Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.2635.353ON58583053e-38
Smik_8.1495.353ON58582966e-37
YHR072W-A (NOP10)5.353ON58582932e-36
Skud_8.1325.353ON58582914e-36
SAKL0G08800g5.353ON59582853e-35
Kwal_34.159765.353ON59582845e-35
KLTH0H14894g5.353ON59582811e-34
TPHA0D020805.353ON59582783e-34
Kpol_1051.65.353ON58582766e-34
TBLA0H019605.353ON58582714e-33
TDEL0E027405.353ON58582706e-33
NCAS0H016305.353ON58582697e-33
KAFR0C018405.353ON58582698e-33
ZYRO0D10208g5.353ON64572672e-32
Ecym_81795.353ON58582653e-32
AGR354W5.353ON69562561e-30
KNAG0C054905.353ON56562514e-30
CAGL0J10802g5.353ON57562507e-30
KLLA0C16753g5.353ON57572462e-29
Suva_15.1551.374ON45253660.18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.263
         (58 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...   122   3e-38
Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   118   6e-37
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   117   2e-36
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...   116   4e-36
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   114   3e-35
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   114   5e-35
KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   112   1e-34
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   111   3e-34
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   110   6e-34
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   108   4e-33
TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   108   6e-33
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   108   7e-33
KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   108   8e-33
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   107   2e-32
Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   106   3e-32
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...   103   1e-30
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   101   4e-30
CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   100   7e-30
KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...    99   2e-29
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    30   0.18 

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  122 bits (305), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  118 bits (296), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  117 bits (293), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/58 (96%), Positives = 57/58 (98%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  116 bits (291), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 56/58 (96%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTL K TETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  114 bits (285), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKKNTE GEITKSAHPARFSPDDKYSRQRVTLKKRF ++PG+
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLPGK 58

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  114 bits (284), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  112 bits (281), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  111 bits (278), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRF L+P Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLPNQ 58

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score =  110 bits (276), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKR+YTLKK TE GEITKSAHPARFSPDDK+SRQRVTLKKRFGL+P Q
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLPTQ 58

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (271), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTL  DGKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+PGQ
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPGQ 58

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (270), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P +
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (269), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLG DGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+P Q
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPTQ 58

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (269), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTL  DGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+PGQ
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  107 bits (267), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 50/57 (87%), Positives = 54/57 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57
          MHLMYTLGPDGKR YTL+K TE GEITKSAHPARFSPDDKYSRQRVTLK+R+GL+PG
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLPG 57

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  106 bits (265), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKRF ++P Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score =  103 bits (256), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 53/56 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56
          MHLMYTLGPDGKR+YTL+K T +GEITKSAHPARFSPDDKYSRQRVTLK+RF ++P
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 68

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score =  101 bits (251), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 51/56 (91%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56
          MHLMYTL  +GKRIYTLKK T  GEITKSAHPARFSPDDKYSRQRVTLKKRFG++P
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  100 bits (250), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 51/56 (91%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56
          MHLMYTL  +GKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score = 99.4 bits (246), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (85%)

Query: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57
          MHLMYTL   GKRIYTLKK TE  EITKSAHPARFSPDDKYSRQRVTLKKR+ L+P 
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score = 30.0 bits (66), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 9/53 (16%)

Query: 4   MYTLGPDGKRIYTLKKNTETGE----ITKSAHPARFSPDDK---YSRQRVTLK 49
           MY LG DG     +++N+ TG     IT+S H  RF P  K    S++++ LK
Sbjct: 352 MYLLGDDGDN--DIEENSPTGSCLDGITRSLHDLRFQPQKKVVELSKEQMKLK 402

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,366,160
Number of extensions: 193799
Number of successful extensions: 575
Number of sequences better than 10.0: 21
Number of HSP's gapped: 575
Number of HSP's successfully gapped: 21
Length of query: 58
Length of database: 53,481,399
Length adjustment: 31
Effective length of query: 27
Effective length of database: 49,926,753
Effective search space: 1348022331
Effective search space used: 1348022331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)