENGKYGLAFSSG-SATTATVLQSLPQGSHAISIGDVYGGTHRYFT 149

Query: 112 AIANILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFAR--RAHAKGA 168
            +AN            L+++     E   +V +ESP NP     DI++ A   ++  K  
Sbjct: 150 KVANAHGVETTFTNDLLKELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDI 209

Query: 169 LLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIY 228
           +L++D+TF SP L    +FGADIV++SATKY  GHSD++ GVL   D+A+  +L+  +  
Sbjct: 210 ILVVDNTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNA 269

Query: 229 LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  +S++  R L+T  LR+ + S NATKI +FL     +   ++K + +  L T 
Sbjct: 270 IGAIPSPFDSWLAHRGLKTLHLRVRQASLNATKIAQFL-----QSSPLVKAVNYPGLPTH 324

Query: 289 E---FVKKQ---LVGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRA-M 341
           E    V+KQ    +GG    F I   ++   K F    + F  A SLGGIESL+E  A M
Sbjct: 325 ENYAVVQKQHREALGGGMISFRIQGGSEAASK-FSSSTRLFTLAESLGGIESLLEVPAVM 383

Query: 342 TDPYIDQT----------LIRVSVGCESADDLIRDLASALK 372
           T   I +           L+R+SVG E  DDL+ D+  AL+
Sbjct: 384 THGGIPKEAREASGVYDDLVRLSVGIEDGDDLLDDIKQALE 424

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  143 bits (360), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 136/397 (34%), Positives = 195/397 (49%), Gaps = 46/397 (11%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA    +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHTDVHGSVIEPISLSTTFK-QTAPAQPVGEYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RKNLEDAVAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEGD-IVHLESPVNPYGTSYDIESFAR--RAHAKGALLIL 172
                     + +ED+ +   E   +V +ESP NP     DIE  ++  ++  K  LL++
Sbjct: 117 AHGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKSINKDILLVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   D+ +  RL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT---EE 289
            +  ++++  R L+T  LR+ + +  ATKI +FLS  QSE D V   + +  L T     
Sbjct: 237 PSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLS--QSE-DVV--AVNYPGLPTHPNHN 291

Query: 290 FVKKQLVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-MTDPY 345
            V KQ   G G    I+ R K   E    F    + F  A SLGGIESL+E  A MT   
Sbjct: 292 VVLKQHRDGLGGGM-ISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 I--DQT--------LIRVSVGCESADDLIRDLASALK 372
           I  DQ         LIR+S+G E  DDL+ D+  AL+
Sbjct: 351 IPKDQREASGVFDDLIRLSIGIEDTDDLLDDIKQALE 387

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  139 bits (351), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 189/396 (47%), Gaps = 46/396 (11%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA    +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDIHGSVIEPISLSTTFK-QSSPAAPLGEYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RKNLEEALAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFARRAHA--KGALLIL 172
               +       ++D+     E   +V +ESP NP     DI    + A    K  L+++
Sbjct: 117 AHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEILVVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN 232
           D+TF SP L    NFG DIV++SATKY  GHSD++ GVL   D+A+  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE---E 289
            +  +S++  R L+T  LR+ + +  ATKI +FL     E D  +  + +  L +    E
Sbjct: 237 PSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFL-----EQDSNVLAVNYPGLASNPDRE 291

Query: 290 FVKKQLVGGYGPVFAITLRTKEQCKV---FPLKLKYFHHATSLGGIESLVEWRA-MTDPY 345
            V++Q   G G    I+ R K   +    F    + F  A SLGGIESL+E  A MT   
Sbjct: 292 IVQRQHRDGLGGGM-ISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IDQT----------LIRVSVGCESADDLIRDLASAL 371
           I +           LIR+SVG E +DDL+ D+  AL
Sbjct: 351 IPKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEAL 386

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  139 bits (349), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 196/396 (49%), Gaps = 44/396 (11%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
           +ST ++HA +  +    V  PI++STTF+      +P    E          YSR  +PN
Sbjct: 9   ISTKVVHAGEHVDIHGSVIEPISLSTTFK-QASPAVPVGAYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  + + +SSG +A  A ++   P+    I IG  Y G     N +  
Sbjct: 58  RKNLEDAIAVLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFNNVAN 116

Query: 120 NYDIK----QHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFAR--RAHAKGALLIL 172
            + ++     + +ED+     E   +V +ESP NP     DI+  ++  ++  K  +L++
Sbjct: 117 AHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIILVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL    + +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIGAV 236

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYH--SSLQTEEF 290
            +  ++++  R L+T  LR+   S +A +I +FL     + DKV+   Y   SS    + 
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFL----VKSDKVISVNYPGLSSHPNNDI 292

Query: 291 VKKQLVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-MTDPYI 346
           VKKQ   G G    I+ R K   +    F    + F  A SLGGIESL+E  A MT   I
Sbjct: 293 VKKQHRDGLGGGM-ISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 --DQT--------LIRVSVGCESADDLIRDLASALK 372
             DQ         LIR+SVG E   DL++D+  AL 
Sbjct: 352 PKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQALN 387

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  135 bits (341), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 128/404 (31%), Positives = 195/404 (48%), Gaps = 55/404 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFAR--RAHAKG--ALL 170
                       L D+ +   E   +V +E+P NP     DI+  A   + HA G   +L
Sbjct: 117 AHGVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 ILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLG 230
           ++D+TF SP +    NFGADIV++SATKY  GHSD++ GVL   ++ +  RL+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE-- 288
              +  ++++  R L+T  LR+ + + +A KI +FL+   ++ + V+   Y   L+T   
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLA---ADKENVVAVNY-PGLKTHPN 292

Query: 289 -EFVKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA 340
            + V KQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E  A
Sbjct: 293 YDVVLKQHRDALGGGM-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPA 347

Query: 341 -MTDPYIDQT----------LIRVSVGCESADDLIRDLASALKE 373
            MT   I +           L+R+SVG E  DDL+ D+  ALK+
Sbjct: 348 VMTHGGIPKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQ 391

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  135 bits (341), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 125/396 (31%), Positives = 188/396 (47%), Gaps = 46/396 (11%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA    +    V  PI++STTF+            + +   E    YSR  +PN
Sbjct: 9   FATKAIHAGAHIDVHGSVIEPISLSTTFKQS-------APSQPIGIYE----YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +G Y + +SSG +A  A ++   P+    I IG  Y G       +AN
Sbjct: 58  RKNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEGD-IVHLESPVNPYGTSYDIESFARRAHA--KGALLIL 172
                     + +E++         +V +ESP NP     DI+          K  L+++
Sbjct: 117 AHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVKKLNKDILVVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL    + +  RL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT---EE 289
            +  ++++  R L+T  LR+ + S +A KI +FL+      D  +  + +  L++    +
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQ-----DPNVIAVNYPGLESHPNRD 291

Query: 290 FVKKQLVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-MTDPY 345
            VKKQ   G G    I+ R K   E    F  K + F  A SLGGIESL+E  A MT   
Sbjct: 292 IVKKQHRDGLGGGM-ISFRIKGGAEGASKFTQKTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IDQT----------LIRVSVGCESADDLIRDLASAL 371
           I +           L+R+SVG E  DDL+ D+  AL
Sbjct: 351 IPKEAREATGVYDDLVRLSVGIEDVDDLLADVKQAL 386

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  134 bits (337), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 128/404 (31%), Positives = 194/404 (48%), Gaps = 55/404 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHIDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLEKAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFAR--RAHAKG--ALL 170
                       L D+ +       +V +E+P NP     DI+  A   + HA G   +L
Sbjct: 117 AHGVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 ILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLG 230
           ++D+TF SP +    NFGADIV++SATKY  GHSD++ GVL   ++ +  RL+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE-- 288
              +  ++++  R L+T  LR+ + + +A KI +FL+   S+ + V+   Y   L+T   
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLA---SDKENVVAVNY-PGLKTHPN 292

Query: 289 -EFVKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA 340
            + V KQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E  A
Sbjct: 293 YDVVLKQHRDALGGGM-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPA 347

Query: 341 -MTDPYIDQT----------LIRVSVGCESADDLIRDLASALKE 373
            MT   I +           L+R+SVG E  DDL+ D+  ALK+
Sbjct: 348 VMTHGGIPKEAREASGVYDDLVRISVGIEDTDDLLEDVKQALKQ 391

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  133 bits (335), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 124/397 (31%), Positives = 183/397 (46%), Gaps = 48/397 (12%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPV----YSRL 59
            +T  IHA    +    V  PI++STTF+                     PV    YSR 
Sbjct: 9   FATKAIHAGAHTDLHGSVIEPISLSTTFKQSS---------------PGNPVGAYEYSRG 53

Query: 60  AHPNSTRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR---- 111
            +PN   LE   + +    Y + +SSG +A  A +V   P+    I IG  Y G      
Sbjct: 54  QNPNRQNLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFT 112

Query: 112 AIANILTRNYDIKQHPLEDIERYAAEGD-IVHLESPVNPYGTSYDIESFARRAHA--KGA 168
            +AN            LED+ +   +   +V +ESP NP     DI+  A    A  +  
Sbjct: 113 KVANAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDI 172

Query: 169 LLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIY 228
           +L++D+TF SP L    NFGADIV++SATKY  GHSD++ G L     ++  RL   +  
Sbjct: 173 ILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  ++++  R L+T  LR+ + +++A KI ++L   QSE    +      S +  
Sbjct: 233 IGAIPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYL--EQSEHVVSVNYPGLPSHRGY 290

Query: 289 EFVKKQLVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-MTDP 344
           +  +KQ   G G    I+ R K   +   +     + F  A SLGGIESL+E  A MT  
Sbjct: 291 QIAQKQHRDGLGGGM-ISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHA 349

Query: 345 YIDQT----------LIRVSVGCESADDLIRDLASAL 371
            I +           L+RVSVG E  DDL+ D+  AL
Sbjct: 350 GIPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQAL 386

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  132 bits (332), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 128/405 (31%), Positives = 185/405 (45%), Gaps = 60/405 (14%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPV----YSRL 59
            +T  IHA    +    V  PI++STTF+                    +P+    YSR 
Sbjct: 9   FATLAIHAGAHTDVHGSVIEPISLSTTFKQS---------------APAQPIGAYEYSRS 53

Query: 60  AHPNSTRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVRAIAN 115
            +PN   LE+  + +    + + +SSG +A  A ++   P     I IG  Y G      
Sbjct: 54  QNPNRANLEAAVAALERAQFGLAFSSG-SATTAVVLQSLPTDSHAISIGDVYGGTHRYFT 112

Query: 116 ILTRNYDIKQHPLEDIER-----YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGA-- 168
            +   + ++     D+ER           +V LESP NP     DI   A  AHA     
Sbjct: 113 QVAHAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDI 172

Query: 169 LLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIY 228
           L+++D+TF SP +      GADIV++SATKY  GHSD++ GVL   +E +  RL+  +  
Sbjct: 173 LVVVDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYH--SSLQ 286
           +G   +  +S++  R L+T  LR+   +++A +I KFL       D+V    Y   SS  
Sbjct: 233 IGAVPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFL----EASDRVEHVNYPGLSSHP 288

Query: 287 TEEFVKKQ----LVGGYGPVFAITLRTKEQCKV---FPLKLKYFHHATSLGGIESLVEWR 339
               V+KQ    L GG      I+ R K        F    + F  A SLGGIESLVE  
Sbjct: 289 AYAVVQKQHRDALGGGM-----ISFRIKGGAGAAARFTSTTRLFTLAESLGGIESLVEVP 343

Query: 340 A-MTDPYIDQ----------TLIRVSVGCESADDLIRDLASALKE 373
           A MT   I +           LIR+SVG E  DDL+ D+  AL++
Sbjct: 344 AVMTHGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  132 bits (331), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 193/405 (47%), Gaps = 56/405 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFA-----RRAHAKGAL 169
                       L+D+ +   +   +V +E+P NP     DI+  A       A ++  +
Sbjct: 117 AHGVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDVI 176

Query: 170 LILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYL 229
           L++D+TF SP +    NFGADIV++SATKY  GHSD++ GVL    + +  RL+  +  +
Sbjct: 177 LVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAI 236

Query: 230 GTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE- 288
           G   +  ++++  R L+T  LR+ + + +A KI +FL+  +      +  + +  L+T  
Sbjct: 237 GAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKEN----IVAVNYPGLKTHP 292

Query: 289 --EFVKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWR 339
             + V KQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E  
Sbjct: 293 NYDVVVKQHRDALGGGM-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVP 347

Query: 340 A-MTDPYIDQT----------LIRVSVGCESADDLIRDLASALKE 373
           A MT   I +           L+R+SVG E ADDL+ D+  ALK+
Sbjct: 348 AVMTHGGIPKEAREASGVFDDLVRISVGIEDADDLLDDIKQALKQ 392

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  131 bits (330), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 125/404 (30%), Positives = 192/404 (47%), Gaps = 55/404 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGAHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFAR--RAHAKG--ALL 170
                       L D+ +   +   +V +E+P NP     DI+  A   + HA G   +L
Sbjct: 117 AHGVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 ILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLG 230
           ++D+TF SP +    +FGADIV++SATKY  GHSD++ GVL    + +  RL+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE-- 288
              +  ++++  R L+T  LR+ + + +A KI +FL+  +      +  + +  L+T   
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKEN----IVAVNYPGLKTHPN 292

Query: 289 -EFVKKQ----LVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA 340
            + V KQ    L GG      I+ R K   E    F    + F  A SLGGIESL+E  A
Sbjct: 293 YDVVLKQHRDALGGGM-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPA 347

Query: 341 -MTDPYIDQT----------LIRVSVGCESADDLIRDLASALKE 373
            MT   I +           LIR+SVG E  DDL+ D+  ALK+
Sbjct: 348 VMTHGGIPKEAREASGVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  130 bits (328), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 188/396 (47%), Gaps = 44/396 (11%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
            +T  IHA    +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFK-QSAPAQPLGEYE----------YSRSQNPN 57

Query: 64  STRLESVFSDILDG-YAVVYSSGLAAFFAAMVHYNPK---KIFIGQSYHGVR----AIAN 115
              LE   + + +G + + +SSG +A  A ++   P+    I IG  Y G       +AN
Sbjct: 58  RKNLEDAIASLENGKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFARRAHA--KGALLIL 172
               +       ++D+         ++ +ESP NP     DI    +      K  L+++
Sbjct: 117 AHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN 232
           D+TF SP L    +FG D+V++SATKY  GHSD++ GVL      +  RL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYH--SSLQTEEF 290
            +  ++++  R L+T  LR+ + +  ATKI +FL  +    D+V+   Y   +S  + + 
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSN----DRVIAVNYPGLASHPSHDV 292

Query: 291 VKKQLVGGYGPVFAITLRTK---EQCKVFPLKLKYFHHATSLGGIESLVEWRA-MTDPYI 346
           V++Q   G G    I+ R K   E    F    + F  A SLGGIESL+E  A MT   I
Sbjct: 293 VQRQHRDGLGGGM-ISFRIKGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 --DQT--------LIRVSVGCESADDLIRDLASALK 372
             DQ         LIR+SVG E  +DL+ D+  ALK
Sbjct: 352 PEDQREASGVYDDLIRLSVGIEDTEDLLEDIKQALK 387

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  127 bits (320), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 121/400 (30%), Positives = 184/400 (46%), Gaps = 52/400 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPV----YSRL 59
            +T  +HA +  +    V  PI++STTF+                     P+    YSR 
Sbjct: 7   FATLAVHAGEHTDVHGSVIEPISLSTTFKQSS---------------PANPIGVYEYSRS 51

Query: 60  AHPNSTRLESVFSDILDG-YAVVYSSGLAAFFAAM--VHYNPKKIFIGQSYHGVR----A 112
            +PN   LE+  + +    Y + +SSG AA    M  +      + IG  Y G       
Sbjct: 52  QNPNRDNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTK 111

Query: 113 IANILTRNYDIKQHPLEDIERYAAEGD-IVHLESPVNPYGTSYDIE--SFARRAHAKGAL 169
           +AN          + LE++     +   +V +ESP NP     DI+  S A +   K  L
Sbjct: 112 VANTHGVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDIL 171

Query: 170 LILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYL 229
           L++D+TF SP L     FGADIV++SATKY  GHSD++ GVL    + +  RL+  +  +
Sbjct: 172 LVVDNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAI 231

Query: 230 GTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT-- 287
           G   +  ++++  R L+T  LR+ + S  A KI +FLS       K ++ + +  L+T  
Sbjct: 232 GAIPSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSA-----SKHVEAVNYPGLKTHP 286

