Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1826.21ON34634615000.0
YOR007C (SGT2)6.21ON34634613490.0
Smik_15.1766.21ON34534513370.0
Skud_15.1686.21ON34834813190.0
SAKL0E01210g6.21ON3233299311e-125
CAGL0E02739g6.21ON3433239061e-121
TDEL0G044806.21ON3433408971e-119
Kwal_56.224336.21ON3223308811e-117
ZYRO0C07788g6.21ON3343238801e-117
TPHA0J003406.21ON3383458711e-115
Kpol_1037.266.21ON3423348621e-114
KNAG0M011706.21ON3393378321e-109
NCAS0H008306.21ON3383428271e-109
NDAI0D008106.21ON3493508271e-109
KAFR0L004106.21ON3313357991e-105
KLTH0C11220g6.21ON3273317951e-104
Ecym_30256.21ON3183307751e-101
TBLA0G010506.21ON3503327691e-100
KLLA0D01155g6.21ON3353487591e-98
ACR005W6.21ON3273406693e-85
Kpol_1032.86.21ON3433535201e-62
TPHA0M002706.21ON3773603633e-39
NDAI0I022406.21ON3502213588e-39
NCAS0D026706.21ON3512303441e-36
TBLA0A072706.21ON3733353162e-32
CAGL0H08195g5.617ON5831132216e-19
TPHA0D028805.617ON5852482153e-18
NDAI0F009105.617ON583972119e-18
KNAG0B032005.617ON5792252092e-17
SAKL0G07084g5.617ON5851172074e-17
Smik_15.2055.617ON5891172055e-17
Kpol_1018.695.617ON590972047e-17
NCAS0G008105.617ON5842232031e-16
Kwal_55.199355.617ON5932252022e-16
ZYRO0A05676g5.617ON5722232012e-16
YOR027W (STI1)5.617ON589972003e-16
TBLA0E033005.617ON582971994e-16
AEL224W5.617ON5801171976e-16
KLTH0E02178g5.617ON593971968e-16
KAFR0C058905.617ON575981932e-15
Skud_15.1925.617ON5891171932e-15
KLLA0A07062g5.617ON581971906e-15
TDEL0A048405.617ON5761271881e-14
Suva_8.805.617ON5861171871e-14
NCAS0A00490singletonON620871801e-13
Ecym_55825.617ON584971763e-13
Smik_6.2153.481ON513681497e-10
YGR123C (PPT1)3.481ON513681489e-10
Ecym_44133.481ON510721471e-09
Skud_7.4323.481ON513681462e-09
Suva_7.4083.481ON513681443e-09
TBLA0C039503.481ON5121141408e-09
KNAG0A079003.481ON512721391e-08
NDAI0B057903.481ON523731372e-08
KAFR0B066103.481ON5111081354e-08
CAGL0D05060g3.481ON510721344e-08
TPHA0D032203.481ON5131371329e-08
NCAS0F034903.481ON512981311e-07
SAKL0F03102g3.481ON513721311e-07
TDEL0D055003.481ON512721273e-07
Kpol_505.413.481ON513721231e-06
KAFR0E029808.506ON3801311221e-06
AAR083C3.481ON538731231e-06
KLTH0F14542g3.481ON5131381194e-06
Kwal_55.211753.481ON511831194e-06
KNAG0A039508.506ON3861011141e-05
CAGL0H07425g8.506ON380891132e-05
Kwal_33.147672.152ON594831142e-05
NCAS0B024008.506ON380891132e-05
KLLA0F24046g2.152ON604681132e-05
TBLA0H033808.506ON3751311122e-05
Kpol_513.28.506ON3741021113e-05
KLLA0B10912g3.481ON512681113e-05
KLTH0B05170g2.152ON593681096e-05
Smik_2.2958.506ON385861086e-05
SAKL0H10934g8.506ON3801011078e-05
ZYRO0B04224g3.481ON5131001089e-05
NCAS0B070102.152ON6251011071e-04
Kwal_27.118908.506ON3341171051e-04
NCAS0G024802.152ON596771062e-04
Kpol_1018.1067.412ON753961052e-04
KLLA0B09966g8.506ON3701271042e-04
TDEL0B013108.506ON3801001023e-04
YBR155W (CNS1)8.506ON385861024e-04
TPHA0L014208.506ON3741311014e-04
Kpol_1043.605.689ON706971024e-04
Suva_4.4058.506ON385861006e-04
CAGL0K09240g6.328ON14256957e-04
NDAI0F028102.152ON609771007e-04
Ecym_82042.152ON597831008e-04
KAFR0F007202.152ON60868990.001
ADR230W5.689ON68570980.001
NCAS0I008703.395ON58563970.002
TPHA0E007407.412ON74697980.002
Suva_2.347.412ON76397970.002
AGL268C8.506ON379100960.002
YBL084C (CDC27)7.412ON75897970.002
ABR131W2.152ON59483960.002
Skud_2.2828.506ON38586960.002
Smik_2.367.412ON75197960.002
TBLA0C055302.152ON610101960.002
TBLA0I023106.328ON11658890.003
Skud_8.1782.152ON63895950.003
Ecym_25598.506ON37086940.004
ZYRO0B03828g7.412ON72796940.004
TPHA0D038606.328ON12061870.005
TDEL0B051402.152ON599101930.006
CAGL0C01903g7.412ON76997920.007
KLTH0E11748g8.506ON378115910.007
YNL121C (TOM70)2.152ON61795920.007
TBLA0F032203.395ON53663910.009
Suva_15.3142.152ON64495910.011
KNAG0I025206.328ON11756840.013
NDAI0B043402.152ON66495890.016
Ecym_20906.328ON17258850.019
ZYRO0G06512g2.152ON604101880.020
CAGL0L04048g2.152ON58762880.022
Skud_14.2112.152ON61795880.024
YHR117W (TOM71)2.152ON63995870.029
Ecym_40315.689ON688107870.029
Smik_8.1952.152ON63595870.030
Smik_14.2072.152ON61795870.030
Kpol_1048.212.152ON59768870.030
Suva_14.2192.152ON61795860.035
Skud_2.247.412ON76997870.035
KLLA0C15455g8.470ON566123860.039
KLLA0E20857g7.412ON71087860.041
YCR060W (TAH1)6.328ON11156800.041
KNAG0H035302.152ON61462860.042
NCAS0E024907.412ON80996860.043
SAKL0E10956g2.152ON60083850.048
SAKL0E14542g5.689ON69053840.072
AGL294W7.412ON65696830.094
Ecym_71427.412ON67596820.11
CAGL0J09570g8.470ON54981820.11
CAGL0K11209g8.470ON59092820.11
TDEL0C027207.412ON70096820.12
TPHA0L012108.470ON58891820.13
Kpol_1006.43.367ON732125810.15
ACR173W7.458ON285109800.15
NCAS0B025608.470ON57881790.28
SAKL0A01672g6.328ON12849750.29
TPHA0G004305.689ON72856790.30
NDAI0A081703.395ON53966780.36
NCAS0D045006.328ON12164730.42
Smik_4.4918.470ON61250770.44
NDAI0C051308.470ON59055770.45
TDEL0A074306.328ON12458730.45
Skud_4.5068.470ON61150770.48
Suva_2.4108.470ON61150770.51
KAFR0J025706.328ON12156720.53
KNAG0B022407.412ON73998770.57
Smik_3.1596.328ON11555720.57
YDR244W (PEX5)8.470ON61250760.60
NDAI0F004005.689ON76469760.62
Kpol_1031.648.470ON60791760.62
TDEL0B016608.470ON54949760.65
NDAI0C043205.352ON70664760.66
Ecym_13968.470ON573120760.69
KLTH0A00638g7.546ON141166760.71
Suva_16.4173.395ON53964750.78
KLLA0E08009g2.665ON72164750.79
NCAS0F028705.352ON70064750.86
SAKL0H11946g8.470ON573119740.97
Kwal_27.117378.470ON575117741.0
Kwal_27.107407.412ON62894741.0
KAFR0L018707.412ON71289741.1
ZYRO0C17138g3.395ON53626741.2
AAR054C6.328ON13358701.2
Kpol_1028.516.328ON11755691.3
KLLA0C08910g6.328ON11549691.4
CAGL0E01573g3.32ON90497731.4
TBLA0A016908.470ON66250731.6
TBLA0H019705.352ON84072731.7
AFR453W8.470ON56990721.8
SAKL0F12936g7.412ON63296721.9
ZYRO0C02970g3.32ON896100722.0
Skud_3.1356.328ON11856682.1
NDAI0J001307.546ON140349722.1
ACR168W2.665ON70764722.2
Kwal_55.220393.32ON90498722.2
Suva_16.5217.546ON142456722.4
KLTH0E10934g8.470ON56863712.4
CAGL0M08030g1.456ON38764712.6
KAFR0C018505.352ON64664712.8
KLTH0F18150g5.689ON68973713.0
Ecym_56372.665ON71764713.0
KNAG0B012903.395ON53763703.5
Kwal_55.218395.689ON690100703.8
Smik_14.53.11ON108477704.2
CAGL0K07986g3.395ON53265694.6
TDEL0B023305.689ON70254694.7
KLTH0C06204g7.412ON627102685.2
YPR189W (SKI3)7.546ON143255695.2
KLTH0F19140g3.32ON92494695.3
TDEL0E027505.352ON564141685.5
YKL022C (CDC16)2.665ON84066685.9
Skud_16.4937.546ON142556687.1
Smik_16.4537.546ON141755687.3
TPHA0I015102.152ON60369678.7
CAGL0H07095g5.352ON661110669.5
KAFR0E028208.470ON56266669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.182
         (346 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   582   0.0  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   524   0.0  
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   519   0.0  
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   512   0.0  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   363   e-125
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   353   e-121
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   350   e-119
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   343   e-117
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   343   e-117
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   340   e-115
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   336   e-114
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   325   e-109
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   323   e-109
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   323   e-109
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   312   e-105
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   310   e-104
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   303   e-101
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   300   e-100
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   296   1e-98
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   262   3e-85
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   204   1e-62
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   144   3e-39
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   142   8e-39
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   137   1e-36
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   126   2e-32
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    90   6e-19
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    87   3e-18
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     86   9e-18
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    85   2e-17
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    84   4e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    84   5e-17
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    83   7e-17
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    83   1e-16
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    82   2e-16
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    82   2e-16
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    82   3e-16
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    81   4e-16
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    80   6e-16
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    80   8e-16
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    79   2e-15
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    79   2e-15
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    78   6e-15
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    77   1e-14
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    77   1e-14
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       74   1e-13
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    72   3e-13
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    62   7e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    62   9e-10
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    61   1e-09
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    61   2e-09
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    60   3e-09
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    59   8e-09
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    58   1e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    57   2e-08
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    57   4e-08
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    56   4e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    55   9e-08
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    55   1e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    55   1e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    54   3e-07
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    52   1e-06
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    52   1e-06
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    52   1e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    50   4e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    50   4e-06
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    49   1e-05
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    48   2e-05
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    49   2e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    48   2e-05
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    48   2e-05
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    48   2e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    47   3e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    47   3e-05
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    47   6e-05
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    46   6e-05
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    46   8e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    46   9e-05
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    46   1e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    45   1e-04
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    45   2e-04
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    45   2e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    45   2e-04
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    44   3e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    44   4e-04
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    44   4e-04
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    44   4e-04
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    43   6e-04
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    41   7e-04
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    43   7e-04
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    43   8e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    43   0.001
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    42   0.001
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    42   0.002
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    42   0.002
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    42   0.002
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    42   0.002
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    42   0.002
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    42   0.002
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.002
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    42   0.002
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    42   0.002
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    39   0.003
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    41   0.003
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    41   0.004
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    41   0.004
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    38   0.005
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    40   0.006
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    40   0.007
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    40   0.007
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    40   0.007
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    40   0.009
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    40   0.011
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    37   0.013
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    39   0.016
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    37   0.019
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    39   0.020
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    39   0.022
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    39   0.024
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    38   0.029
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    38   0.029
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    38   0.030
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    38   0.030
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    38   0.030
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    38   0.035
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    38   0.035
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    38   0.039
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    38   0.041
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.041
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    38   0.042
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    38   0.043
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    37   0.048
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    37   0.072
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    37   0.094
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    36   0.11 
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    36   0.11 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    36   0.11 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    36   0.12 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    36   0.13 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    36   0.15 
ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic hom...    35   0.15 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    35   0.28 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    33   0.29 
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    35   0.30 
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    35   0.36 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.42 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    34   0.44 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    34   0.45 
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    33   0.45 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    34   0.48 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    34   0.51 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    32   0.53 
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    34   0.57 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   0.57 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    34   0.60 
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    34   0.62 
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    34   0.62 
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    34   0.65 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    34   0.66 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    34   0.69 
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    34   0.71 
Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {...    33   0.78 
KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} simila...    33   0.79 
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    33   0.86 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    33   0.97 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    33   1.0  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    33   1.0  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    33   1.1  
ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]...    33   1.2  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    32   1.2  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    31   1.3  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    31   1.4  
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    33   1.4  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    33   1.6  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    33   1.7  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    32   1.8  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   1.9  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    32   2.0  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    31   2.1  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    32   2.1  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    32   2.2  
Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL3...    32   2.2  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    32   2.4  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    32   2.4  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    32   2.6  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    32   2.8  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    32   3.0  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    32   3.0  
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    32   3.5  
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    32   3.8  
Smik_14.5 Chr14 (8441..11695) [3255 bp, 1084 aa] {ON} YNL327W (R...    32   4.2  
CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa] ...    31   4.6  
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    31   4.7  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    31   5.2  
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    31   5.2  
KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} simi...    31   5.3  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    31   5.5  
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    31   5.9  
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    31   7.1  
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    31   7.3  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    30   8.7  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    30   9.5  
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    30   9.6  