Query: 288 -EEFVKKQ---LVGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRA-MT 342
               V++Q    +GG    F +          F    + F  A SLGGIESL+E  A MT
Sbjct: 287 NHAVVQRQHRDALGGGMISFRVK-GGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMT 345

Query: 343 DPYIDQ----------TLIRVSVGCESADDLIRDLASALK 372
              I +           LIR+SVG E  +DL+ D+  AL+
Sbjct: 346 HGGIPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQALE 385

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 107/392 (27%), Positives = 173/392 (44%), Gaps = 55/392 (14%)

Query: 24  PINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNSTRLES----VFSDILDGYA 79
           P+ +STTF+ D        E EN  +      YSR  +P  T L+     ++ DI   + 
Sbjct: 11  PLYLSTTFKVD-------LENENNQY-----DYSRSGNPTRTLLQQQVAKLYDDIDPNFV 58

Query: 80  VVYSSGLAAFFAAMVHYNPKK-----IFIGQS-YHGVRAIANILTRNYDIKQHPLEDIER 133
              SSG+ A    +  + P +     I  G   Y G + + N+L  + D     L   E 
Sbjct: 59  FAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHTEN 118

Query: 134 YAAE-----------GDIVHLESPVNPYGTSYDIESFAR--RAHAKGALLILDSTFASPP 180
           + A+            DI+ LESP NP     DI    +  R ++   L+++D+T  S  
Sbjct: 119 FKAKFYDLVTIKKTIVDIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMSGL 178

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
                 FGAD+V  SATKY  GH D+++GV++ K++ ++ ++       G+ +  ++S++
Sbjct: 179 NCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLNPMDSWL 238

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSD----HQSEFDKVLKTIYHSSLQTEEFVKKQLV 296
           L+R L+T  +R++KQ  NA  I  +L +         +  LKT Y   L++    +    
Sbjct: 239 LIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKTRY-IGLKSHPDYELHRS 297

Query: 297 GGYGPVFAITLRTKE---QCKVFPLK-LKYFHHATSLGGIESLVEW-----RAMTDPYI- 346
              GP   I+L+T       K+   K LK ++   S G + SL+        A  DP + 
Sbjct: 298 FNKGPGAVISLQTGSIPISKKIVASKLLKLWNVTVSFGCVNSLISMPCLMSHASIDPELR 357

Query: 347 -----DQTLIRVSVGCESADDLIRDLASALKE 373
                 + LIR+  G E    L  DL  A  E
Sbjct: 358 KERQFPEDLIRLCCGIEDVKALQEDLLGAFVE 389

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 98.2 bits (243), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 102/412 (24%), Positives = 180/412 (43%), Gaps = 57/412 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D ++       +N D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQNFD-------YSRSGNPT 54

Query: 64  STRLESVFSD---ILDGYAVVYSSGLAAF---------FAAMVHYNPKKIFIGQSYHGVR 111
            + L++       +     +  SSG+ A               ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANILT-RNYDIKQH-PLEDIERYAA------EGDIVHLESPVNPYGTSYDIESFAR-- 161
            + N    + + +  H    D E++        + D V LESP NP     DI    R  
Sbjct: 115 RLLNFFKHQTHAVTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFV 174

Query: 162 RAHAKGALLILDSTFASP----PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEA 217
           +  +   ++I+D+T  S     PLQ   N   D+V  SATKY  GH DL+ GV++ K   
Sbjct: 175 KRISPETIVIVDNTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 VSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD----HQSEF 273
           ++ +L       G  ++ ++S++L+R L+T  +R+++Q  NA  +  +L +      +E 
Sbjct: 233 IASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCGFKPTET 292

Query: 274 DKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLRTKEQCK--VFPLKLKYFHHATSLG 330
           +K  KT +       +F + +    G G V +    + E  K  V   KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSFG 352

Query: 331 GIESLVEW-----RAMTDPYI------DQTLIRVSVGCESADDLIRDLASAL 371
            + SL+        A  DP +       + L+R+  G E+  DL +DL +A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 105/380 (27%), Positives = 158/380 (41%), Gaps = 45/380 (11%)

Query: 21  VAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNSTRLESVFSDILDGYAV 80
           V PP+   +T  +   D        +++ M+ R  Y     P    LE  ++ +  G   
Sbjct: 30  VNPPLYKGSTIIHKKLD--------DVEHMKGRFFYGTAGSPTIANLEDAWTHLTGGAGT 81

Query: 81  VYS-SGLAAFFAAMVH--------------YNPKKIFIGQSYHGVRAIANILTRNYDIKQ 125
           V S SGL +   A++               Y P ++       G+ A   I T  YD   
Sbjct: 82  VLSPSGLGSISLALLTLAKAGDHILITDSVYVPTRMLC----DGLLAKFGIETEYYDPSV 137

Query: 126 HPLEDIERY-AAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYA 184
              EDI++       ++ LESP +      DI +    A   G   ILD+T+A+P    A
Sbjct: 138 G--EDIKKLIKPNTTVIFLESPGSGTMEIQDIPALVSVAKKHGIKTILDNTWATPLFFDA 195

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRS 244
              G DI L + TKY GGHSDLL G L   +E     L+     +       +  + LR 
Sbjct: 196 HGHGIDISLEAGTKYLGGHSDLLIG-LTSANEECWPLLRSTYDAMAMLPGADDCLLALRG 254

Query: 245 LRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304
           +RT  LR+ +    A  +  +L D + E +KVL   +      E +V+     G   +F+
Sbjct: 255 MRTLHLRLKEAERKALDLAAWLED-RDEVEKVLHPAFKDCPGHEYWVRD--YKGSSGLFS 311

Query: 305 ITLR---TKEQCKVFPLKLKYFHHATSLGGIESLV-------EWRAMTDPYIDQTLIRVS 354
           I L+   T+   +    K+K FH   S GG ESL+       + +A   P+    L R+ 
Sbjct: 312 IVLKDGYTRTGLENMVEKMKVFHLGFSWGGYESLITPVNPARQRKAANWPHRGFAL-RIQ 370

Query: 355 VGCESADDLIRDLASALKEL 374
           VG E   DL RDL    + L
Sbjct: 371 VGLEELTDLKRDLELGFERL 390

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 95.9 bits (237), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 103/412 (25%), Positives = 180/412 (43%), Gaps = 57/412 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D    +     ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVD----LSNETAQDYD-------YSRSGNPT 54

Query: 64  STRLESVFSDIL---DGYAVVYSSGLAAF---------FAAMVHYNPKKIFIGQSYHGVR 111
            + L++    +        +  SSG+ A          F    ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIL-TRNYDIKQH-PLEDIERYAA------EGDIVHLESPVNPYGTSYDIESFAR-- 161
            + N    +++ +  H    D E++        + D V LESP NP     DI    R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 RAHAKGALLILDSTFASP----PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEA 217
           +  +    +++D+T  S     PLQ   + G D+V  SATKY  GH DL+ GV++ K   
Sbjct: 175 KCISPETTVVVDNTMMSGLNCNPLQL--DPGCDVVYESATKYLNGHHDLMGGVIISKTAE 232

Query: 218 VSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD----HQSEF 273
           ++ +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  +  +L D      +E 
Sbjct: 233 IAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTET 292

Query: 274 DKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLRTKEQCK--VFPLKLKYFHHATSLG 330
           +K  KT +       +F + +    G G V +    + E  K  V   KL  +    S G
Sbjct: 293 NKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 331 GIESLVEW-----RAMTDPYI------DQTLIRVSVGCESADDLIRDLASAL 371
            + SL+        A  DP +       + LIR+  G E+  DL +DL +A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDLLAAM 404

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 95.5 bits (236), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 102/412 (24%), Positives = 179/412 (43%), Gaps = 57/412 (13%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D ++     + +N D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EDAQNYD-------YSRSGNPT 54

Query: 64  STRLESVFSD---ILDGYAVVYSSGLAAF---------FAAMVHYNPKKIFIGQSYHGVR 111
            + L+        +     +  SSG+ A               ++ P  I     Y G +
Sbjct: 55  RSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIL-TRNYDIKQH-PLEDIERYAA------EGDIVHLESPVNPYGTSYDIESFAR-- 161
            + N    +++ +  H    D E++        + D V LESP NP     DI    R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 RAHAKGALLILDSTFASP----PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEA 217
           +  +    +++D+T  S     PLQ   N G D+V  SATKY  GH DL+ GV++ K   
Sbjct: 175 KCISPDTTVVVDNTMMSGLNCNPLQL--NPGCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 VSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD----HQSEF 273
           ++ +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  +  +L +      +  
Sbjct: 233 IASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRT 292

Query: 274 DKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLRTKEQCK--VFPLKLKYFHHATSLG 330
           +K  KT +       +F + K    G G V +    + E  K  V   KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 331 GIESLVEW-----RAMTDPYI------DQTLIRVSVGCESADDLIRDLASAL 371
            + SL+        A  DP +       + L+R+  G E+  DL +DL +A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 137/283 (48%), Gaps = 36/283 (12%)

Query: 115 NILTRNYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIE---SFARRAHAKGALLI 171
           N+ T N+D  Q     +++     D VH+ESP NP     D+    SF +    +   +I
Sbjct: 124 NVDTSNFDKFQEAFLSVDKV----DCVHIESPTNPMCKVVDVPRIISFVKSVSPQ-TYVI 178

Query: 172 LDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYL-- 229
           +D+T  S  L    + GAD V  SATK+  GH D+++GV+V +++ ++     D IY   
Sbjct: 179 VDNTMMSGLLCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVV 233

Query: 230 ---GTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD----HQSEFDKVLKTIYH 282
              G  +A ++S++L+R L+T  +R+ +Q  NA  + ++L       QS+ + +L+T Y 
Sbjct: 234 NATGCGLAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYV 293

Query: 283 SSLQTEEF-VKKQLVGGYGPVFAI-TLRTKEQCKVFPLK-LKYFHHATSLGGIESLVEW- 338
                 +F + +    G G V +  T  T    ++   K LK +    S G + SL+   
Sbjct: 294 GLQSHPQFSLHRSFNDGPGAVLSFETGSTPLSRRIVSSKALKIWSVTVSFGCVNSLISLP 353

Query: 339 ----RAMTDPYI------DQTLIRVSVGCESADDLIRDLASAL 371
                A  DP +       + LIR+ VG E   DL +DL +A+
Sbjct: 354 CSMSHASIDPNVRKEREFPEDLIRLCVGIEDIVDLQKDLLAAM 396

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 104/418 (24%), Positives = 180/418 (43%), Gaps = 65/418 (15%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D ++       ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQDYD-------YSRSGNPT 54

Query: 64  STRLESVFSD---ILDGYAVVYSSGLAAF---FAAMVHYN------PKKIFIGQSYHGVR 111
            + L++       +     +  SSG+ A       +V  N      P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIL------------TRNYDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESF 159
            + N              T N+D  +   + +++     D V LESP NP     DI   
Sbjct: 115 RLLNFFKHQTHAVTVHVDTSNFDRFKTVFQSLDKV----DCVLLESPTNPLCKVVDIPKI 170

Query: 160 AR--RAHAKGALLILDSTFASP----PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVV 213
            R  +  +    +I+D+T  S     PLQ   N   D+V  SATKY  GH DL+ GV++ 
Sbjct: 171 LRYVKCVSPDTKVIVDNTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIIS 228

Query: 214 KDEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD----H 269
           K   ++ +L       G  ++ ++S++L+R L+T  +R+++Q  NA  +  +L D     
Sbjct: 229 KTAEIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSCGFK 288

Query: 270 QSEFDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLRTKEQCK--VFPLKLKYFHHA 326
            +  +K  KT +       +F + +    G G V +    + E  K  V   KL  +   
Sbjct: 289 PTATNKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVT 348

Query: 327 TSLGGIESLVEW-----RAMTDPYI------DQTLIRVSVGCESADDLIRDLASALKE 373
            S G + SL+        A  DP +       + L+R+  G E+  DL +DL +A+ E
Sbjct: 349 VSFGCVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDLLAAMVE 406

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/256 (28%), Positives = 125/256 (48%), Gaps = 30/256 (11%)

Query: 143 LESPVNPYGTSYDIESFAR--RAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           LESP NP     D+ +     +AHA G  +++D+T  S         GAD V  SATKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 GGHSDLLSGVLVVKDEAVSRRLKDDRIY----LGTNVANLESFMLLRSLRTYELRINKQS 256
            GH D+++GV+V    A +R L ++  +    +G  +A +++++L+R L+T  LR+ KQ 
Sbjct: 208 NGHHDIMAGVIV----AATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQ 263

Query: 257 ENATKIVKFLSD----HQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLRTKEQ 312
            NA  +  +L +         +  L+T +   L++    K       GP   ++++T + 
Sbjct: 264 HNAMVLAHWLREVCGFRAVGGNHALQTRF-VGLRSHPQHKLHRSFNRGPGAVLSIQTGDT 322

Query: 313 CK----VFPLKLKYFHHATSLGGIESLVEW-----RAMTDPYIDQT------LIRVSVGC 357
                 V   KL+++    S G + SL+        A  DP + +       LIR+S G 
Sbjct: 323 ALSERIVCSKKLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGV 382

Query: 358 ESADDLIRDLASALKE 373
           E  +DL +DL +AL++
Sbjct: 383 EDVEDLQQDLLAALED 398

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 107/415 (25%), Positives = 173/415 (41%), Gaps = 64/415 (15%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
           L+T+L+     D   + V PP+  STTF+    D     + +  D       Y+R  +P 
Sbjct: 6   LNTSLVSVSHNDKYGSSV-PPLYQSTTFKASSFD-----QLQEYD-------YTRSGNPT 52

Query: 64  STRLESVFSDILD---GYAVVYSSGLAAFFAAM------VHYNPKKIFIGQSYHGVRAIA 114
            T L+   +++ D         SSG+ A    +        + P  I     Y G + + 
Sbjct: 53  RTVLQQQIANLYDVAPEQVFAVSSGMTALDIILRTLIDNSDHIPTIIAGDDLYGGTQRLL 112

Query: 115 NIL-TRNYDIKQHP-LEDIERYA------AEGDIVHLESPVNPYGTSYDIESFARRAHAK 166
             L TRN+    H    D E +        + DIV LESP NP     D+    +    K
Sbjct: 113 TFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPRLCQFVKQK 172

Query: 167 G-----ALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRR 221
           G       +++D+T  S        FGAD+V  S TKY  GH D+++GV++ K +     
Sbjct: 173 GGSSSNCKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHHDIMAGVIIAKKDVAP-- 230

Query: 222 LKDDRIYL-----GTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD----HQSE 272
                +Y      G  ++ ++S++L+R L+T  +R+ KQ  NA  +  +L D      ++
Sbjct: 231 ----SVYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQDICGFKPTD 286

Query: 273 FDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLR--TKEQCKVFPLKLKYFHHATSL 329
            ++ LKT +       +F + K    G G V +I        +  V   +L  +    S 
Sbjct: 287 NNQQLKTRFVGLESHPQFELHKSFNNGPGAVLSIETGDLALSEAIVTSKRLNIWAVTVSF 346

Query: 330 GGIESLVEW-----RAMTDPYIDQT------LIRVSVGCESADDLIRDLASALKE 373
           G + SL+        A  DP + +       LIR+  G E   DL  DL +A +E
Sbjct: 347 GCVNSLISMPCKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYDLLAAFEE 401

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 98/407 (24%), Positives = 178/407 (43%), Gaps = 50/407 (12%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPN 63
           L T L+      ++     PP+  STTF+    +          D  ++   Y+R  +P 
Sbjct: 6   LHTKLVSVTHHKDQHGSSVPPLYQSTTFKQSSLE----------DDADQEYDYTRSGNPT 55

Query: 64  STRLESVFSDILD--GYAV-VYSSGLAAF---FAAMV----HYNPKKIFIGQSYHGVRAI 113
            + L+   + + +  G+ V   SSG+        A+V    ++ P  I     Y G + +
Sbjct: 56  RSVLQEQIAKLYNVPGFQVFAVSSGMTCLDVILRALVLGNSNHTPTIIAGDDLYGGTQRL 115

Query: 114 ANILTRNYDIKQHPLE--DIERY--AAEG----DIVHLESPVNPYGTSYDIES---FARR 162
              L R    +   ++  D +++  A  G    D V LESP NP     D+     F ++
Sbjct: 116 LTFLERKNHARVIHVDTTDFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIKQ 175

Query: 163 AHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRL 222
           A+ K   +++D+T  S        F  D+V  S TKY  GH D+++GV++ + + +++ L
Sbjct: 176 ANPK-CHVVVDNTMVSGLNCNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQEL 234

Query: 223 KDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD----HQSEFDKVLK 278
                  G  ++ ++ ++L+R L+T  +R+ +Q  NA  + ++L        +  +K+L+
Sbjct: 235 YFVINSTGCGLSPMDCWLLIRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSENKLLR 294

Query: 279 TIYHSSLQTEEF-VKKQLVGGYGPVFAITLRTKEQCK--VFPLKLKYFHHATSLGGIESL 335
           T Y       +F + +    G G V +    + E  K  V   KLK +    S G + SL
Sbjct: 295 TRYVGLKSHPQFELHRSFNKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNSL 354

Query: 336 VEW-----RAMTDPYI------DQTLIRVSVGCESADDLIRDLASAL 371
           +        A  DP +       + L+R+  G E   DL +DL +A+
Sbjct: 355 ISMPCKMSHASIDPELRKERDFPEDLVRLCCGIEDVKDLQKDLLAAM 401

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 109/414 (26%), Positives = 176/414 (42%), Gaps = 66/414 (15%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFR---YDDDDLIPWTERENLDFMEKRPVYSRLA 60
           L + + H+D   + V    PPI  STTF+    +DD   P+              Y+R  
Sbjct: 12  LVSVVQHSDQHGSSV----PPIYQSTTFKIGSLEDDASQPYD-------------YTRSG 54

Query: 61  HPNSTRLESVFSDI--LDGYAVV-YSSGLAAF---FAAMV----HYNPKKIFIGQSYHGV 110
           +P  T ++     +  +D   V+  SSG+ A      A+V     Y P  I     Y G 
Sbjct: 55  NPTRTVVQHQIGKLYGVDASQVLAVSSGMTALDVILRALVLTNNSYVPTIIAGDDLYGGT 114

Query: 111 RAIANIL-TRNYDIKQHPLEDIERYAA---------EGDIVHLESPVNPYGTSYD---IE 157
           + +   L +RN+    H   D   Y A           D V LESP NP     D   I 
Sbjct: 115 QRLLTYLESRNHARVLHV--DTTNYDAFTALFNAQPRVDCVLLESPTNPLLKVADLPRIT 172

Query: 158 SFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEA 217
            F ++++ K  ++ +D+T  S  L    +F  D+V  SATKY  GH D+++G++V +   
Sbjct: 173 RFVKQSNEK-CVVAIDNTMMSGMLCNPLHFHCDVVYESATKYLNGHHDIMAGIVVARSAQ 231

Query: 218 VSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSD------HQS 271
           ++  +       G  ++  +S++L+R L+T  +RI +Q  NA  +  +L +      H  
Sbjct: 232 LAGEIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQHNAMVLAHWLENSCGFVSHGK 291

Query: 272 EFDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLRTKEQCK--VFPLKLKYFHHATS 328
           +    L+T +       EF + K    G G V +    + E  +  V   K+K +    S
Sbjct: 292 KGKGSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFETGSFEHSRRLVSSKKIKLWAVTVS 351

Query: 329 LGGIESLVEW-----RAMTDPYIDQT------LIRVSVGCESADDLIRDLASAL 371
            G + SL+        A  DP + Q       L+R+  G E+  DL  DL  A+
Sbjct: 352 FGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENIVDLQNDLLEAM 405

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 99/410 (24%), Positives = 171/410 (41%), Gaps = 59/410 (14%)

Query: 4   LSTALIHADDKDNRVTDVAPPINVSTTFR---YDDDDLIPWTERENLDFMEKRPVYSRLA 60
           L + + H D   + V    PPI  STTF+    +DD   P+              Y+R  
Sbjct: 10  LVSVVQHVDQHGSSV----PPIYQSTTFKIGSLEDDASQPYD-------------YTRSG 52

Query: 61  HPNSTRLESVFSDILD---GYAVVYSSGLAAF---FAAMVHYNPKK---IFIGQSYHG-- 109
           +P  T ++     + D      +  SSG+ A      A+V  N  +   I  G   +G  
Sbjct: 53  NPTRTVVQHQIGKLYDVDAAQVLAVSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGT 112

Query: 110 VRAIANILTRNYDIKQH-------PLEDIERYAAEGDIVHLESPVNPYGTSYDIESFAR- 161
            R + ++ +RN+    H          ++ +     D V LESP NP     D+      
Sbjct: 113 QRLLTHLESRNHARVLHVDTANYETFVEVFKQQEHVDCVLLESPTNPLLKVADLPRLTHF 172

Query: 162 -RAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSR 220
            ++  +  L+ +D+T  S  L     F  D+V  SATKY  GH D+++G++V +   +++
Sbjct: 173 IKSANEACLVAIDNTMMSGMLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQ 232

Query: 221 RLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDK----- 275
            +       G+ ++  +S++L+R L+T  +R+ +Q  NA  +  +L +      K     
Sbjct: 233 EIYFVINSTGSGLSPFDSWLLVRGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGKKGVKG 292

Query: 276 VLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLRTKEQCK--VFPLKLKYFHHATSLGGI 332
             +T +       +F + K    G G V +    + E  +  V   K+K +    S G +
Sbjct: 293 SPRTRFVGLKSHPQFELHKSFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGCV 352

Query: 333 ESLVEW-----RAMTDPYIDQT------LIRVSVGCESADDLIRDLASAL 371
            SL+        A  DP + Q       L+R+  G E+  DL  DL  A+
Sbjct: 353 NSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENISDLQNDLLEAM 402

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 96/389 (24%), Positives = 172/389 (44%), Gaps = 55/389 (14%)

Query: 24  PINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNSTRLESVFSDILD---GYAV 80
           P+ +STTF+ D D+     E +  D       YSR  +P  + L+     + +    + +
Sbjct: 29  PLYLSTTFKVDLDN----PESQVFD-------YSRSGNPTRSLLQYQIGKLYEVPVEHVL 77

Query: 81  VYSSGLAAF--------FAAMVHYNPKKIFIGQSYHGV--RAIANILTRNYDIKQH-PLE 129
             +SG+ A          ++  H     I  G   +G   R +A + ++++    H    
Sbjct: 78  AVASGMTALDVILRGLVISSATHV--PTIIAGDDLYGGSNRLLAYLESKSHARAVHVDTT 135

Query: 130 DIERYAA------EGDIVHLESPVNPYGTSYDIE---SFARRAHAKGALLILDSTFASPP 180
           D+E++ A      + D V LESP NP     D+    ++ +R  +   ++I+D+T  S  
Sbjct: 136 DMEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRI-SPSTVVIVDNTMMSGL 194

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240
                 +G D+V  SATKY  GH D++ G++V K   +++ +       G+ ++ ++S++
Sbjct: 195 QCNPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMDSWL 254

Query: 241 LLRSLRTYELRINKQSENATKIVKFLSD----HQSEFDKVLKTIYHSSLQTEEF-VKKQL 295
           L R L+T  +R+ +Q  N+  I ++L +      +E +  LKT Y        F + +  
Sbjct: 255 LNRGLKTLGVRMYQQQYNSMVIAQWLEESCGFKPTEKNSALKTRYVGLKTNPGFELHRSF 314

Query: 296 VGGYGPVFAITLRTKEQCK--VFPLKLKYFHHATSLGGIESLVEW-----RAMTDPYIDQ 348
             G G V +    + E  +  V     + F    S G + SL+        A  DP + +
Sbjct: 315 NKGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASIDPEVRK 374

Query: 349 T------LIRVSVGCESADDLIRDLASAL 371
                  LIR+ VG E   DL +DL  A+
Sbjct: 375 QREFPEDLIRLCVGIEDVGDLQKDLLYAM 403

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 105/401 (26%), Positives = 162/401 (40%), Gaps = 50/401 (12%)

Query: 3   DLSTAL-IHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAH 61
           D++T L +   + D +   V PP+   +T  +         +  +++ M+ R  Y     
Sbjct: 11  DITTQLTVIGRNPDEQNGFVNPPLYKGSTIIHK--------KLSDVESMKGRFFYGTAGS 62

Query: 62  PNSTRLESVFSDILDGYAVVYS-SGLAAFFAAMVH--------------YNPKKIFIGQS 106
           P    LE  ++ +      V S SGL +   A++               Y P ++     
Sbjct: 63  PTIANLEDAWTHLTGAAGTVLSPSGLGSITLALMTLAKAGDHILITDSVYVPTRVLC--- 119

Query: 107 YHGVRAIANILTRNYDIKQHPLEDIERYAAEG-DIVHLESPVNPYGTSYDIESFARRAHA 165
             G+ A   I T  YD      EDIE+       ++ LESP +      DI +    A  
Sbjct: 120 -DGLLAKFGIQTEYYDPTVG--EDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKK 176

Query: 166 KGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEA--VSRRLK 223
            G   ILD+T+A+P    A   G DI L + TKY GGHSD L G+     E   + R   
Sbjct: 177 HGIRTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDFLLGLTSANQECWPLLRSTY 236

Query: 224 DDRIYL-GTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYH 282
           D    L G +   L     LR +RT  LR+ +    A  +  +L   + E + VL   + 
Sbjct: 237 DAMAMLPGADDCQLA----LRGMRTLHLRLKEAERKALDLAAWLGK-RDEVETVLHPAFE 291

Query: 283 SSLQTEEFVKKQLVGGYGPVFAITLR---TKEQCKVFPLKLKYFHHATSLGGIESLV--- 336
                + +++     G   +F+I L+   T+   +    K+K FH   S GG ESL+   
Sbjct: 292 DCPGHKYWLRD--YKGSSGLFSIVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPV 349

Query: 337 ---EWRAMTDPYIDQTLIRVSVGCESADDLIRDLASALKEL 374
              E R   +       +R+ VG E   DL RDL    + L
Sbjct: 350 KPAEQRKPHNWPHRGFALRIQVGLEELSDLKRDLELGFERL 390

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 120/261 (45%), Gaps = 30/261 (11%)

Query: 140 IVHLESPVNPYGTSYDIE---SFARRAHA-KGALLILDSTFASPPLQYAWNFGADIVLYS 195
            V LESP NP     D+    SF +      G  +++D+T  S         GAD+V  S
Sbjct: 160 CVLLESPTNPLMKVADLPKLISFVKSHRGGSGCKIVVDNTMVSGINCNPLELGADLVYES 219

Query: 196 ATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIY----LGTNVANLESFMLLRSLRTYELR 251
           ATK+  GH D+++GV+V    A S  L  D  +    +G  +A ++S++L+R L+T  +R
Sbjct: 220 ATKFLNGHHDIMAGVIV----AASVELAQDMYFIVNSMGAGLAPMDSWLLIRGLKTLGVR 275

Query: 252 INKQSENATKIVKFLSDH----QSEFDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAIT 306
           + +Q  NA  +  +L D      +E +  L+T +       +F + +    G G V +I 
Sbjct: 276 MYQQQHNAMVLAHWLQDSCGFAPTEQNSQLRTRFVGLKSHPQFHLHRSFNSGPGAVLSIE 335

Query: 307 LRTKEQCK--VFPLKLKYFHHATSLGGIESLVEW-----RAMTDPYI------DQTLIRV 353
               E  +  V   K KY++   S G + SL+        A  DP +       + LIR+
Sbjct: 336 TGDIELSEKIVCSKKFKYWNVTVSFGCVNSLISMPCKMSHASIDPELRKDRKFPEDLIRI 395

Query: 354 SVGCESADDLIRDLASALKEL 374
             G E   DL  DL  A +++
Sbjct: 396 CCGIEDVSDLQWDLLGAFEDV 416

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 147/351 (41%), Gaps = 23/351 (6%)

Query: 45  ENLDFMEKRPVYSRLAHPNSTRLESVFSDILDGYAVVYS-SGLAAFFAAMVHYNPKK--I 101
           E+L+  + R  Y     P    LE  ++ +      V S SGL +   A++  +     I
Sbjct: 46  EDLEQRKGRFFYGTAGSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHI 105

Query: 102 FIGQS-YHGVRAIANILTRNYDIKQHPL-----EDIERYAAEGD-IVHLESPVNPYGTSY 154
            I  S Y   R + + L   + I+         EDIE+       ++ LESP +      
Sbjct: 106 LITDSVYFPTRMLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQ 165

Query: 155 DIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK 214
           +I +    A   G   ILD+T+A+P    A   G DI L + TKY GGHSDLL G LV  
Sbjct: 166 NIPALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLG-LVSA 224

Query: 215 DEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFD 274
           +E     L+     +       +  + LR +RT  LR+ +    A  +  +    + E +
Sbjct: 225 NEECWPLLRSTYDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWFK-KRDEVE 283

Query: 275 KVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR---TKEQCKVFPLKLKYFHHATSLGG 331
           KVL   +      E +V+     G   +F+I L+   T+   +     +K F    S GG
Sbjct: 284 KVLHPAFEDCPGHEYWVRD--YKGSSGLFSIVLKDGFTRSGLENMVDNMKVFELGYSWGG 341

Query: 332 IESLV-----EWRAMTDPYIDQTL-IRVSVGCESADDLIRDLASALKELQD 376
            +SL+       +    P+      +R+ VG E  +DL RDL    + L +
Sbjct: 342 YDSLITPVNPPTQRKAAPWSHNGFALRIQVGLEELEDLKRDLELGFERLTE 392

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 91/351 (25%), Positives = 153/351 (43%), Gaps = 25/351 (7%)

Query: 45  ENLDFMEKRPVYSRLAHPNSTRLESVFSDILDGYAVVYS-SGLAAFFAAM--VHYNPKKI 101
           E+L+ +  R  Y     P    LE  ++++      V S +GL +   A+  V  +   I
Sbjct: 46  ESLESLGGRFWYGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHI 105

Query: 102 FIGQSYHGVRA-IANILTRNYDIKQH---PL--EDIERY-AAEGDIVHLESPVNPYGTSY 154
            +  S +G  A   N + R + +      PL  +DIE        ++ LESP +      
Sbjct: 106 LLPISVYGPTANFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQ 165

Query: 155 DIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK 214
           D+ +  + A       +LD+T+A+P    A ++G DI + + TKY GGHSDLL G L   
Sbjct: 166 DVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLG-LTSA 224

Query: 215 DEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFD 274
           +      L+     +G      +  + LR LRT +LR+ +    A  + ++L + ++E +
Sbjct: 225 NSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWL-EARNEVE 283

Query: 275 KVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR---TKEQCKVFPLKLKYFHHATSLGG 331
           ++L   +        +V+     G   VF   L+   ++   K    K++ F    S GG
Sbjct: 284 RILHPAFEDCPGHSLWVRD--YSGSTGVFTFILKDQFSRAGLKDMLEKMQIFKLGYSWGG 341

Query: 332 IESLV-------EWRAMTDPYIDQTLIRVSVGCESADDLIRDLASALKELQ 375
            ESL+         R  T  +    L R+ VG E  DD +RDL    + L+
Sbjct: 342 YESLLIPVNSTSRDRIRTWSHFGYAL-RIQVGLEDIDDQLRDLEMGFERLK 391

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 114/457 (24%), Positives = 182/457 (39%), Gaps = 107/457 (23%)

Query: 2   VDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSRL 59
           + L     + DD  NR   V  PI  +T++ ++D +        NL F  K P  VYSR 
Sbjct: 8   IQLHAGQENPDDNANRPRAV--PIYATTSYVFNDSE-----HGSNL-FGLKVPGYVYSRF 59

Query: 60  AHPNSTRLESVFSDILDGYAVV-YSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIAN 115
            +P    LE   + +  G A V  +SG AA       + H     I     Y G      
Sbjct: 60  QNPTQNVLEERMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGTYNQFK 119

Query: 116 ILTRNYDIKQHPL-----EDIERYAAEG-DIVHLESPVNPYGTSYDIESFARRAHAKGAL 169
           +  +   I+   +     +D E+   +    V+LES  NP     D E     AH  G  
Sbjct: 120 VAFKRLGIEARFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAHKHGVP 179

Query: 170 LILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV------------ 212
           +++D+TF +      P++Y    GADIV +SATK+ GGH   ++G++V            
Sbjct: 180 VVVDNTFGAGGFFCQPIKY----GADIVTHSATKWIGGHGTTIAGMIVDSGKFPWADYPE 235

Query: 213 ---------------VKDEAVS----------RRLKDDRIYLGTNVANLESFMLLRSLRT 247
                          + +EA              L+D    LG  ++   +F+L++ + T
Sbjct: 236 KFPQFSKPAEGYHGTIFNEAYGNLAYIVHVRVELLRD----LGPAISPFAAFLLIQGIET 291