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/346 (84%), Positives = 294/346 (84%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
           KGQ          KLPESGKKDDAQNVEVNIP              IQGNKAMANKEYEL
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRD     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300
                                  MNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE
Sbjct: 241 GQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300

Query: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ 346
           GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ
Sbjct: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ 346

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/346 (75%), Positives = 279/346 (80%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MSASKEEIA+LIVNYFSSIVEKKE+SED ADSLNVAMDCISEAFGFER+AVS IL KS F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
           KGQ          ++PES KKDDA+NVE+NIP              +QGNKAMANK+YEL
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AI KYTEAI VLPTNAIYYANRAAAHSSLKEYD+A+KDAESAIS+DPSYFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           YAQGKPEEALEAYKKVLDIEGDNAT+AMKRDYESAKK+VEQSLNLEKT PEQ RD     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300
                                  MNNPQLMQAAQKMMSNPGAMQNIQ MMQDPSIRQMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ 346
           GF SGGGTPNLSDLM NPALRNMAG+LFGGA A ST++TPD+E KQ
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ 346

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/345 (75%), Positives = 274/345 (79%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M ASKEEIA+LIVNYFSSIVEKKE+SED ADSLNVAMDCISEAFGFERDA S IL KS F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
           KG+          K  ES +KDDAQNVEVNIP              +QGNKAMANK+YEL
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AI KYTEAI VLPTNAIYYANRAAAHSSL+EYDEA+KDAES+IS+DPSYFRGYSRLGFAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           YAQGKPEEALEAYKKVLDIEGDNAT+AMKRDYESAKK+VEQSLNLEK  PEQ RD     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300
                                  MNNPQLMQAAQKMMSNPGAMQNIQ MMQDPSIRQMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETK 345
           GFTSGGG PNLSDLM NPALRNMAG+LFGGADAPS+E TPDSE K
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/348 (74%), Positives = 277/348 (79%), Gaps = 2/348 (0%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MSASK EIASLIVNYFSSIVEKKE+SEDSADSLNVAMDCISEAFGFER+AV SIL+ S F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
           KGQ          ++ ES KKDDAQNVEVNIP              +QGNKAMANK+YEL
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AI KYTEAI VLPTNAIYYANRAAAHSSLK YDEA++DAESAIS+DP+YFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           YAQGKPEEALEAYKKVLDIEGDNAT+AMKRDYESAKK+VEQSLNLEKT PEQ RD     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXX--MNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQM 298
                                    MNNPQLMQAAQKMMSNPGAMQNIQ MMQDP+I+QM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 299 AEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ 346
           AEGFTSGGG PNLSDLM NPALR+MAG+LFGGA APSTEDT DSE KQ
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ 348

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  363 bits (931), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 188/329 (57%), Positives = 231/329 (70%), Gaps = 8/329 (2%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M+ S +EIA+LIV++ SS VEK  VSED ADSLNVA+DCISEAF FERDAVS I+  S  
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
             +           LP       ++ V+VNIP              +QGNKAMA+K++E 
Sbjct: 61  NRKLDELLKSAATALPTQ-----SEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AIKKYTEAI+VLP+NA+YYANRAAA+SSLK+Y+E+++DAESAI V+PSY +GYSRLGFAK
Sbjct: 116 AIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           YA GKPEEALEAYK VLDIEGD ATD MKRDYE+AK++VEQSLNLEK+ P Q  +     
Sbjct: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300
                                  +NNPQ+M AAQK+M NPGAM     MM++P++RQMAE
Sbjct: 236 DAGAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQMAE 292