Query: 248 YELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITL 307
             LR  +  +NA K+ ++L   QS +   +      S    E  KK L  G+G V +  +
Sbjct: 292 LSLRGERHGQNALKLAQWL--EQSPYVSWVSYPGLPSHPYHENAKKYLSNGFGGVLSFGV 349

Query: 308 R-----TKEQCKVFPL---------KLKYFHHATSLGGIESLVEWRAMTDPY-------- 345
           +     TKE+    P           LK   +  ++G  ++LV       PY        
Sbjct: 350 KDIPGQTKEELAAKPFSASGAQVVDSLKLASNLANVGDSKTLV-----IAPYFTTHEQLD 404

Query: 346 --------IDQTLIRVSVGCESADDLIRDLASALKEL 374
                   + + LIRVSVG E  DD+I D   + +++
Sbjct: 405 DDEKLLSGVTKDLIRVSVGTEFIDDIIADFQQSFEKV 441

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 110/456 (24%), Positives = 181/456 (39%), Gaps = 105/456 (23%)

Query: 2   VDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSRL 59
           V L     + DD  NR   V  PI  +T++ ++D      ++     F  + P  VYSR 
Sbjct: 8   VQLHAGQENPDDNKNRPRAV--PIYATTSYVFND------SKHGAQLFGLEVPGYVYSRF 59

Query: 60  AHPNSTRLESVFSDILDGYAVV-YSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIAN 115
            +P +   E   + +  G A V  SSG AA     + + H     +     Y G      
Sbjct: 60  QNPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTYNQFK 119

Query: 116 ILTRNYDIK------QHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGAL 169
           +  +   ++       +P +  + +      V+LES  NP     D E     AH  G  
Sbjct: 120 VAFKRLGVEARFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHKHGIP 179

Query: 170 LILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV------VKD--E 216
           +++D+TF +      PL+    FGADIV +SATK+ GGH   ++GV+V       KD  E
Sbjct: 180 VVVDNTFGAGGFFCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPWKDYPE 235

Query: 217 AVSRRLKDDRIY-------------------------LGTNVANLESFMLLRSLRTYELR 251
              +  K    Y                         LG  +    +F+LL+ + T  LR
Sbjct: 236 KFPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVETLSLR 295

Query: 252 INKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITLR 308
             + + NA  + K+L     E    +  + +  L++    E  KK L  G+G V +  ++
Sbjct: 296 CERHASNALALAKWL-----EKSPYVSWVSYPGLESHSHHENAKKYLSNGFGGVLSFGVK 350

Query: 309 -----TKEQCKVFPL---------KLKYFHHATSLGGIESLVEWRAMTDPY--------- 345
                ++E+ K  P           L+   +  ++G  ++LV       PY         
Sbjct: 351 DLPNQSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLV-----IAPYFTTHQQLDD 405

Query: 346 -------IDQTLIRVSVGCESADDLIRDLASALKEL 374
                  + + LIRVSVG E  DD+I D   + +++
Sbjct: 406 DEKLLSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKV 441

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 111/448 (24%), Positives = 180/448 (40%), Gaps = 95/448 (21%)

Query: 4   LSTALIHA---DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSR 58
             T  +HA   D  DN     A PI  +T++ +DD      ++  +  F  + P  VYSR
Sbjct: 5   FDTIQLHAGQEDAGDNAHRPRAVPIYATTSYVFDD------SKHGSQLFGLEVPGYVYSR 58

Query: 59  LAHPNSTRLES-VFSDILDGYAVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIA 114
             +P S  LE  + +      A+  +SG AA       + H     +     Y G     
Sbjct: 59  FQNPTSNVLEERIAALEGGAAALAVASGQAAQTLAIQGLAHNGDNIVATSYLYGGTYNQF 118

Query: 115 NILTRNYDIKQHPLE-----DIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGA 168
            +  + + I+   +E     D E+ +      V+LES  NP     D E     AH  G 
Sbjct: 119 KVAFKRFGIEARFVEGDNQDDFEKQFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGI 178

Query: 169 LLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV----------- 212
            +++D+TF +      P++Y    G DIV +SATK+ GGH   L GV++           
Sbjct: 179 PVMVDNTFGAGGFFCQPIKY----GVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKDYP 234

Query: 213 ----------------VKDEAV----------SRRLKDDRIYLGTNVANLESFMLLRSLR 246
                           + +EA           +  L+D    LG+ ++   +F+LL+ + 
Sbjct: 235 EKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGSLMSPFAAFLLLQGVE 290

Query: 247 TYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAIT 306
           T  LR  +  ENA K+ K+L   QS +   +      S    E  KK L  G+G + +  
Sbjct: 291 TLSLRGERHGENALKLAKWLE--QSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGMLSFG 348

Query: 307 LR--TKEQCKVFPLK---------LKYFHHATSLGGIESLV------EWRAMTD-----P 344
           ++       +  P K         LK   +  ++G  ++LV        + + D      
Sbjct: 349 VKDLPNADTETDPFKLSGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLNDEEKLAS 408

Query: 345 YIDQTLIRVSVGCESADDLIRDLASALK 372
            + + LIRVSVG E  DD+I D   + +
Sbjct: 409 GVTKDLIRVSVGTEFIDDIINDFQQSFE 436

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 110/453 (24%), Positives = 178/453 (39%), Gaps = 103/453 (22%)

Query: 4   LSTALIHA---DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLD-FMEKRP--VYS 57
             T  +HA   D  DN     A PI  +T++ ++D        +   D F  K P  VY 
Sbjct: 5   FDTVQLHAGQEDPNDNNHRPRAVPIYATTSYVFED-------SKHGADLFGLKVPGYVYG 57

Query: 58  RLAHPNSTRLES-VFSDILDGYAVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAI 113
           R  +P    LE  + +      A+  +SG AA       + H     +     Y G    
Sbjct: 58  RFQNPTQAVLEDRLAALEGGAAALATASGQAAQTLAIQGLAHCGDNIVSTSFLYGGTYNQ 117

Query: 114 ANILTRNYDIKQHPLE-----DIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKG 167
             +  + + I+   +E     D E+ +      V+LES  NP     D E     AH  G
Sbjct: 118 FKVAFKRFGIEARFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 ALLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV---------- 212
             +++D+TF +      PL+Y    GADIV +SATK+ GGH   L G++V          
Sbjct: 178 IPVMVDNTFGAGGFFCQPLKY----GADIVTHSATKWIGGHGTTLGGIIVDSGKFPWKDY 233

Query: 213 -----------------VKDEAV----------SRRLKDDRIYLGTNVANLESFMLLRSL 245
                            + +EA           +  L+D    LG+ ++   +F+L++ +
Sbjct: 234 PEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGSMISPFAAFLLIQGV 289

Query: 246 RTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPV 302
            T  LR  +  +NA K+ K+L     E    +  + +  L +    E  KK L  G+G +
Sbjct: 290 ETLSLRGERHGQNALKLAKWL-----EASPYVSWVSYPGLPSHSHHENAKKYLSNGFGGM 344

Query: 303 FAITLR--TKEQCKVFPLK---------LKYFHHATSLGGIESLVEWRAMTD-------- 343
            +  ++       +  P K         LK   +  ++G  ++LV     T         
Sbjct: 345 LSFGVKDLPNAATETDPFKLSGAQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLADEE 404

Query: 344 ---PYIDQTLIRVSVGCESADDLIRDLASALKE 373
                + + LIRVSVG E  DD+I D   A ++
Sbjct: 405 KLASGVTKDLIRVSVGTEYIDDIIEDFKQAFEK 437

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 109/452 (24%), Positives = 182/452 (40%), Gaps = 103/452 (22%)

Query: 6   TALIHADDKD---NRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSRLA 60
           T  +HA  +D   N  +  A PI  +T++ ++D      ++     F  + P  +YSR+ 
Sbjct: 7   TLQLHAGQEDAAENANSPRAVPIYATTSYVFND------SKHGAQLFGLEAPGFIYSRIM 60

Query: 61  HPNSTRLES-VFSDILDGYAVVYSSGLAAFFAA---MVHYNPKKI----FIGQSYHGVR- 111
           +P +  LE  + +      A+  +SG AA   A   + H     +      G SY+  + 
Sbjct: 61  NPTNDVLEKRIAALEGGAAALAVASGQAAQLVAIGGLAHAGDNIVSTSYLYGGSYNQFKV 120

Query: 112 AIANILTRNYDIKQHPLEDIE-RYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALL 170
           A   +      ++    ED E R+ ++   V LES  NP     D E     AH  G  +
Sbjct: 121 AFKRLGIECRFVEGDNAEDFEARFDSKTKAVFLESIGNPKYNVPDFERIVAVAHRHGIPV 180

Query: 171 ILDSTF-ASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV----------------- 212
           ++D+TF A         FGADIV +SATK+ GGH   + G++V                 
Sbjct: 181 VVDNTFGAGGYFCQPIKFGADIVTHSATKWIGGHGTAIGGLVVDSGKFPWKDYPAKFPQF 240

Query: 213 ----------VKDEAVS----------RRLKDDRIYLGTNVANLESFMLLRSLRTYELRI 252
                     V +EA+             L+D    LG  ++   +F+ L+ L T  LR 
Sbjct: 241 SEPSEGYHGLVLNEALGPLAFVGHARIELLRD----LGPALSPFAAFLFLQGLETLSLRA 296

Query: 253 NKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVK---KQLVGGYGPVFAITLR- 308
            +  +NA  + K+L     E    +  + +  L++ +++    + L  GYG V +  ++ 
Sbjct: 297 ERHGQNALALAKYL-----ETSAYVSWVSYPGLESHDYLSNATRYLQNGYGGVLSFGVKP 351

Query: 309 ---TKEQCKVFPL-------KLKYFHHATSLGGIESLVEWRAMTDPY------------- 345
              T E+   F          LK+  +  ++G  ++LV       PY             
Sbjct: 352 LPDTDEEADPFKAAGAQFVDNLKFASNLANVGDSKTLV-----IAPYFTTHQQLSESEKL 406

Query: 346 ---IDQTLIRVSVGCESADDLIRDLASALKEL 374
              + + LIRVSVG E   D+I D   A   +
Sbjct: 407 ASGVTRDLIRVSVGTEYLQDIIADFEQAFSTV 438

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 109/449 (24%), Positives = 184/449 (40%), Gaps = 94/449 (20%)

Query: 4   LSTALIHA---DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSR 58
             T  +HA   D  DN     A PI  +T+F ++D      +      F  ++P  +YSR
Sbjct: 5   FDTVQLHAGQEDPGDNAHRPAAVPIYQTTSFVFED------SHHGAQLFGLEKPGYMYSR 58

Query: 59  LAHPNSTRLES-VFSDILDGYAVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIA 114
           + +P    LE  + +      AV  SSG AA       + H     +     Y G     
Sbjct: 59  VGNPTVDVLEKRLAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTYNQF 118

Query: 115 NILTRNYDI------KQHPLEDIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKG 167
            +  +   I        +P ED E+ +  +   V++ES  NP     D E     AH  G
Sbjct: 119 KVAFKRLGIDVRFVLGDNP-EDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 ALLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV------VKD- 215
             +++D+TF +      P+++    G DIV +SATK+ GGH   ++GV+V       KD 
Sbjct: 178 IPVVVDNTFGAGGFFCQPIKH----GVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDY 233

Query: 216 -EAVSRRLKDDRIY-------------------------LGTNVANLESFMLLRSLRTYE 249
            E   +  K    Y                         LG  +  + +F+LL+ + T  
Sbjct: 234 PEKFPQFSKPSEGYHGMIFNDAMGPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVETLS 293

Query: 250 LRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEF---VKKQLVGGYGPVFAIT 306
           LR  +Q +NA K+ ++L     E    +  + +  L +  +    KK L  G+G V +I 
Sbjct: 294 LRAERQGQNALKLAQWL-----EKSPHVNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIG 348

Query: 307 LRT-KEQCKVFPLK---------LKYFHHATSLGGIESLV------EWRAMTD-----PY 345
           ++  K+     P K         LK   +  ++G  ++LV        + ++D       
Sbjct: 349 VKPLKDVSDSDPFKKSGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSG 408

Query: 346 IDQTLIRVSVGCESADDLIRDLASALKEL 374
           + + LIR+S+G E  DD+I D   + +++
Sbjct: 409 VTEDLIRISIGTEFIDDIIADFEQSFEKV 437

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 132/311 (42%), Gaps = 75/311 (24%)

Query: 129 EDIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS-----PPLQ 182
           ED E+ +  +   V+LE+  NP     D +     AH  G  +++D+TF +      P++
Sbjct: 138 EDFEKLFDEKTKAVYLETIGNPKYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK 197

Query: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLV---------------------------VKD 215
           Y    GADIV +SATK+ GGH   ++G ++                           + +
Sbjct: 198 Y----GADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFN 253

Query: 216 EAV----------SRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKF 265
           EA+          +  L+D    LG  ++   SF+LL+ + T  LR  +Q EN   + K+
Sbjct: 254 EAMGNLAFIGHVRTELLRD----LGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKW 309

Query: 266 LSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR----TKEQCKVFPL--- 318
           L   +S +   +      S    E  KK L  G+G V +  ++      E+   F     
Sbjct: 310 L--EKSAYVSWVSYPGLVSHSHHENAKKYLRNGFGGVLSFGVKDLPGAAEEKDPFKAAGA 367

Query: 319 ----KLKYFHHATSLGGIESLV------EWRAMTD-----PYIDQTLIRVSVGCESADDL 363
                LK   +  ++G  ++LV        + ++D       + + LIRVSVG E  DD+
Sbjct: 368 QAVDNLKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRVSVGTEFIDDI 427

Query: 364 IRDLASALKEL 374
           I D   + +++
Sbjct: 428 IADFQQSFEKI 438

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 129/315 (40%), Gaps = 83/315 (26%)

Query: 129 EDIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS-----PPLQ 182
           ED E+ +  +   ++LES  NP     D E     AH  G  +++D+TF +      P++
Sbjct: 137 EDFEKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGFFCQPIK 196

Query: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLV------VKD--EAVSRRLKDDRIY------ 228
           +    GADIV +SATK+ GGH   ++G ++       KD  E   +  K    Y      
Sbjct: 197 W----GADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYPEKFPQFSKPSEGYHGLVFN 252

Query: 229 -------------------LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDH 269
                              LG  ++   SF+LL+ L T  LR  + + NA K+ ++L   
Sbjct: 253 DAFGPLAFIGHARTELLRDLGPALSPFSSFLLLQGLETLSLRGERHAYNALKLAQWL--- 309

Query: 270 QSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITLR----TKEQCKVFPL---- 318
             E    +  + +  L++    E  KK L  G+G V +  ++      E+   F      
Sbjct: 310 --EKSPYVSWVSYPGLESHTHHENAKKYLQNGFGGVLSFGVKPLPNASEESDPFKASGAQ 367

Query: 319 ---KLKYFHHATSLGGIESLVEWRAMTDPY----------------IDQTLIRVSVGCES 359
               LK   +  ++G  ++LV       PY                +   LIRVSVG E 
Sbjct: 368 VVDNLKLASNLANVGDSKTLV-----IAPYFTTHQQLSHEEKLASGVTDDLIRVSVGTEF 422

Query: 360 ADDLIRDLASALKEL 374
            DD+I D   + +++
Sbjct: 423 IDDIIADFEQSFEKI 437

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 120/283 (42%), Gaps = 30/283 (10%)

Query: 45  ENLDFMEKRP--VYSRLAHPNSTRLESVFSDILDGYAVVYS-SGLAAFFAAMVH------ 95
           + L  +E+R    Y     P    LE+ ++ +  G   V S SGL +   A++       
Sbjct: 43  KKLSDLEQRKGRFYGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGD 102

Query: 96  --------YNPKKIFIGQSYHGVRAIANILTRNYDIKQHPLEDIERYAAEGD-IVHLESP 146
                   Y P ++       G+ A   + T  YD      +DIE+       ++ LESP
Sbjct: 103 HILMTDSVYVPTRMLC----DGLLAKFGVETDYYDPSIG--KDIEKLVKPNTTVIFLESP 156

Query: 147 VNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDL 206
            +      DI +    A   G   ILD+T+A+P    A   G DI + + TKY GGHSDL
Sbjct: 157 GSGTMEVQDIPALVSVAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDL 216

Query: 207 LSGVLVVKDEAVS-RRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKF 265
           L G+    +E     R   D + +     + +  + LR +RT  LR+ +    A  +  +
Sbjct: 217 LIGLASANEECWPLLRSTYDAMAMLPGAEDCQ--LALRGMRTLHLRLKEVERKALDLAAW 274

Query: 266 LSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR 308
           L + + E +KVL   +      E +V+     G   +F+I L+
Sbjct: 275 LGN-RDEVEKVLHPAFEDCPGHEYWVRD--YKGSSGLFSIVLK 314

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 112/459 (24%), Positives = 185/459 (40%), Gaps = 116/459 (25%)

Query: 6   TALIHADDKD-----NRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSR 58
           T  +HA  +D     NR   V  PI  +T++ +DD      ++  +  F  + P  +YSR
Sbjct: 7   TIQLHAGQEDPSEHSNRPRAV--PIYSTTSYVFDD------SKHGSQLFGLETPGYIYSR 58

Query: 59  LAHPNSTRLESVFSDILDGY-AVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIA 114
           + +P +   E   + +  G  A+  SSGLAA       + H     +     Y G     
Sbjct: 59  IMNPTADVFERRIAALEGGVGALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGTYNQF 118

Query: 115 NILTRNYDIKQHPLEDIERYAAEGDI------VHLESPVNPYGTSYDIESFARRAHAKGA 168
            I  + + I+   +E  +    E  I      V+LE+  NP     D E     AH  G 
Sbjct: 119 KIAFKRFGIESRFIEGDDPSGLEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGV 178

Query: 169 LLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV----------- 212
            +++D+TF +      P+++    GAD+V++SATK+ GGH   + GV+V           
Sbjct: 179 PVVVDNTFGAGGYYCQPIKH----GADVVVHSATKWIGGHGTTIGGVIVDSGNFPWKEYP 234

Query: 213 ----------------VKDEAVSRR----------LKDDRIYLGTNVANLESFMLLRSLR 246
                           V +EA+  +          L+D    LG +++   +F+LL+ L 
Sbjct: 235 KKFPQFSEPSEGYHGLVFNEALGNQAFIGHVRAELLRD----LGPSLSPFAAFLLLQGLE 290

Query: 247 TYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEF---VKKQLVGGYGPVF 303
           T  LR  + + NA K+ ++L     E    +  + +  L         KK L  G+G V 
Sbjct: 291 TLSLRAERHASNALKLAQWL-----EKSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVL 345

Query: 304 AIT---LRTKEQCKVFPLK---------LKYFHHATSLGGIESLVEWRAMTDPY------ 345
           +     L    + K  P K         L+   +  ++G  ++LV       PY      
Sbjct: 346 SFGAKDLPDNPEEKENPFKAAGAQISDNLELASNLANVGDCKTLV-----IAPYFTTHLQ 400

Query: 346 ----------IDQTLIRVSVGCESADDLIRDLASALKEL 374
                     + + LIRVSVG E  DD+I D   + K++
Sbjct: 401 LNHEEKLAAGVSKDLIRVSVGTEFIDDIIADFEQSFKKV 439

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 105/449 (23%), Positives = 173/449 (38%), Gaps = 97/449 (21%)

Query: 6   TALIHADDKDNRVTDVAP---PINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSRLA 60
           T  +HA  +D       P   PI  +T++ ++D      ++     F  + P  +YSR+ 
Sbjct: 7   TIQLHAGQEDASTNANNPNAVPIYATTSYVFND------SKHGAQLFGLETPGYIYSRIM 60

Query: 61  HPNSTRLESVFSDILDGYAVV-YSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIANI 116
           +P     E   + +  G A +  SSG AA       + H     +     Y G      +
Sbjct: 61  NPTVDVFEKRIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKV 120

Query: 117 LTRNYDIKQHPLE-----DIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALL 170
             +   I    +E     D E+ +  +   V+LE+  NP     D E     AH  G  +
Sbjct: 121 AFKRLGINVKFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHKHGIPV 180

Query: 171 ILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV------VKD--EA 217
           ++D+TF +      P++Y    G DIV +SATK+ GGH   ++G ++       KD  E 
Sbjct: 181 VVDNTFGAGGYFCQPIKY----GCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYPER 236

Query: 218 VSRRLKDDRIY-------------------------LGTNVANLESFMLLRSLRTYELRI 252
             +  K    Y                         LG  +    +F+LL+ + T  LR 
Sbjct: 237 FPQFSKPSEGYHGLVFNDAFGPAAFIGHVRTELLRDLGPCLDAFSAFLLLQGVETLSLRG 296

Query: 253 NKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLRTKEQ 312
            +  EN  K+ K+L   +S +   +      S    E  KK L  G+G V +  ++    
Sbjct: 297 ERHGENTLKLAKWLE--KSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPN 354

Query: 313 C--KVFPLK---------LKYFHHATSLGGIESLVEWRAMTDPY---------------- 345
              +  P K         LK   +  ++G  ++LV       PY                
Sbjct: 355 ASDEKDPFKASGAQVVDNLKLALNLANVGDSKTLV-----IAPYFTTHQQLNEEEKLASG 409

Query: 346 IDQTLIRVSVGCESADDLIRDLASALKEL 374
           + + LIRVSVG E  DD+I D   + +++
Sbjct: 410 VTKDLIRVSVGTEYIDDIIADFQQSFEKV 438

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 88/337 (26%), Positives = 135/337 (40%), Gaps = 65/337 (19%)

Query: 77  GYAVVYSSGLAAFFAAMVHYNP---KKIFIGQSYHGVRAIANILTRNYDIKQH------P 127
           GYA  +S        A+V Y P   K +  G  Y    +I  +    + +          
Sbjct: 323 GYASPHSPN-----GALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFLGSGDHKAMAQ 377

Query: 128 LEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNF 187
           LEDI         V +E+P NP     D+++  R A   G  L++D T     +      
Sbjct: 378 LEDILHSGEPILAVFIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGF-VNIDVLP 436

Query: 188 GADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKD------------------DRIYL 229
            AD+V  S TK F G S++++G LVV     + RL D                  D IYL
Sbjct: 437 HADLVCSSLTKIFSGDSNVMAGSLVVNP---ASRLYDFAQGFFHNGSYEDLLWCEDAIYL 493

Query: 230 GTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE 289
             N          R   +  LR+NK +E    + K L  HQ     + K I++ +L +EE
Sbjct: 494 ERNS---------RDCASRSLRVNKNTE--LLLEKVLLPHQG---SLFKKIFYPTLTSEE 539

Query: 290 F------VKKQLVGGYGPVFAITLRTKEQCKVF---------PLKLKYFHHATSLGGIES 334
                  V+ +  GGYG +F++T   + + KVF         P     F  A     +  
Sbjct: 540 TKRNYDAVRCKPDGGYGGLFSLTFHEENRAKVFFDTLELCKGPSLGTNFTLACPYTVLAH 599

Query: 335 LVEWRAMTDPYIDQTLIRVSVGCESADDLIRDLASAL 371
             E   + +  ++++L+RVSVG E  D L +    A+
Sbjct: 600 YAEMDVVAEYGLERSLVRVSVGLEDFDHLRKVFQRAI 636

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 117/275 (42%), Gaps = 44/275 (16%)

Query: 128 LEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNF 187
           L+DI     +   V +E+P NP     D+      A+A G  +++D T A   +      
Sbjct: 384 LKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDET-AGGFVNIDVLP 442

Query: 188 GADIVLYSATKYFGGHSDLLSGVLVVKDEA----------VSRRLKD-----DRIYLGTN 232
            ADIV  S TK F G S++++G +V+   +           S   +D     D IYL  N
Sbjct: 443 HADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFAQQFFSSDSFEDLLWCEDAIYLERN 502

Query: 233 VANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVK 292
                     R   T  L +NK ++   + V    +      K+ K I+  SL +EE  +
Sbjct: 503 S---------RDFATRTLTVNKNTQRLLEDVLLPQE-----GKLFKKIFFPSLTSEETKR 548

Query: 293 KQLV-----GGYGPVFAITLRTKEQCKVF---------PLKLKYFHHATSLGGIESLVEW 338
              V     GGYG +F++T   +EQ +VF         P     F  A     +    E 
Sbjct: 549 NYDVVLCPQGGYGGLFSLTFYREEQARVFFDVLELCKGPSLGTNFTLACPYAILAHYAEL 608

Query: 339 RAMTDPYIDQTLIRVSVGCESADDLIRDLASALKE 373
             +    ++++L+RVSVG ESA+ L    + A+KE
Sbjct: 609 EEVAKYGVERSLVRVSVGLESAESLNHVFSHAIKE 643

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 118/284 (41%), Gaps = 58/284 (20%)

Query: 121 YDIKQHPLEDIERYAAEGD---IVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFA 177
           YD K   L+D++     G+    V +E+P NP     D+    + +   G  +++D T  
Sbjct: 386 YDSKS--LQDLQTILHSGEQILAVFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIG 443

Query: 178 SPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK----------------DEAVSRR 221
              +     F ADIV  S TK F G S++++G +V+                 D      
Sbjct: 444 GF-VNLDGLFHADIVCSSLTKVFNGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSI 502

Query: 222 LKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDH--QSEFDKVLKT 279
             +D IYL  N          R      LRIN  +E       +L D+  +    K+ K 
Sbjct: 503 WCEDLIYLEKNS---------RDFVAKTLRINYTTE-------YLLDNVFKPHVGKLFKR 546

Query: 280 IYHSSLQTEEF------VKKQLVGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIE 333
           IY+ S  +EE       +K +  GGYG VF++T    +Q KVF   LK     T LG   
Sbjct: 547 IYYPSQNSEEIKQNYEAIKCKKDGGYGGVFSVTFFQLDQAKVFFNNLKLTKQIT-LGNNS 605

Query: 334 SLV----------EWRAMTDPYIDQTLIRVSVGCESADDLIRDL 367
           + V          E   + +  ++  LIRV VG E+ + L RD+
Sbjct: 606 TTVCPYTMLKHKDELERVKEYGLEDNLIRVCVGLENKNTL-RDI 648

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 89/394 (22%), Positives = 154/394 (39%), Gaps = 80/394 (20%)

Query: 55  VYSRLAHPNSTRLESVFSDILDGYAVV-YSSGLAA---FFAAMVHYNPKKIFIGQSYHGV 110
           +YSR+ +P    LE   + +  G   V  +SG AA      A+       +     Y G 
Sbjct: 54  LYSRMGNPTVDVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGT 113

Query: 111 RAIANILTRNYDIK-----QHPLEDIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAH 164
                +  +   ++         ED E+ +  +   +++ES  NP  T  D E     AH
Sbjct: 114 YNQLKVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAH 173

Query: 165 AKGALLILDSTFASP-----PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKD---- 215
             G  +++D+TF +      P++    FGADI+ +SATK+  GH   ++G +V       
Sbjct: 174 KHGIPVVVDNTFGAAGFFCKPIE----FGADIITHSATKWINGHGTAIAGAIVDSGNFPW 229

Query: 216 --------------EAVSRRLKDDRIY---------------LGTNVANLESFMLLRSLR 246
                         E+    + +D                  LG+ ++   +F+ L+ L 
Sbjct: 230 TQYPDKFPQFSQPAESYHGMVYNDNFGPLAFIAYVRLELLRDLGSTMSPFTAFLSLQGLE 289

Query: 247 TYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAIT 306
           T  LR  + + N+  + + L D  S +   +      S  +    KK L  G G + +  
Sbjct: 290 TLSLRCERHARNSIDLARHLED--SPYVAWVSYPGLDSHPSRNNAKKYLTNGAGGMLSFG 347

Query: 307 LRT-------KEQCKV--------FPLKLKYFHHATSLGGIESLV------EWRAMTD-- 343
           ++        +E  +V        F   LK   +  ++G  ++LV        + +TD  
Sbjct: 348 IKPFDKTNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEE 407

Query: 344 ---PYIDQTLIRVSVGCESADDLIRDLASALKEL 374
                 D+ +IRVSVG E  DD+I D   A K +
Sbjct: 408 KLKAGADKDVIRVSVGTEYIDDIIADFEQAFKTV 441

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 128/294 (43%), Gaps = 68/294 (23%)

Query: 128 LEDIERYAAEGD---IVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS----PP 180
           L+D+E     G+    V +E+P NP     D+    R A+  G  +I+D T         
Sbjct: 412 LKDLECTLHSGEQILAVFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNIDV 471

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIY---------LGT 231
           L YA     DIV  S TK F G S++++G +V+  +        +++Y         LG 
Sbjct: 472 LPYA-----DIVCSSLTKIFSGSSNVIAGSMVLNPQ--------EKLYSFAQVFMSQLGE 518

Query: 232 NVANL---ESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE 288
              +L   ++  L R+ R +  R  K ++N   ++K +   Q    K+ K I++ SL + 
Sbjct: 519 YEDHLWCEDAIYLERNSRDFIARTIKTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSA 578

Query: 289 E------FVKKQLV-------GGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESL 335
           E       V+ + +       GGYG +F++     EQ K+F  +L       +L    SL
Sbjct: 579 ESKVNYDAVRCKSIDKDSDEEGGYGGLFSLAFNKIEQAKIFFNEL-------NLSKGPSL 631

Query: 336 VEWRAMTDPY----------------IDQTLIRVSVGCESADDLIRDLASALKE 373
                ++ PY                ++++L+RVS+G ES D+L +    A+ E
Sbjct: 632 GTNFTLSCPYTVLMYYDKLDEVAKYEVEESLVRVSIGIESQDELQKAFQHAIDE 685

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 118/262 (45%), Gaps = 41/262 (15%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V LE+P NP     D++     A+  G  +++D T        L YA     DIV  S T
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGGLNVDVLPYA-----DIVCTSLT 374

Query: 198 KYFGGHSDLLSGVLVVKDEAV--SRRLKDDRIYLGTNVANLESFMLLRS-LRTYELRINK 254
           K F G S+++ G +++  ++   S  L+  R      +  LE  ++L +  R +E R  +
Sbjct: 375 KLFSGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTR 434

Query: 255 QSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAITLRT 309
            +EN  K+++ +     E  K+ K +Y+ ++ ++E  K     +   GGYG +F+++   
Sbjct: 435 TNENTMKLIQEV--LLPEEGKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFN 492

Query: 310 KEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIRV 353
           +E  K      K+++  T   G  +   +  +  PY+                  +L+RV
Sbjct: 493 EEDAK------KFYNSLTVFKGPSNGTNF-TLACPYVHLAHHFELEEVSTFGAHSSLVRV 545

Query: 354 SVGCESADDLIRDLASALKELQ 375
           SVG E+   L+   +S +  L+
Sbjct: 546 SVGLENTQWLLNAFSSVINLLR 567

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 113/446 (25%), Positives = 181/446 (40%), Gaps = 87/446 (19%)

Query: 4   LSTALIHADDK---DNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSR 58
             T  +HA  +   DN     A PI  +T++ +++      ++  +  F  + P  VYSR
Sbjct: 5   FDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYVYSR 58

Query: 59  LAHPNSTRLES-VFSDILDGYAVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIA 114
             +P S  LE  + +      A+  SSG AA       + H     +     Y G     
Sbjct: 59  FQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQF 118

Query: 115 NILTRNYDIKQHPLE-----DIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGA 168
            I  + + I+   +E     D E+ +      V+LE+  NP     D E     AH  G 
Sbjct: 119 KISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGI 178

Query: 169 LLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLL------SGVLVVKD-- 215
            +++D+TF +      P++Y    GADIV +SATK+ GGH   +      SG    KD  
Sbjct: 179 PVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYP 234

Query: 216 EAVSRRLKDDRIYLGT-------NVANL------------------ESFMLLRSLRTYEL 250
           E   +  +    Y GT       N+A +                   SF+LL+ + T  L
Sbjct: 235 EKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSL 294

Query: 251 RINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR-- 308
           R  +  ENA K+ K+L   QS +   +     +S    E  KK L  G+G V +  ++  
Sbjct: 295 RAERHGENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDL 352

Query: 309 --TKEQCKVFPL-------KLKYFHHATSLGGIESLV------EWRAMTDPY-----IDQ 348
               ++   F L        LK   +  ++G  ++LV        + + D       + +
Sbjct: 353 PNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTK 412

Query: 349 TLIRVSVGCESADDLIRDLASALKEL 374
            LIRVSVG E  DD+I D   + + +
Sbjct: 413 DLIRVSVGIEFIDDIIADFQQSFETV 438

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 113/446 (25%), Positives = 181/446 (40%), Gaps = 87/446 (19%)

Query: 4   LSTALIHA---DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSR 58
             T  +HA   +  DN     A PI  +T++ +++      ++  +  F  + P  VYSR
Sbjct: 5   FDTVQLHAGQENPSDNAHRTRAVPIYATTSYCFEN------SKHGSQLFGLEVPGYVYSR 58