Query: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFG 329
            F+SGGGTPNL DLM NPA+++MA +LFG
Sbjct: 293 NFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  353 bits (906), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 183/323 (56%), Positives = 222/323 (68%), Gaps = 8/323 (2%)

Query: 7   EIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF-KGQXX 65
           E+A++I+ Y   +V +K V ED  DS+NVA+DCI+E+F  ER  V S+L +S   KG   
Sbjct: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLEE 63

Query: 66  XXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYELAIKKY 125
                        G    +++V+VNIP              ++GNKAMA K++ELAI KY
Sbjct: 64  CLECM-------KGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKY 116

Query: 126 TEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGK 185
           +EAI+VLPTNAIYYANRAAAHSSLK+YDEA+ DAE AI +DP+Y +GYSRLGFAKYAQ K
Sbjct: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176

Query: 186 PEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXXXXXXX 245
           PEEALEAYKKV+D+EGD ATD MKRDYE+AKK+VEQSLNLEKT   +  D          
Sbjct: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAG 236

Query: 246 XXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAEGFTSG 305
                             MNNPQ+MQAAQ+MMSNP A+Q +Q+MMQDPSIRQMAE FTSG
Sbjct: 237 GAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296

Query: 306 GGTPNLSDLMKNPALRNMAGSLF 328
            GTPN+ DLM NPALRNMA S+F
Sbjct: 297 NGTPNMDDLMSNPALRNMASSMF 319

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  350 bits (897), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 179/340 (52%), Positives = 227/340 (66%), Gaps = 5/340 (1%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S +E+ASLIV+Y S +VEKK VSE++ DSLNVA+DCI E+F  ++        K+ F
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGD-----SKAVF 55

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
            G+                    A++++VNIP              ++GNKAMA K+++L
Sbjct: 56  GGKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDL 115

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AIKKY++AI+VLPTNA+YYANRAAAHSS+K Y+EAIKDAESAI  DP+Y +GYSRLG+AK
Sbjct: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           +A G+ E+ALEAYKKVLDIEGD A+D MKRDYE+AKK+VEQSL+LEK    Q R      
Sbjct: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGA 235

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300
                                  +NNPQLMQAAQ+MM NP AM  +++MMQ+P +RQMAE
Sbjct: 236 GGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAE 295

Query: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTP 340
            F  G G PN+ DLM NPALR+MAGSLFGGA+  +  D P
Sbjct: 296 NFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVP 335

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  343 bits (881), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 229/330 (69%), Gaps = 11/330 (3%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S +++A+LIV++ S  VE KEVSED  DSLNVA+DCI+EAF F+R++V++ L+K TF
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEK-TF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
            G+               G     ++V+VNIP              ++GNKAMA K++E 
Sbjct: 60  AGRSLKQVVEAAS----VGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           A+ KY+EAI VLPTNA+YYANRAAAHSSLK+Y+EA+KDAE AI V+PSY +GYSRLGFA+
Sbjct: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           YA GKPEEAL+AYKKVLDIEG+ ATDAMKRDY++A K+V QSLN+EK+AP   RD     
Sbjct: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA 235

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300
                                   NNPQLMQAAQ+MM NP AMQ +   M +P+++QMAE
Sbjct: 236 TGSGGLPDISSMLGGGLGGLL---NNPQLMQAAQQMMQNPNAMQEV---MNNPAVKQMAE 289

Query: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGG 330
            F SGGGTP+++DLM NPAL +MA ++FGG
Sbjct: 290 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 319

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  343 bits (880), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 177/323 (54%), Positives = 221/323 (68%), Gaps = 9/323 (2%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M+ S ++I+SLIV+Y + +V+KK VSEDS DSLNVA++CI+EAFG E+ + S+      F
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSA-----AF 55

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
            G+            P S      +NV+VNIP              ++GNKAMA K+YEL
Sbjct: 56  GGKNLAELLSAGAGAPSS----QGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AIKKY+EAI V+PTNA+YYANRAAAHSSLK YDEAIKDAESA+ VD SY +GYSRLG+AK
Sbjct: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXXX 240
           +AQGK EEALEAYKKVLDIEGD+ATD MKRDYE+AK++VEQ+L L KT   +  D     
Sbjct: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGE 231

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300
                                  +NNPQ+MQAAQ+MM NP AM  ++ MMQ+P++RQMAE
Sbjct: 232 PAGANPGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAE 291

Query: 301 GFTSGGGTPNLSDLMKNPALRNM 323
            F  G GTPNL+D+M NPALR+M
Sbjct: 292 KFAGGNGTPNLNDIMNNPALRDM 314

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  340 bits (871), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/345 (53%), Positives = 232/345 (67%), Gaps = 22/345 (6%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M+AS +EIA+LIV+Y +++V+KKEVS D+ADSLNVAMDCI+EAF FERD+V   + KS F
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-KSAF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXX--XIQGNKAMANKEY 118
            G            L  S   D    ++VNI                 ++GNKAMA K+Y
Sbjct: 60  NGNGLTSF------LSGSATND----IQVNIADDAADEEQKATAEGLKLEGNKAMATKDY 109

Query: 119 ELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGF 178
           E AIKKY+EAI+VLPTNA+YYANRAAA+SSLK+YD+A+ DAESAI V+P+Y +GYSRLGF
Sbjct: 110 ESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169

Query: 179 AKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXX 238
           AK+AQGK E+AL+AYKKVLDIEGD ATD MKRDYE+AKK+VEQSLNLEK  P++      
Sbjct: 170 AKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESN 229