Query: 59  LAHPNSTRLES-VFSDILDGYAVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIA 114
             +P S  LE  + +      A+  SSG AA       + H     +     Y G     
Sbjct: 59  FQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQF 118

Query: 115 NILTRNYDIKQHPLE-----DIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGA 168
            I  + + I+   +E     D E+ +      V+LE+  NP     D E     AH  G 
Sbjct: 119 KISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGI 178

Query: 169 LLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLL------SGVLVVKD-- 215
            +++D+TF +      P++Y    GADIV +SATK+ GGH   +      SG    KD  
Sbjct: 179 PVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYP 234

Query: 216 EAVSRRLKDDRIYLGT-------NVANL------------------ESFMLLRSLRTYEL 250
           E   +  +    Y GT       N+A +                   SF+LL+ + T  L
Sbjct: 235 EKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSL 294

Query: 251 RINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR-- 308
           R  +  ENA K+ K+L   QS +   +     +S    E  KK L  G+G V +  ++  
Sbjct: 295 RAERHGENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDL 352

Query: 309 --TKEQCKVFPL-------KLKYFHHATSLGGIESLV------EWRAMTDPY-----IDQ 348
               ++   F L        LK   +  ++G  ++LV        + + D       + +
Sbjct: 353 PNADKETDPFKLSGAQVVDSLKLASNLANVGDAKTLVIAPYFTTHKQLNDTEKLASGVTK 412

Query: 349 TLIRVSVGCESADDLIRDLASALKEL 374
            LIRVSVG E  DD+I D   + + +
Sbjct: 413 DLIRVSVGIEFIDDIIADFQQSFETV 438

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 109/260 (41%), Gaps = 41/260 (15%)

Query: 143 LESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS---PPLQYAWNFGADIVLYSATKY 199
           +E+P NP     D+    + A+  G  +++D T        L YA     DIV  S TK 
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGGLNVDILPYA-----DIVCTSLTKL 358

Query: 200 FGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYEL--------- 250
           F G S+++ G L++  +  S      R ++ ++    E  +     +  E+         
Sbjct: 359 FNGSSNVMGGSLILNPK--SSLYSSARAFVESD--GFEDLLWCEDAKVLEINSRDFEDRT 414

Query: 251 -RINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFA 304
            R NK +E     +  +++      KV K IY+ ++ +EE  K     +  +GGYG +F+
Sbjct: 415 VRANKNTERLLSELILVNE-----GKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFS 469

Query: 305 ITLRTKEQCKVFPLKLKYFHH---------ATSLGGIESLVEWRAMTDPYIDQTLIRVSV 355
           +   ++E  K F   LK F           A     +    E   ++    D  LIRVSV
Sbjct: 470 MAFYSEEDSKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSV 529

Query: 356 GCESADDLIRDLASALKELQ 375
           G E +  L+   + A+  L+
Sbjct: 530 GLEDSQWLLDVFSDAINMLE 549

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 112/446 (25%), Positives = 180/446 (40%), Gaps = 87/446 (19%)

Query: 4   LSTALIHADDK---DNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSR 58
             T  +HA  +   DN     A PI  +T++ +++      ++  +  F  + P  VYSR
Sbjct: 5   FDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYVYSR 58

Query: 59  LAHPNSTRLES-VFSDILDGYAVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIA 114
             +P S  LE  + +      A+  SSG AA       + H     +     Y G     
Sbjct: 59  FQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQF 118

Query: 115 NILTRNYDIK------QHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGA 168
            I  + + I+       +P E  + +      V+LE+  NP     D E     AH  G 
Sbjct: 119 KISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGI 178

Query: 169 LLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLL------SGVLVVKD-- 215
            +++D+TF +      P++Y    GADIV +SATK+ GGH   +      SG    KD  
Sbjct: 179 PVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYP 234

Query: 216 EAVSRRLKDDRIYLGT-------NVANL------------------ESFMLLRSLRTYEL 250
           E   +  +    Y GT       N+A +                   SF+LL+ + T  L
Sbjct: 235 EKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSL 294

Query: 251 RINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR-- 308
           R  +  ENA K+ K+L   QS +   +     +S    E  KK L  G+G V +  ++  
Sbjct: 295 RAERHGENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDL 352

Query: 309 --TKEQCKVFPL-------KLKYFHHATSLGGIESLV------EWRAMTDPY-----IDQ 348
               ++   F L        LK   +  ++G  ++LV        + + D       + +
Sbjct: 353 PNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTK 412

Query: 349 TLIRVSVGCESADDLIRDLASALKEL 374
            LIRVSVG E  DD+I D   + + +
Sbjct: 413 DLIRVSVGIEFIDDIIADFQQSFETV 438

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 109/438 (24%), Positives = 182/438 (41%), Gaps = 92/438 (21%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSRLAHPNSTRLES 69
           DD ++R   V  PI  +T+F ++D      ++     F  + P  +YSR  +P +  LE 
Sbjct: 18  DDNNHRPRAV--PIYSTTSFVFND------SQHGAQLFGLEVPGYIYSRFQNPTNNVLEE 69

Query: 70  -VFSDILDGYAVVYSSGLAA--FFAAMVHYNPKKI-----FIGQSYHGVR-AIANILTRN 120
            + +      A+  SSG AA     A + +N   I       G +Y+  + A   +    
Sbjct: 70  RIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGTYNQFKVAFKRLGIEA 129

Query: 121 YDIKQHPLEDIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS- 178
             ++    ED E+ +      V+LES  NP     D E+    AH  G  +++D+TF + 
Sbjct: 130 RFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHKHGIPVVVDNTFGAG 189

Query: 179 ----PPLQYAWNFGADIVLYSATKYFGGHSDLL------SGVLVVKD--EAVSRRLKDDR 226
                P++Y    GADIV +SATK+ GGH   +      SG    KD  E   +  K   
Sbjct: 190 GFFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSKPAE 245

Query: 227 IY-------------------------LGTNVANLESFMLLRSLRTYELRINKQSENATK 261
            Y                         LG  ++   +F+LL+ + T  LR  +  +NA  
Sbjct: 246 GYHGTVYNETYGNLAYIVHVRTELLRDLGPGMSPFAAFLLLQGVETLSLRGERHGQNALA 305

Query: 262 IVKFLSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITLR----TKEQCK 314
           + K+L     E +  +  + +  L +    E  KK L  G+G V +  ++      ++  
Sbjct: 306 LAKWL-----EKNPHVAWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETD 360

Query: 315 VFPL-------KLKYFHHATSLGGIESLV------EWRAMTDPY-----IDQTLIRVSVG 356
            F L        LK   +  ++G  ++LV        + ++DP      + + LIRVSVG
Sbjct: 361 PFKLAGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLSDPEKLASGVTKDLIRVSVG 420

Query: 357 CESADDLIRDLASALKEL 374
            E  DD+I D   +  ++
Sbjct: 421 TEFIDDIIADFEQSFAKV 438

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 103/444 (23%), Positives = 176/444 (39%), Gaps = 87/444 (19%)

Query: 6   TALIHADDKD---NRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSRLA 60
           T  +HA  +D   N     A PI  ++++ ++D      ++     F  ++P  +YSR+ 
Sbjct: 7   TLQLHAGQEDATENAHNPRAVPIYATSSYVFND------SQHGAQLFGLEKPGYMYSRIV 60

Query: 61  HPNSTRLESVFSDILDGYAVV-YSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIANI 116
           +P     E   + +  G A +  +SG AA     + + H     +     Y G      +
Sbjct: 61  NPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGTYNQFKV 120

Query: 117 LTRNYDIKQHPLE-----DIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALL 170
             R   I+   +E     D E+ +  +   V+LE+  NP     D E     AH  G  +
Sbjct: 121 AFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAHKHGIPV 180

Query: 171 ILDSTFAS-----PPLQYAWNFGADIVLYSATKY-------------------------- 199
           ++D+TF +      P++Y    GADIV +SATK+                          
Sbjct: 181 VVDNTFGAGGYFAQPIKY----GADIVTHSATKWIGGHGTTIGGVIVDSGKFPWKEYPEK 236

Query: 200 ---FGGHSDLLSGVLVVKDEAVSRRLKDDRIY----LGTNVANLESFMLLRSLRTYELRI 252
              F   S+   G+++         +   RI     LG  +    +F LL+ + T  LR 
Sbjct: 237 FPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFAAFQLLQGVETLSLRC 296

Query: 253 NKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLRTKEQ 312
            + + NA K+ ++L   +S +   +     SS    E  KK L  G+G V +  ++    
Sbjct: 297 ERHATNALKLAQYLE--KSPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVLSFGVKDLPN 354

Query: 313 CKVF--PLK---------LKYFHHATSLGGIESLV------EWRAMTD-----PYIDQTL 350
                 P K         LK   +  ++G  ++LV        + +TD       + + L
Sbjct: 355 AHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDL 414

Query: 351 IRVSVGCESADDLIRDLASALKEL 374
           IRVSVG E  DD+I D   A +++
Sbjct: 415 IRVSVGTEFIDDIIGDFEQAFEKV 438

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 112/446 (25%), Positives = 181/446 (40%), Gaps = 87/446 (19%)

Query: 4   LSTALIHADDK---DNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSR 58
             T  +HA  +   DN     A PI  +T++ +++      ++  +  F  + P  VYSR
Sbjct: 5   FDTVQLHAGQENAGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYVYSR 58

Query: 59  LAHPNSTRLES-VFSDILDGYAVVYSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIA 114
             +P S  LE  + +      A+  SSG AA       + H     +     Y G     
Sbjct: 59  FQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQF 118

Query: 115 NILTRNYDIKQHPLE-----DIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGA 168
            I  + + I+   +E     D E+ +      V+LE+  NP     D E     AH  G 
Sbjct: 119 KISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGI 178

Query: 169 LLILDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLL------SGVLVVKD-- 215
            +++D+TF +      P++Y    GADIV +SATK+ GGH   +      SG    KD  
Sbjct: 179 PVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYP 234

Query: 216 EAVSRRLKDDRIYLGT-------NVANL------------------ESFMLLRSLRTYEL 250
           E   +  +    Y GT       N+A +                   SF+LL+ + T  L
Sbjct: 235 EKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSL 294

Query: 251 RINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR-- 308
           R  +  ENA K+ K+L   +S +   +     +S    E  KK L  G+G V +  ++  
Sbjct: 295 RAERHGENALKLAKWLE--ESPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDL 352

Query: 309 --TKEQCKVFPL-------KLKYFHHATSLGGIESLV------EWRAMTDPY-----IDQ 348
               ++   F L        LK   +  ++G  ++LV        + + D       + +
Sbjct: 353 PNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTK 412

Query: 349 TLIRVSVGCESADDLIRDLASALKEL 374
            LIRVSVG E  DD+I D   + + +
Sbjct: 413 DLIRVSVGIEFIDDIIADFQQSFETV 438

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 112/271 (41%), Gaps = 65/271 (23%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     D++   + A   G  +++D T        L YA     DIV  S T
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGGLNVDILPYA-----DIVCTSLT 371

Query: 198 KYFGGHSDLLSG-VLVVKDEAV---------SRRLKD-----DRIYLGTNVANLESFMLL 242
           K F G S+++ G VL+  D ++         S   +D     D + L  N  + E+    
Sbjct: 372 KLFSGTSNVMGGSVLLNPDSSLYPYAQEYFQSCEFEDLLWSEDAVVLEANSRDFEA---- 427

Query: 243 RSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVG 297
           R+LRT E  +N      TK++        E  K++K +Y+ ++ +EE  K     +   G
Sbjct: 428 RTLRTNENTVNL----LTKVL------LPEEGKLIKKVYYPTVSSEETFKNYERVRNRQG 477

Query: 298 GYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------- 346
           GYG +F+I    +E  K F   LK F   ++            +  PY+           
Sbjct: 478 GYGCLFSIAFHNEEDAKCFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHFELVEV 530

Query: 347 -----DQTLIRVSVGCESADDLIRDLASALK 372
                D  L+RVSVG E    L     +AL+
Sbjct: 531 AELGADPNLVRVSVGLEEFQGLREVFLNALE 561

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 107/244 (43%), Gaps = 37/244 (15%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D+    + A A    +I+D T         LQYA     DIV  S 
Sbjct: 427 VFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVLQYA-----DIVCSSL 481

Query: 197 TKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANL----ESFMLLRSLRTYELRI 252
           TK F G S++++G LV+   +   +L   R +   +  +L    +S  L R+ R    R 
Sbjct: 482 TKIFSGDSNVMAGSLVLNPSSRLYKLA-RRFFASDDYEDLLWCEDSIYLERNSRDCVSRS 540

Query: 253 NKQSENATKIVK--FLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVGGYGPVFA 304
            K +ENA +++K   L    + F    K IY+ SL + E       VK Q  GGYG +F+
Sbjct: 541 MKINENAERLLKGTLLPLEGTLF----KKIYYPSLTSSETKANYDAVKCQPNGGYGGLFS 596

Query: 305 ITLRTKEQCKVFPLKLKYFHHATSLGGIESLV----------EWRAMTDPYIDQTLIRVS 354
           +T    E  K F   L       SLG   +L           E   +    +++ L+RVS
Sbjct: 597 LTFFDDECAKAFFNSLD-LCKGPSLGTNFTLACPYTILAHYGEMDVVAKYGLEKNLVRVS 655

Query: 355 VGCE 358
           +G E
Sbjct: 656 IGLE 659

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 112/263 (42%), Gaps = 46/263 (17%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     ++    R +   G  +I+D T           F ADIV  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGVLVVKDEA-----VSRRLK-----------DDRIYLGTNVANLESFMLLRS 244
            G S+++ G +V+  ++      SR ++           +D IYL  N          R 
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNS---------RD 504

Query: 245 LRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGG 298
                +RIN  +E    + K L  H  E +K+ K IY+ +L ++E       V+ +  GG
Sbjct: 505 FIARTIRINYSTEYL--LDKILKPHVGE-NKLFKKIYYPNLTSKETLTNYDMVRCKKEGG 561

Query: 299 YGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQ 348
           YG +F++T   ++    F   LK  +   SLG   +L     +   Y          +++
Sbjct: 562 YGGLFSLTFHDEDHAAAFYDNLK-LNKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVER 620

Query: 349 TLIRVSVGCESADDLIRDLASAL 371
            L+R+SVG ES   L +    A+
Sbjct: 621 NLLRISVGLESQSILGKIFQEAI 643

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 122/269 (45%), Gaps = 30/269 (11%)

Query: 128 LEDIERYAAEGDIV---HLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYA 184
           +E++++    G+ +    +E+P NP     D+      A++ G  +++D T         
Sbjct: 374 MEELKKILHSGEQILALFMEAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNIDV 433

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANL----ESFM 240
             F ADIV  S TK F G S++++G +V+  +  S+       ++     +     ++  
Sbjct: 434 LPF-ADIVCSSLTKIFSGDSNVIAGSIVLNPQ--SKLYSFAETFMEQQYEDCLWCEDALY 490

Query: 241 LLRSLRTYELRINKQSENATKIV-KFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQ 294
           L R+ R +  R  K ++N  +++ K L   +    K+ K IY+ SL ++E  K     + 
Sbjct: 491 LERNSRDFVARTLKVNQNTERLLNKVLLPQEG---KLFKKIYYPSLTSKETKKNYDAVRG 547

Query: 295 LVGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPY--------- 345
             GGYG +F++T    +  K F   L+      SLG   +L    A+   Y         
Sbjct: 548 HQGGYGGLFSLTFYNLDSAKTFFNTLQ-LCKGPSLGTNFTLACPYAIIAHYQELDRVAKY 606

Query: 346 -IDQTLIRVSVGCESADDLIRDLASALKE 373
            ++  L+RVSVG E  D+L +   +A+ E
Sbjct: 607 GVESNLVRVSVGLEREDELCKVFQTAIDE 635

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 115/262 (43%), Gaps = 42/262 (16%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D++   R +      +++D T         L YA     DI+  S 
Sbjct: 388 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIICSSL 442

Query: 197 TKYFGGHSDLLSGVLVVKD-----EAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELR 251
           TK F G S++++G LV+       E   + +K +  Y    +   ++  L R+ R +  R
Sbjct: 443 TKIFSGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDC-LWCEDALCLERNSRDFVER 501