Query: 239 XXXXXXXXXX---------XXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNM 289
                                             + NPQ+MQAAQ+MM NP AMQ +++M
Sbjct: 230 ADAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESM 289

Query: 290 MQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAP 334
           MQ+P++RQMAE F SG GTP+LS +M NP L++MA ++FG    P
Sbjct: 290 MQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  336 bits (862), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 235/334 (70%), Gaps = 7/334 (2%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S ++IA+LI+++ S++V+K EVSED+ADSLNVAMDCI+EAF FERD+V+ ++ KS+F
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-KSSF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
           +G               +    D + V+VN+               ++GNKAMA K+YEL
Sbjct: 60  QGNSLSSYLNGSTSASAATTTAD-ETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYEL 118

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AIKKYTEAI  LPTNA+Y+ANRAAA+SSLK+YDEA++DA SAI ++P+Y +GYSRLGFAK
Sbjct: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKT-----APEQPRD 235
           +AQGK E+ALEAYKKVLDIEGD AT+ MKRDYE+AKK+VEQSLNLEK+     A  +   
Sbjct: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDS 238

Query: 236 XXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSI 295
                                       +NNPQLMQAAQ+MM +P AM+ +++MMQ+PS+
Sbjct: 239 ASAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSV 298

Query: 296 RQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329
           +QMA+ F+SG GTP+ S LM +P++R+MA ++FG
Sbjct: 299 KQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  325 bits (832), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 167/337 (49%), Positives = 229/337 (67%), Gaps = 9/337 (2%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M+ S +E++SLI++Y + +V K EVS D  DSLNVA+DC++E FG E+D +S+ ++ S F
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIE-SKF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDA--QNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEY 118
            G+          +   +G  D+   + V++NIP              ++GNKA+A+K+Y
Sbjct: 60  NGKSLTELLDAASQ--NAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDY 117

Query: 119 ELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGF 178
           +LA++KYTEAI +LPTNA+Y+ANRAAA+++ + YDEA+KDAE AI +DP+Y +GYSRL +
Sbjct: 118 DLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAY 177

Query: 179 AKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXX 238
           AKY Q   EE+LEAYKKVL+IEGD+AT+  KR YE+AKKRVE+SLNLEK+ P    +   
Sbjct: 178 AKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVP---TESAG 234

Query: 239 XXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQM 298
                                    MNNPQ+MQAAQ MMSNPGAM+ IQ+MMQ+P+I+QM
Sbjct: 235 GQTNPAAGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQM 294

Query: 299 AEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPS 335
           AE F  GG TP+ S++M NPA+RNMA SLF GA  P+
Sbjct: 295 AEQF-KGGNTPDFSEMMNNPAVRNMASSLFSGAGEPA 330

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 174/342 (50%), Positives = 223/342 (65%), Gaps = 13/342 (3%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S +E+ SLIV++ S++++ KE+SEDSADSLNVA+DCI+E+F FERD V+  L +  F
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-QDKF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
            G+                +K+++  V+VNIP              ++GNKAMA K+Y L
Sbjct: 60  SGKTLKEILSSASATSTGSEKEES--VKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AI+KY+EAI  LPTN IYYANRAAA+SS+KEYD AIKDAE AI +DP+Y +GYSRL FAK
Sbjct: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEK---TAPEQPRDXX 237
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK RVE S+NLEK   T PE  R   
Sbjct: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237

Query: 238 XX-----XXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQD 292
                                          +NNPQ+MQAAQ+MMS+P +MQ +Q MMQ+
Sbjct: 238 QQPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQN 297

Query: 293 PSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAP 334
           P++R+MA+   SG    NL DLM NP++++MA +LFG   AP
Sbjct: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 227/350 (64%), Gaps = 17/350 (4%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS + ++I +LIV++ S+I+EK EVSED+ADSLNVAMDCISEA  F+R+ V   + K+ F
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-KNKF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
            G+              +   +  ++VEVNIP              ++GNKAMA K++ L
Sbjct: 60  NGKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           A++KYTEAI +LPTNAIYYANRAAAHSSLKE++EAIKDAESAI +DPSY +GYSRL FAK
Sbjct: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKT-APEQPRDXXXX 239
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKKRVE+S+N+EK+  PEQ +     
Sbjct: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239

Query: 240 XXXXXXXX-----------XXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQN 288
                                              ++NP  M  AQK+MS+P AMQ +Q+
Sbjct: 240 NESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQS 299

Query: 289 MMQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTED 338
           MM DPS+R +A  F +  G  +++D+M NPA+RNMA +LF G   PS E+
Sbjct: 300 MMSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLFKG--NPSEEN 345

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  312 bits (799), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 173/335 (51%), Positives = 221/335 (65%), Gaps = 14/335 (4%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M  S +EI++LIV+Y   + EK +VSED  DSLNVA+DCI+++F FERD+ S ++ KS F
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-KSKF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDA-QNVEVNIPXXX----XXXXXXXXXXXIQGNKAMAN 115
                        +L E   ++ A +NV VN+P                  ++GNKAMA 
Sbjct: 60  YN-------LSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAM 112

Query: 116 KEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSR 175
           K+++LAI KY+EAI + P NAIYYANRAAA+SSLK++++A +DAESAI VDP+Y +GYSR
Sbjct: 113 KDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSR 172

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRD 235
           LGFAKYA  KPEEALEAYKKVLD+EGD AT+ MKRDYE+AKKRVEQSLNLEK       +
Sbjct: 173 LGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEE 232

Query: 236 XXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSI 295
                                       +NNPQLMQAAQ+MMS+P AM  IQ+MMQ+PSI
Sbjct: 233 SVTESAANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSI 292

Query: 296 RQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGG 330
           RQMAE F   G TP+ S LM +P +++MA + FGG
Sbjct: 293 RQMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGG 326