Query: 252 INKQSENA----TKIVKFLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVGGYGP 301
             K + N     TK++        +  K+ K IY+ SL +EE       V     GGYG 
Sbjct: 502 TIKVNTNTDILLTKVL------LPQVGKLFKKIYYPSLTSEETKRNYDSVMATRDGGYGG 555

Query: 302 VFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLI 351
           +F++T    E+ K F   L+      SLG   +L    A+   Y          +++ L+
Sbjct: 556 LFSLTFFDIEKAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLV 614

Query: 352 RVSVGCESADDLIRDLASALKE 373
           RVSVG E++D L R    A+++
Sbjct: 615 RVSVGLENSDVLCRVFQRAIEK 636

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 129/306 (42%), Gaps = 65/306 (21%)

Query: 129 EDIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTF-ASPPLQYAWN 186
           ED E+ +  +   V+LES  NP     D E     AH  G  +++D+TF A       + 
Sbjct: 138 EDFEKAFDDKTKAVYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQPFK 197

Query: 187 FGADIVLYSATKYFGGHSDLLSGVLV------VKD------------EAVSRRLKDDRIY 228
           FGADI+ +SATK+ GGH   + GV+V       KD            E     + +D + 
Sbjct: 198 FGADIITHSATKWIGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDALG 257

Query: 229 ---------------LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEF 273
                          LG  +    +F LL+ + T  LR  + + NA K+ ++L     E 
Sbjct: 258 PLAYIAHVRVELLRDLGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYL-----ES 312

Query: 274 DKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITLR----TKEQCKVFPL-------K 319
              +  + +  L +    E  KK L  G+G V +I ++      E+   F          
Sbjct: 313 SPYVSWVSYPGLPSHSHHENAKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQVVDS 372

Query: 320 LKYFHHATSLGGIESLV------EWRAMTDPY-----IDQTLIRVSVGCESADDLIRDLA 368
           LK   +  ++G  ++LV        + ++D       + + LIR+SVG E  DD+I D  
Sbjct: 373 LKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDIIGDFE 432

Query: 369 SALKEL 374
            A +++
Sbjct: 433 QAFEKV 438

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 125/276 (45%), Gaps = 41/276 (14%)

Query: 128 LEDIERYAAEGD---IVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYA 184
           +ED+++    G+    V +E+P NP     D+    + A+  G  +++D T A   +   
Sbjct: 381 MEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDET-AGGFVNID 439

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKDEA----------VSRRLKDDRIYLGTNVA 234
               AD+V  S TK F G S+L++G LV+  +           ++++  +D ++    +A
Sbjct: 440 VLPHADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCEDALA 499

Query: 235 NLESFMLLRSLRTYELRINKQSENATKIV-KFLSDHQSEFDKVLKTIYHSSLQTEEF--- 290
                 L R+ R +  R  + + N   ++ K L   +    K+ K IY+ SL + E    
Sbjct: 500 ------LERNSRDFVQRTIQVNHNTEYLLNKVLIPLEG---KLFKKIYYPSLTSPETKRH 550

Query: 291 ---VKKQLVGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPY-- 345
              VK  +  GYG +F++T     Q +VF   L+      SLG   +L    A+   Y  
Sbjct: 551 YDAVKCSIDAGYGGLFSLTFFNLAQARVFFDSLQ-LCKGPSLGTNFTLACPYAILAHYQE 609

Query: 346 --------IDQTLIRVSVGCESADDLIRDLASALKE 373
                   ++++L+RVSVG E+ + L +    A+ E
Sbjct: 610 LDEVARYGVEKSLVRVSVGLENRESLCQVFQHAIAE 645

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 114/263 (43%), Gaps = 51/263 (19%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     +++   R A A G  +++D T        L YA     DIV  S T
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIGGLNVDILPYA-----DIVCTSLT 371

Query: 198 KYFGGHSDLLSGVLVVKDE-AVSRRLKD-------DRIYLGTNVANLESFMLLRSLRTYE 249
           K F G S+++ G +V+  + A+ +R ++       + +  G +   LE     R+ R +E
Sbjct: 372 KLFNGASNVMGGSVVLNPKSALYQRAREYFKSGEFEDLLWGEDAVVLE-----RNSRDFE 426

Query: 250 LRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFA 304
            R  + + N  K++K       E  K  K IY+ ++ ++E +      +   GGYG +F+
Sbjct: 427 DRTLRANTNTEKLLK--ELLLPEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFS 484

Query: 305 ITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQ 348
           +   ++   + F   LK F   ++            +  PY+                D 
Sbjct: 485 VAFHSEGDAEAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADS 537

Query: 349 TLIRVSVGCESADDLIRDLASAL 371
           ++IRVSVG E    L+   +SAL
Sbjct: 538 SIIRVSVGLEETQLLLDVFSSAL 560

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 117/270 (43%), Gaps = 46/270 (17%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     D+    R +   G  +I+D T A   +       ADI+  S TK F
Sbjct: 438 VFIEAPSNPLLKMGDLIELKRLSDMYGFFIIVDETIAGF-VNIDAIIHADIICSSLTKVF 496

Query: 201 GGHSDLLSGVLVVKDEA----VSRRL------------KDDRIYLGTNVANLESFMLLRS 244
            G S++++G +V+   +     ++R              +D +YL  N          R 
Sbjct: 497 TGDSNVIAGSMVLNPMSKIYDFAKRFLSFPDGFEDCLWCEDILYLEKNS---------RD 547

Query: 245 LRTYELRINKQSENATKIV--KFLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLV 296
             +   RIN  +E     V   ++   ++   K+ K IY+ +  ++E       +K +  
Sbjct: 548 FLSKTTRINNTTEYLVNTVLSPYVGKKEAN-GKLFKKIYYPTTTSKETKMCYDAIKCKTY 606

Query: 297 GGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLV----------EWRAMTDPYI 346
           GGYG VF+IT    E+ K+F   LK      SLG   + V          E   +++  +
Sbjct: 607 GGYGGVFSITFHDIEKAKLFFNNLK-LSKTISLGSNYTTVCPYTVLKHGDELEKVSEYGL 665

Query: 347 DQTLIRVSVGCESADDLIRDLASALKELQD 376
           D+TLIRV VG E+   L  + + A+++  +
Sbjct: 666 DETLIRVCVGLENKTSLKENFSRAIEKTMN 695

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 96/405 (23%), Positives = 161/405 (39%), Gaps = 66/405 (16%)

Query: 24  PINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNSTRLESVFSDILDGYAVVYS 83
           P NV +    DDD L      E +  M +    S   +  +  L+   +   D Y  ++ 
Sbjct: 242 PFNVGSGEALDDDQLNSDIPAETITSMGESGSNSTFENTATDDLKFHVNPNTDVY--LFP 299

Query: 84  SGLAAFFAA---------------------MVHYNP---KKIFIGQSYHGVRAIANILTR 119
           SG+A+ F A                     ++ Y P   K +  G  Y    +I      
Sbjct: 300 SGMASIFTAHRLLLNFDAKRLSRSSSRQDKLIGYGPPFKKTVMFGFPYTDTLSILRKFNH 359

Query: 120 NYDIKQ------HPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILD 173
            + + Q      + L++I     +   V +E+P NP     D++   R +      +++D
Sbjct: 360 THFLGQGDSTSMNALKNILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVD 419

Query: 174 STFAS----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKD-----EAVSRRLKD 224
            T         L YA     DIV  S TK F G S++++G LV+       E   + +K 
Sbjct: 420 ETVGGFVNIDVLPYA-----DIVCSSLTKIFSGDSNVIAGSLVLNPRGKIYEFARKFMKT 474

Query: 225 DRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSS 284
           +  Y    +   ++  L R+ R +  R  K + N   ++K +   Q    K+ K IY+ S
Sbjct: 475 EDGYEDC-LWCEDALCLERNSRDFVERTIKVNTNTDILLKRVLLPQ--VGKLFKKIYYPS 531

Query: 285 LQTEEF------VKKQLVGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEW 338
           L +E+       V     GGYG +F++T    E+ K F   L+      SLG   +L   
Sbjct: 532 LTSEDTKRNYDSVMSTKDGGYGGLFSLTFFNIEEAKKFFNNLE-LCKGPSLGTNFTLACP 590

Query: 339 RAMTDPY----------IDQTLIRVSVGCESADDLIRDLASALKE 373
            A+   Y          ++  L+RVSVG E++D L      A+++
Sbjct: 591 YAIIAHYQELDEVAQYGVETNLVRVSVGLENSDVLCNVFQRAIEK 635

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 113/257 (43%), Gaps = 32/257 (12%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D++   R +      +++D T         L YA     DIV  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 197 TKYFGGHSDLLSGVLVVKDEA----VSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRI 252
           TK F G S++++G LV+  +      +R+           +   ++  L R+ R +  R 
Sbjct: 442 TKIFSGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERT 501

Query: 253 NKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVGGYGPVFAIT 306
            K + N   ++  +   Q    K+ K IY+ SL +EE       V     GGYG +F++T
Sbjct: 502 IKVNTNTNILLTKVLLPQ--VGKLFKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSLT 559

Query: 307 LRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVSVG 356
             + E+ K F   L+      SLG   +L    A+   Y          +++ L+RVSVG
Sbjct: 560 FFSIEEAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVG 618

Query: 357 CESADDLIRDLASALKE 373
            E++D L +    A+++
Sbjct: 619 LENSDVLCKVFQRAIEK 635

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 120/315 (38%), Gaps = 81/315 (25%)

Query: 129 EDIER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS-----PPLQ 182
           ED E+ +      V+LE+  NP     D +     AH  G  +++D+TF +      P++
Sbjct: 138 EDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAHKHGIPVVVDNTFGAGGFFAQPIK 197

Query: 183 YAWNFGADIVLYSATKYF----------------------------------GGHSDLLS 208
           Y    GADIV +SATK+                                   G H  + +
Sbjct: 198 Y----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSIPSEGYHGMIFN 253

Query: 209 ---GVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQSENATKIVKF 265
              G L       +  L+D    LG  +    +F LL+ + T  LR  +  ENA K+  +
Sbjct: 254 DAFGPLAFIGHVRTELLRD----LGPALNPFAAFQLLQGVETLSLRAERHGENALKLAAW 309

Query: 266 LSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLR----TKEQCKVFPL--- 318
           L   QS +   +      S    E  KK L  G+G V +   +      E     P    
Sbjct: 310 LE--QSPYVSWVSYPGLPSHSHHENAKKYLTNGFGGVLSFGAKDLPNNAEAEAKNPFAAA 367

Query: 319 ------KLKYFHHATSLGGIESLV-------------EWRAMTDPYIDQTLIRVSVGCES 359
                  LK   +  ++G  ++LV             E +A +   + + LIRVSVG E 
Sbjct: 368 GAKVVDNLKLASNLANVGDCKTLVIAPYFTTHLQLTHEEKASSG--VTKDLIRVSVGTEF 425

Query: 360 ADDLIRDLASALKEL 374
            DD+I D   + +++
Sbjct: 426 IDDIINDFQQSFEQV 440

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 110/259 (42%), Gaps = 40/259 (15%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D++   R +      +++D T         L YA     DIV  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 197 TKYFGGHSDLLSGVLVVKDEA----VSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRI 252
           TK F G S++++G LV+         +R+           +   ++  L R+ R +  R 
Sbjct: 442 TKIFSGDSNVIAGSLVLNPRGKIYEFARKFMSTEDGYEDCLWCEDALCLERNSRDFVERT 501

Query: 253 NKQSENA----TKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKK------QLVGGYGPV 302
            K + N     TK++        +  K+ K IY+ SL +EE  K          GGYG +
Sbjct: 502 IKVNTNTDVLLTKVL------LPQVGKLFKKIYYPSLTSEETKKNYDNVMSTKDGGYGGL 555

Query: 303 FAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIR 352
           F++T    E+ K F   L+      SLG   +L    A+   Y          +++ L+R
Sbjct: 556 FSLTFFNIERAKKFFNSLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVR 614

Query: 353 VSVGCESADDLIRDLASAL 371
           VSVG E++D L +    A+
Sbjct: 615 VSVGLENSDVLCKVFQQAI 633

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 117/268 (43%), Gaps = 41/268 (15%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E P NP     D++     A+  G  +++D T           F ADIV  S ++ F
Sbjct: 456 VFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNIDVLPF-ADIVCSSLSQSF 514

Query: 201 GGHSDLLSGVLVVKDEAVSRRLKDDRIYLG------TNVANLESFMLLRSLRTY---ELR 251
           GG S++++G +V+  +   +  +  +++L         V   ++ +L R+ R +    + 
Sbjct: 515 GGDSNVMAGSMVLNPQ--EKLYQFAQLFLNQLGEYENYVWCEDAIILERNSRDFIPRSIT 572

Query: 252 INKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE---------------FVKKQLV 296
           IN  SE     V   ++     DK+ K IY+ SL ++E               F K++  
Sbjct: 573 INHNSEYLINEVLLPNEGP---DKIFKKIYYPSLTSDETKENYDKLRCKKIPNFEKEE-- 627

Query: 297 GGYGPVFAITLRTKEQCKVF--------PLKLKYFHHATSLGGIESLVEWRAMTDPY-ID 347
           GGYG + ++T    +  K F           L   H       I S  +  A  + + ++
Sbjct: 628 GGYGGIISLTFHNLDTSKRFFDEINITKGPSLSTNHTLACPYTILSYFDNLAQVEKFGVE 687

Query: 348 QTLIRVSVGCESADDLIRDLASALKELQ 375
           + LIR+ +GCES +DL +    A+++ Q
Sbjct: 688 ENLIRIKIGCESKEDLAKVFLHAIEKAQ 715

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 111/254 (43%), Gaps = 28/254 (11%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     ++    R +   G  +I+D T           F ADIV  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 201 GGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANL----ESFMLLRSLRTY---ELRIN 253
            G S+++ G +V+  ++         + L     +L    ++  L R+ R +    +RIN
Sbjct: 504 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 563

Query: 254 KQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITL 307
             +E    + K L  H  E + + K IY+ SL ++E       V+ +  GGYG +F++T 
Sbjct: 564 YSTEYL--LDKILKAHVGE-NGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLFSLTF 620

Query: 308 RTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVSVGC 357
             ++    F   L+  +   SLG   +L     +   Y          +++ L+R+SVG 
Sbjct: 621 HDEDHAAAFYNNLQ-LNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRISVGL 679

Query: 358 ESADDLIRDLASAL 371
           ES   L +    A+
Sbjct: 680 ESQSTLGKIFQEAI 693

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 105/253 (41%), Gaps = 25/253 (9%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     D+    R A   G  +++D T A   +       AD+V  S TK F
Sbjct: 419 VFMETPSNPLLKMGDLLELKRLADIYGFYVVVDET-AGGFVNIDVLPHADLVCSSLTKIF 477

Query: 201 GGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANL---ESFMLLRSLRTYELRINKQSE 257
            G S++++G LV+   +       +    G     L   ++  L R+ R +  R  K + 
Sbjct: 478 SGDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCLWCEDAIYLERNSRDFVTRTLKVNS 537

Query: 258 NATKIVK--FLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITLRT 309
           NA  ++    + +    F K    IY+  L +EE       V+ +  GGYG +F++T   
Sbjct: 538 NAEMLLNDVLIPEEGHLFSK----IYYPRLTSEETKQNYDTVRCKPNGGYGGLFSLTFYE 593

Query: 310 KEQCKVF---------PLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
            EQ K F         P     F  A     +    E   +    ++  L+RVSVG E A
Sbjct: 594 IEQAKKFFNALELCKGPSLGTNFTLACPYAVLAHYAELEKVAQYGVEANLVRVSVGLEDA 653

Query: 361 DDLIRDLASALKE 373
           + L +    A+ E
Sbjct: 654 EHLRKVFREAISE 666

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 103/425 (24%), Positives = 169/425 (39%), Gaps = 90/425 (21%)

Query: 22  APPINVSTTFRYDDDDLIPWTERENLDFMEKRP--VYSRLAHPNSTRLESVFSDILDGYA 79
           A PI  +T++ ++D      ++     F  + P  +YSR+ +P    LE   + +  G A
Sbjct: 25  AVPIYATTSYVFND------SKHGAQLFGLETPGYIYSRIMNPTLDVLEKRLAALEGGIA 78

Query: 80  VV-YSSGLAA---FFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYDIKQHPL-----ED 130
            +  SSG AA       + H     +     Y G      +  +   I+   +     ED
Sbjct: 79  ALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVDGDKPED 138

Query: 131 IER-YAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS-----PPLQYA 184
            E+ +  +   ++LES  NP     D E     AH  G  +++D+TF +      P++Y 
Sbjct: 139 FEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPIKY- 197