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  310 bits (795), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 228/331 (68%), Gaps = 8/331 (2%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M+ +K+E+ASLI++Y     E KE+ ED  DSLNVA+DC++EAF  E+++ SS+++KS F
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
            GQ          K P + +++    V+VNIP              ++GNKAMA K++E 
Sbjct: 60  GGQSLEQIVGASSKGPTATQQEP---VKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEH 116

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AI KY+EAI  LP+NA+Y+ANRAAA+SSLK+Y EA++DAE+AI V+PSY +GYSRLGFA+
Sbjct: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPR-DXXXX 239
           YA G+PEEAL+AYKKVLDIEG NATDAMKRDY++A K+VEQSLN+E++AP     +    
Sbjct: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236

Query: 240 XXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMA 299
                                   + NPQ+MQAAQ+MM NP AM   Q MM +P+I+QMA
Sbjct: 237 AGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAM---QEMMSNPAIKQMA 293

Query: 300 EGFTSGGGTPNLSDLMKNPALRNMAGSLFGG 330
           + F SGGGTP+++DLM NPAL +MA ++FGG
Sbjct: 294 DKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  303 bits (775), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 215/330 (65%), Gaps = 15/330 (4%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M  S +EIA+LIV + S+    K+V E+  DSLNVA+DCI+EAF  ER+  + I+ K+ +
Sbjct: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57

Query: 61  KGQXXXXXXXXXXKLPE-SGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYE 119
            G+            P  S  +    N + + P              ++GNKA A K++E
Sbjct: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLK----LEGNKAFAAKDFE 113

Query: 120 LAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFA 179
            A+KKYTEAI+++P NA++Y NRAAA+SS K+++EA++DAESA+ ++PSY RGYSRLG A
Sbjct: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDXXXX 239
           KYA GKPEEA+EAYKKVLDIEGDNAT+AMKRDYESAKK+VE+SLNLE      P+     
Sbjct: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL----PKGEEQQ 229

Query: 240 XXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMA 299
                                   +NNPQ+MQAAQKMM NP AM   Q MM +P+I+QMA
Sbjct: 230 TSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMA 286

Query: 300 EGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329
           + F SGGGTPNL D+MK+P +++MAG  FG
Sbjct: 287 QNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  300 bits (769), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 220/332 (66%), Gaps = 13/332 (3%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S ++IA+L+V++ S+ +EKK VS D+ADSLNVA+DCI+EAF FE+D V S L  S F
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTL-ASKF 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIP----XXXXXXXXXXXXXXIQGNKAMANK 116
            G+               G+    ++++V+I                   ++GNKAMA K
Sbjct: 60  GGKSLTELLDAATNAK--GRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAK 117

Query: 117 EYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRL 176
           +Y LA++KY  AI ++PT A+YYANRAAA+SS ++YDEAIKDAESAI V+P++ +GYSRL
Sbjct: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDX 236
           GFAK+AQGK +EALEAYKK L+++GD ATD MKRDYE+AKK+VEQSLN+EK+A       
Sbjct: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSAS-- 235

Query: 237 XXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIR 296
                                      +NNPQ+MQAAQ+MMSNP AM+ +++MMQ+PSIR
Sbjct: 236 ---ASASASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIR 292

Query: 297 QMAEGFTSGGGTPNLSDLMKNPALRNMAGSLF 328
           QMAE  +S G +  + D M NPA+R MA +LF
Sbjct: 293 QMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  296 bits (759), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 167/348 (47%), Positives = 223/348 (64%), Gaps = 31/348 (8%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S +EIA+LIV++ SS      V+ED  DSLNVA+DCI+EAF FERD   S++    F
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLI-SGPF 57

Query: 61  KGQXXXXXXXXXXKLPE------SGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMA 114
            G+          KLPE      S      + V+V+IP              +QGNKAMA
Sbjct: 58  NGK----------KLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMA 107

Query: 115 NKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYS 174
            K+++ AI+KYT AI+V P+NA+YY+NRAAA+SSLK+Y++A+KDAE AI VDP+Y +G+S
Sbjct: 108 AKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFS 167

Query: 175 RLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPR 234
           RLGFAKYA  KPEEAL+AYKKVLDIEG+ ATD MKRDYE+AKK+VE S+NLEK++     
Sbjct: 168 RLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASS 227

Query: 235 DXXXXXXXXXXXXXXXXXXX---------XXXXXXXXXMNNPQLMQAAQKMMSNPGAMQN 285
           +                                     +NNPQ+MQAA+KMM NPG MQ+
Sbjct: 228 EDVSDKSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQD 287

Query: 286 IQNMMQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADA 333
              MM +P+++QMA  F+SGGG P+LS +M +P++R+MA ++FGG + 
Sbjct: 288 ---MMSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNG 332

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  262 bits (669), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 149/340 (43%), Positives = 204/340 (60%), Gaps = 26/340 (7%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S ++IA+LIV++ ++    K V ED  DSL VA+DCI+EAF        +++ +   
Sbjct: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKC- 57

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
                        +L  +G    +   E  +               ++GN+AMA K+YE 
Sbjct: 58  -------GGRSLSQLLTTGMAHTSDAGEPKV--AAEELKKEAEALKLEGNRAMAAKDYET 108

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AI+KYT AI+VLPT+A+YYANRAAA+SSL++Y++A++DAE A  VD SY +G+SRLG+AK
Sbjct: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK 168

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTA----------- 229
           YA G+ EEALEAYK+VLDIEGDNAT+AM+RDYESAK++VE+S+N+++ A           
Sbjct: 169 YALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAG 228

Query: 230 PEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQNM 289
                                             +NNPQ+MQAAQKMM NP A   IQ M
Sbjct: 229 SAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSA---IQEM 285