Query: 185 WNFGADIVLYSATKYFGGHSDLL------SGVLVVKD--EAVSRRLKDDRIY-------- 228
              GADIV +SATK+ GGH   +      SG    KD  E   +  +    Y        
Sbjct: 198 ---GADIVTHSATKWIGGHGVTVGGVIIDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDA 254

Query: 229 -----------------LGTNVANLESFMLLRSLRTYELRINKQSENATKIVKFLSDHQS 271
                            LG  ++    F+LL+ L T  LR  +   NA K+ ++L     
Sbjct: 255 FGPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLETLSLRGERHGSNALKLAQYL----- 309

Query: 272 EFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITLR----TKEQCKVFPL------ 318
           E    +  + +  L +    E  KK L  G+G V +  ++      E+   F        
Sbjct: 310 ESSPYVSWVSYPGLPSHSHHENAKKYLENGFGGVLSFGVKDLPNASEESDPFKASGAQVV 369

Query: 319 -KLKYFHHATSLGGIESLV------EWRAMTD-----PYIDQTLIRVSVGCESADDLIRD 366
             LK   +  ++G  ++LV        + +TD       + + LIRVSVG E  DD+I D
Sbjct: 370 DNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEFIDDIIAD 429

Query: 367 LASAL 371
             ++ 
Sbjct: 430 FEASF 434

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 116/256 (45%), Gaps = 28/256 (10%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     ++    R +   G  +I+D T           F AD+V  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 201 GGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANL----ESFMLLRSLRTY---ELRIN 253
            G S+++ G +V+  ++         + L     +L    ++  L R+ R +    +RIN
Sbjct: 493 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 552

Query: 254 KQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITL 307
             +E    + K +  H  E + + K IY+ +L ++E       V+ +  GGYG +F++T 
Sbjct: 553 YNTEYL--LDKIIKPHVGE-NALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTF 609

Query: 308 RTKEQCKVFPLKLKYFHHATSLGGIESLV---------EWRAMTDPY-IDQTLIRVSVGC 357
             ++  + F   L+  +   SLG   +LV            AM + + +++ L+R+SVG 
Sbjct: 610 HDEDHAEAFYDNLQ-LNKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRISVGL 668

Query: 358 ESADDLIRDLASALKE 373
           E+   L +    A+ +
Sbjct: 669 ENQLTLGKIFQKAIDQ 684

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 114/263 (43%), Gaps = 46/263 (17%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     ++    R +   G  +I+D T           F ADIV  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGVLVVKDEA-----VSR--RLKD---------DRIYLGTNVANLESFMLLRS 244
            G S+++ G +V+  ++      +R  RL+D         D IYL  N          R 
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFATRFMRLEDEYEDLLWCEDAIYLERNS---------RD 504

Query: 245 LRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGG 298
                +RIN  +E    + K L  H    +++ K IY+ +L ++E       V+ +  GG
Sbjct: 505 FIARTVRINYSTEYL--LDKILKPHVGG-NELFKKIYYPNLTSKETLTNYDMVRCKKEGG 561

Query: 299 YGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLV---------EWRAMTDPY-IDQ 348
           YG +F++T   +     F   L+  +   SLG   +L          +  AM + + +++
Sbjct: 562 YGGLFSLTFHDEHHAAAFYDNLQ-LNKGPSLGTNFTLAFPYTLMTYYQELAMAEKFGVER 620

Query: 349 TLIRVSVGCESADDLIRDLASAL 371
            L+R+SVG ES   L +    A+
Sbjct: 621 NLLRISVGLESQSTLGKIFQEAI 643

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 108/262 (41%), Gaps = 49/262 (18%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     D++     A   G  +++D T        L YA     DIV  S T
Sbjct: 321 VFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGGLNVDILPYA-----DIVSTSLT 375

Query: 198 KYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM-------LLRSLRTYEL 250
           K F G S+++ G +V+  +  S      R Y  +  AN E  +       L R+ R +E 
Sbjct: 376 KLFNGASNVMGGSVVLNPK--SSLYPYAREYFRS--ANFEDLLWCEDAIVLERNSRDFED 431

Query: 251 RINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAI 305
           R  + + N   ++  L     E  K+ K IY+ ++ ++E  +     +   GGYG +F++
Sbjct: 432 RTLRANANTGILLNDL--LLPEEGKICKKIYYPTVTSKETFENYESVRNERGGYGCLFSV 489

Query: 306 TLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQT 349
               +   K F   LK F   ++            +  PY+                D  
Sbjct: 490 AFFNEGDAKAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADPN 542

Query: 350 LIRVSVGCESADDLIRDLASAL 371
           +IRVSVG E    L++  +SAL
Sbjct: 543 IIRVSVGLEDIQWLLKVFSSAL 564

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 135/316 (42%), Gaps = 33/316 (10%)

Query: 87  AAFFAAMVHYNP---KKIFIGQSYHGVRAIANILTRNY---DIKQHPLEDIERYAAEGD- 139
           AA  A +V Y P   K +  G  Y    +I       +   D  +  +E ++     G+ 
Sbjct: 338 AAGSADVVGYGPPYKKTVMFGFPYTDTLSILRKFNHTHFLGDGDEKSMEQLKEILHSGEQ 397

Query: 140 --IVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSAT 197
              V +E+P NP     ++      A A G  +++D T A   +       AD+V  S T
Sbjct: 398 ILAVFMEAPSNPLLKMGNLIELRELADAYGFYVVIDET-AGGFVNIDVLPHADMVCSSLT 456

Query: 198 KYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLG--TNVANLESFMLL-RSLRTYELRINK 254
           K F G S++++G LV+  ++          + G   ++   E  + L R+ R +  R   
Sbjct: 457 KIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEFEDLLWCEDVIYLERNSRDFVTRTLT 516

Query: 255 QSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLV-----GGYGPVFAITLRT 309
            ++N  ++++ +   Q +  K+ K I++ SL + E  +         GGYG +F++T   
Sbjct: 517 VNKNTAQLLEEVLIPQEK--KLFKKIFYPSLTSPETKRNYDAILCPKGGYGGLFSLTFYN 574

Query: 310 KEQCKVF---------PLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           ++Q +VF         P     F  A     +    E   +    ++++L+RVSVG ES 
Sbjct: 575 EKQARVFFDTLELCKGPSLGTNFTLACPYAILAHYTELEEVAKFGVERSLVRVSVGLESP 634

Query: 361 DDL----IRDLASALK 372
             L     R +A ALK
Sbjct: 635 QVLNAVFSRAIAEALK 650

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 104/270 (38%), Gaps = 65/270 (24%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     D++   R A A G  +++D T        L Y     ADIV  S T
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIGGLNVDVLPY-----ADIVCTSLT 372

Query: 198 KYFGGHSDLLSGVLVVKDEAV----------SRRLKD-----DRIYLGTNVANLESFMLL 242
           K F G S+ + G +++  ++           S   +D     D + L  N          
Sbjct: 373 KLFNGSSNAMGGSIILNPKSSLYSSACEYFKSAEFEDLLWCEDAVVLEANS--------- 423

Query: 243 RSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEE-FVKKQLV----G 297
           R  +   LR N  +E     V        E  K+ K IY+ ++ ++E F   + V    G
Sbjct: 424 RDFQDRTLRANINTEKLLNEVLL-----PEEGKICKKIYYPTVSSKETFNNYESVRNKHG 478

Query: 298 GYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------- 346
           GYG +F++    +   K F   LK F   ++            +  PY+           
Sbjct: 479 GYGCLFSMAFYNEGDAKTFYDTLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEV 531

Query: 347 -----DQTLIRVSVGCESADDLIRDLASAL 371
                D  LIRVSVG E    L+   +SA+
Sbjct: 532 SKFGADPNLIRVSVGLEDTQTLLDVFSSAI 561

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 100/247 (40%), Gaps = 33/247 (13%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS----PPLQYAWNFGADIVLYSA 196
           V LE+P NP     D+    + +   G  +++D T +       L Y      DIV  S 
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSYC-----DIVCSSL 372

Query: 197 TKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQS 256
           TK F G S++++G LVV     + +L D  I    +    E  +        E       
Sbjct: 373 TKIFSGDSNVIAGSLVVNP---ASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFI 429

Query: 257 ENATKIVKFLSDHQSEFDKVLKT-----IYHSSLQTEEF-----VKKQLVGGYGPVFAIT 306
           + A KI K   D  S      +      IY+ SL + E        K   GGYG + +I 
Sbjct: 430 DRAQKINKIAEDLVSTVLLEEEGQLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGLISIV 489

Query: 307 LRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYID----------QTLIRVSVG 356
            + ++Q KVF   L   +   SLG   +LV   A+   Y +          + L+R+SVG
Sbjct: 490 FKREDQAKVFYDNLS-LNKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVG 548

Query: 357 CESADDL 363
            ES + L
Sbjct: 549 LESLETL 555

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 125/300 (41%), Gaps = 35/300 (11%)

Query: 95  HYNPKKIFIGQSYHGVRAIANILTRNYDIKQHPLEDIERYAAEGDIVH---------LES 145
            ++ K + +G   H    +   L+++Y I ++  + + +     +I+H          E+
Sbjct: 342 QHSKKTVVLGVPCHDTYEMVTTLSKSYFIPENGTDGLSKLK---EILHSGEQILAVITET 398

Query: 146 PVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLYSATKYFGGHSD 205
           P N      ++    + +   G  +++D +        A  +  DIV  S  K F G  D
Sbjct: 399 PTNGLLDVTNLVELKQLSELFGFYIVVDESVGGFVNVDALVY-CDIVCSSLVKMFSGTED 457

Query: 206 LLSGVLVVKDEA---------VSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINKQS 256
           ++SG +VV  ++         ++   +   +    ++  LE     R   +   RIN  +
Sbjct: 458 VVSGSMVVNPQSKLYDFAQTFMASEHEPSSVLWCEDIIQLEQNS--RDFVSKSKRINTAT 515

Query: 257 ENATKIVKFLSDHQSEFDKVLKTIYHSSLQTE---EFVKKQLVGGYGPVFAITLRTKEQC 313
           +   + V  L    + F +V    +H S+        +K +  GGYG VFA+   T E+ 
Sbjct: 516 KRLLRDV-ILPQRGTIFTEV----HHPSITDRAQYNLIKGKQDGGYGGVFAVQFSTLERA 570

Query: 314 KVFPLKLKYFHHATSLGGIESLVEWRAMTDPY--IDQTLIRVSVGCESADDLIRDLASAL 371
           + F  +L        LGG  ++     + + Y  +D+TLIRVSVG E  D L R    A+
Sbjct: 571 RSFYDRLNVCK-GPGLGGDYTVACPWQLLNQYDEVDKTLIRVSVGLEDYDVLKRAFEEAI 629

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 108/257 (42%), Gaps = 32/257 (12%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +ESP NP     D+    R +   G  +++D T         L YA     D+V  S 
Sbjct: 431 VFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNIDVLPYA-----DVVCSSL 485

Query: 197 TKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTN-----VANLESFMLLRSLRTYELR 251
           TK F G S++++G +V+   +         ++L        +   ++  L R+ R +  R
Sbjct: 486 TKIFSGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLLWCEDAICLERNSRDFISR 545

Query: 252 INKQSENATKIV-KFLSDHQSE---FDKVLKTIYHSSLQTEEF--VKKQLVG-GYGPVFA 304
               +EN   ++ K +   Q E   F KV    Y ++   + +  VK +  G GYG +F+
Sbjct: 546 SILVNENTESLLEKVILPQQGEGKLFKKVFYPKYTNAETKKNYDQVKAKTAGSGYGGLFS 605

Query: 305 ITLRTKEQCKVFPLKLKYFHHATSLGGIESLV----------EWRAMTDPYIDQTLIRVS 354
           +T    EQ K+F   L       SLG   +L           E   +    ++  L+RVS
Sbjct: 606 VTFYNIEQAKMFFNSLN-LCKGPSLGTNFTLACPYTVLAHYQEMEEVAKFGLEDNLVRVS 664

Query: 355 VGCESADDLIRDLASAL 371
           VG ES   L +   +A+
Sbjct: 665 VGLESKQHLEKVFQTAI 681

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 113/261 (43%), Gaps = 37/261 (14%)

Query: 141 VHLESPVNPYGTSYDIESFARRAHAKGALLILDST----FASPPLQYAWNFGADIVLYSA 196
           V +E+P  P     ++      ++  G ++I+D T    F    L +A     D+V  S 
Sbjct: 410 VLIEAPSTPLLKMGNLLELKELSNLFGFIIIVDETVGGFFNVDALVHA-----DVVCTSL 464

Query: 197 TKYFGGH-SDLLSGVLVVK-DEAVSRRLKD---DRIYLGTNVANLESFMLLRSLRTY--- 248
           TK F G   ++++G + +  +  +    KD   D      N+   ++ ++ R+ R +   
Sbjct: 465 TKIFSGDVGNVMAGAMALNSNSTIYNFAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAK 524

Query: 249 ELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSL------QTEEFVKKQLVGGYGPV 302
            L+IN  ++    + K L  H  E + + K IYH  L      Q  E +K +  GGYG V
Sbjct: 525 MLKINYTTD--YLLDKVLIPHIGEHN-LFKKIYHPRLTSNETKQNYEKIKCKSDGGYGGV 581

Query: 303 FAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYID----------QTLIR 352
           F+I     EQ K+F   L       SLG   +L     +   Y D          ++LIR
Sbjct: 582 FSIDFNNLEQAKLFYNCLN-VAKGPSLGTTMTLACPYTILYHYADIEKVSKYGLSESLIR 640

Query: 353 VSVGCESADDLIRDLASALKE 373
           VSVG E+   L +   +A+ E
Sbjct: 641 VSVGLENRKQLCQLFQAAIDE 661

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 91/206 (44%), Gaps = 31/206 (15%)

Query: 189 ADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM-------L 241
           ADIV  S TK F G S+++ G +V+  +  S      R Y  +  A+ E  +       L
Sbjct: 358 ADIVCTSLTKLFNGASNVMGGSIVLNPK--SSIYPYAREYFKS--ADFEDLLWCEDAVVL 413

Query: 242 LRSLRTYELRINKQSENATKIV-KFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQL 295
            R+ R +E R    + N  K++ + L   Q    K+ K +Y+ ++ +EE  +     +  
Sbjct: 414 ERNSRDFENRTLHANANTEKLLNEVLIPEQG---KLCKKVYYPTVTSEETFRNYESVRNE 470

Query: 296 VGGYGPVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLV----------EWRAMTDPY 345
            GGYG +F++    +   K F   LK F    S G   +L           E  A++   
Sbjct: 471 RGGYGCLFSVAFYNEGDAKAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEAVSKFG 529

Query: 346 IDQTLIRVSVGCESADDLIRDLASAL 371
            D  +IRVSVG E    L+   ++AL
Sbjct: 530 ADPNIIRVSVGLEDTQWLLEVFSNAL 555

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 11/67 (16%)

Query: 316 FPLKLKYFHHATSLGGIESLVEWRA-MTDPYI--DQ--------TLIRVSVGCESADDLI 364
           F    + F  A SLGGIESL+E  A MT   I  DQ         LIR+SVG E  DDL+
Sbjct: 16  FTSTTRLFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLL 75

Query: 365 RDLASAL 371
            D+ +AL
Sbjct: 76  DDIKNAL 82

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1431

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 18/112 (16%)

Query: 270 QSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLRTKEQ------------CKVFP 317
           +S + KVL+ ++ S+LQ       + V G  P F   L   EQ            C    
Sbjct: 338 ESAYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSC---- 393

Query: 318 LKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLIRDLAS 369
           L +  FH   +   +E L EW A++D  +D++   ++   E AD+L + L +
Sbjct: 394 LDVSLFHTENANRLVELLSEWLALSDEPLDES--ELNAANEVADELYKILET 443

>KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {ON}
           
          Length = 1436

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 18/112 (16%)

Query: 270 QSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLRTKEQ------------CKVFP 317
           +S + KVL+ ++ S+LQ       + V G  P F   L   EQ            C    
Sbjct: 342 ESAYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSC---- 397

Query: 318 LKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLIRDLAS 369
           L    FH   +   +E L EW A+ D  +D++   ++   E AD+L + L +
Sbjct: 398 LDASLFHTENANRLVELLSEWLALNDKPLDES--ELNAANEVADELYKILET 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,864,546
Number of extensions: 1723741
Number of successful extensions: 5385
Number of sequences better than 10.0: 120
Number of HSP's gapped: 5302
Number of HSP's successfully gapped: 139
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)