Query: 290 MQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329
           M +P+I++MAE F SG G+  L DLM +PA+RNMA   FG
Sbjct: 286 MSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  204 bits (520), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 187/353 (52%), Gaps = 23/353 (6%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGF----ERDAVSSILD 56
           MS + ++  +LIVNY   I++ KEVSED+A+SLNVA+DCIS+ F      E   ++ + +
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 57  KSTFKGQXXXXXXXXXXKLPESGKKD--DAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMA 114
           KS  K             L   G ++  D   +EV                 ++GNK M+
Sbjct: 61  KSDLK----------TITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMS 110

Query: 115 NKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYS 174
            K Y+ AI KY++AI++ P+N  YY+NRAAA+  ++++  A+ DA +AI +DP+Y + YS
Sbjct: 111 LKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYS 170

Query: 175 RLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPR 234
           RLG AK A+G  E+A+ A+KKVL++EGD +T+ MK DYE+AKK V+  + L K  P+   
Sbjct: 171 RLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDP-- 228

Query: 235 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNP--QLMQAAQKMMSNPGAMQNIQNMMQD 292
                                        MNN              NP  MQ ++ +MQ+
Sbjct: 229 ---SGPPPLNTTDVLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQN 285

Query: 293 PSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETK 345
           P +RQ AE   +G G   LSD++ NP+++ +A  L  G +  S+    + E+K
Sbjct: 286 PVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESK 338

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  144 bits (363), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/360 (28%), Positives = 163/360 (45%), Gaps = 45/360 (12%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           M+ + +EIAS+IV+YF+  +   ++++D+ DSLNVA+DCI++ F  ++D +S+IL  +  
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNV-------------------EVNIPXXXXXXXXX 101
                              KK+   NV                   ++N+P         
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 102 XXXXXI-------------QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSS 148
                +             +GN+ M  K+Y  AI  Y++AI + PTN  YY NRA A+  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 149 LKEYDEAIKDAESAISVD----PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI----- 199
              +D AI DA  +I +D    P+ F+ Y RLG AKY  G  E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 200 EGDNATDAMKRDYESAKKRVEQSLNLEKT-APEQPRDXXXXXXXXXXXXXXXXXXXXXXX 258
           +GD  T  M  DYE AK++V++   ++ T +  +                          
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300

Query: 259 XXXXXMNNPQLMQAAQKMM-SNPGAMQNIQNMMQDPSIRQMAEGFTSG--GGTPNLSDLM 315
                M+NP   +  ++++ SNP A Q   N+M DP +RQM E   S      P L DL 
Sbjct: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDLF 360

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  142 bits (358), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 122/221 (55%), Gaps = 21/221 (9%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS +KE+ ASLI++Y S +     + ED  +SL VA+ CI E+F  + D + + L + T 
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
           K               E+ +K   +  E                   +GN+AM   +YE 
Sbjct: 61  K-----TILQENLNTLEATQKIHNEEAEA---------------LKKEGNEAMIEGQYEE 100

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AIKKYTEAI     N  YY+NR+ A+S L  Y++A+ DA  AI++DPS+ + YSRLG+AK
Sbjct: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQ 221
             Q K E+ + AYK+ +D+EG NA+  +  DYE A+ + EQ
Sbjct: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  137 bits (344), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 132/230 (57%), Gaps = 24/230 (10%)

Query: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60
           MS S +EIAS IV+Y SS++   +V+ED A+S++VA++CI ++F  + + VS+  D +T 
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEE-VSADSDLATV 59

Query: 61  KGQXXXXXXXXXXKLPESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYEL 120
                         L    K  + +   VN                ++GNKA+  + Y+ 
Sbjct: 60  --------LLANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKD 102

Query: 121 AIKKYTEAIDVLPTNAI-----YYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSR 175
           AI KYT AID+L  N +     Y +N++ A +    Y+EA  DA + I +DP++ +GYSR
Sbjct: 103 AIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSR 162

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNL 225
           L  AK  Q K E+A+ AYK+VLD+EG+ ATD MKRD+E  K++ E +LN 
Sbjct: 163 LAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNF 211

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  126 bits (316), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/335 (25%), Positives = 162/335 (48%), Gaps = 34/335 (10%)

Query: 6   EEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFG-------------FERDAVS 52
           +++A LIVN+  +++ KKE+S+D+ DSLNVA+DCI + +              F +  ++
Sbjct: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSDLT 68

Query: 53  SILD---KSTFKG----QXXXXXXXXXXKLPESGKK-------DDAQNVEVNIPXXXXXX 98
           SIL+   K+ +K     +           L ES KK       D+ + + +N+       
Sbjct: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128

Query: 99  XXXXXXXXI-----QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYD 153
                         +GN+ M +++Y+ AI+ YT AI   P + IYY+NR+ A+  + +Y+
Sbjct: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188

Query: 154 EAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYE 213
            AI DA   IS+D ++ + Y RL   K  Q +  +AL+ YKK +++  D+  + + R++E
Sbjct: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248

Query: 214 SAKKRVEQSLNLEKTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAA 273
             K +V+  ++L + + +                                ++NP L Q  
Sbjct: 249 DLKLKVQTDISLREISNDHSN-NNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQQMI 307

Query: 274 QKMM-SNPGAMQNIQNMMQDPSIRQMAEGFTSGGG 307
            K++ +NP A +NI  ++ +P+++ + + F +G  
Sbjct: 308 FKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 74/113 (65%), Gaps = 6/113 (5%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+YE AI  +++AI+V  T N ++Y+NR+A ++SLK++ EA+ DAE  + ++
Sbjct: 10  QGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKIN 69

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN-----ATDAMKRDYES 214
           P++ +GY+RLG A    G  +EA  +YKK L+++G N       D +KR  ES
Sbjct: 70  PTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSNQAAKDGLDQVKRTQES 122

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G       ++  A+K YTE I   P +A  Y+NRAAA S L  + EAI+D   AI  D
Sbjct: 395 LEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKD 454

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 455 PNFIRAYIRKATAQIA 470

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAA-------AHSSLKEYDEAIKDAES 161
           GNKA   ++++ AI  Y  A + L  +  Y  NR+A       A ++LK  DEA++    
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWN-LHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 162 AISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
             +      + ++R+G   +     ++A+E Y+K L
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 121/248 (48%), Gaps = 54/248 (21%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A + KEYE A+  +++AI+V P  N + Y+NR+A ++SLK++ +A+ DA     ++
Sbjct: 11  QGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           P++ +GY+R+G A Y  G  +EA ++YKK L+++  N           A++ +EQ    +
Sbjct: 71  PTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKV---------AQEGLEQVKRTQ 121

Query: 227 KTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNI 286
           +    QP                               N+P L+   +K+ SNP   +  
Sbjct: 122 EARKAQP-----------------------DMGLTSMFNDPNLI---EKLKSNPKTAE-- 153

Query: 287 QNMMQDPSIRQMAEGFTSGGGTPNLS-DLMKNPALRNMAGSLFG---------GADA--P 334
             MM DP +  +A+  +    +  LS +L  +P L  +  +L G         G+++  P
Sbjct: 154 --MMNDPQL--VAKLLSYRSNSQALSTELFSDPRLMTIMATLLGVDLNMGDLNGSNSMPP 209

Query: 335 STEDTPDS 342
           + E TP++
Sbjct: 210 TAEKTPEA 217

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 86/209 (41%), Gaps = 35/209 (16%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           IQG       ++  A+K YTE I   P +A  Y+NRAAA S L  + EAI D E A+  D
Sbjct: 397 IQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKD 456

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI---------EGDNATDAMKRDYESAKK 217
           P++ + Y R   A+ A  +   ALE     LDI          G N  +  +   ++ ++
Sbjct: 457 PNFVKAYIRKATAQIAIKEYSSALE----TLDIARSKDTELNNGSNIREINQLYAKATQQ 512

Query: 218 RVEQSLNLEKTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMM 277
           R E + + E   PEQ                               M +P +    Q+  
Sbjct: 513 RFEPASSNE--TPEQ-----------------TYQRAMKDPEVAAIMQDPVMQSILQQAQ 553

Query: 278 SNPGAMQNIQNMMQDPSIRQMAEGFTSGG 306
           +NP A+   Q  M++P I +  +   S G
Sbjct: 554 TNPAAL---QEHMKNPEIFKKIQTLISAG 579

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 69/97 (71%), Gaps = 1/97 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A  +K++  AI+ +T+AI+V PT N + Y+NR+AA++S K++ EA+ DA   + ++
Sbjct: 11  QGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           P++ +GY+RLG A++  G  EEA + YK+ L ++ +N
Sbjct: 71  PTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K Y+E I   P +A  Y+NRAAA S L  + EAIKD ++AI  D
Sbjct: 394 LEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKD 453

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 454 PNFVRAYIRKATAQIA 469

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 63/130 (48%), Gaps = 10/130 (7%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI--- 163
           ++GNK     +++ AI++Y +A   L  +  Y  NR+AA     +++ AI     A+   
Sbjct: 260 VEGNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 164 -SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATDAMKRDYESAKK 217
             +   Y    + ++R+G A + +G  +++++ Y+K L      D  T     + E  K+
Sbjct: 319 RELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNCEKELKKQ 378

Query: 218 RVEQSLNLEK 227
             EQ ++ EK
Sbjct: 379 EAEQYIDPEK 388

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 109/225 (48%), Gaps = 45/225 (20%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A A K+Y+ A+  +T+AI+V  T N + Y+NR+A+++S ++++EA+KDA     ++
Sbjct: 11  QGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           PS+ +GY+R G A +  G  ++A  +YKK L+++ +N           AK+ +EQ   ++
Sbjct: 71  PSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKI---------AKEGIEQIQRVQ 121

Query: 227 KTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNI 286
                QP                               N+P L+   +K+ +NP   +  
Sbjct: 122 SQRQAQP-----------------------DLGLTEMFNDPNLI---EKLKNNPKTAE-- 153

Query: 287 QNMMQDPSIRQMAEGFTSGGGTPN--LSDLMKNPALRNMAGSLFG 329
             +M DP   Q+     S    PN    DL  +P L  + G+L G
Sbjct: 154 --LMNDP---QLVAKLLSFRSNPNGLAQDLFSDPRLMTIMGTLMG 193

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K YTE I   P +A  Y+NRAAA S L  + +AI D   AI  D
Sbjct: 390 LEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKD 449

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 450 PNFVRAYIRKATAQIA 465

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 8/98 (8%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI--- 163
           ++GNKA   + ++ AI  Y +A + L  N  Y  NR+AA     EYD AI     AI   
Sbjct: 256 VEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKG 314

Query: 164 -SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
             +   Y    + ++R+G A    G  +EA+  Y+K L
Sbjct: 315 REMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 82/117 (70%), Gaps = 3/117 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A A K++E AI+ +T+AI+V    N + Y+NR+A ++S K++++A++DA+  ++++
Sbjct: 9   QGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNIN 68

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATDAMKRDYESAKKRVEQ 221
           P++ +GY+R+G A +  G  +EA + YKK L+++  N  A D +++ +++ + R +Q
Sbjct: 69  PAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSRQQQ 125

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (57%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +QG +     ++  A+K YTE I   P +A  Y+NRAAA S L  + EAIKD   AIS D
Sbjct: 398 LQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKD 457

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 458 PNFIRAYIRKATAQIA 473

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 52/97 (53%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI---- 163
           +GNK    ++++ AI+ Y++A + L  +  Y  NRAAA     EY+ AIK    A+    
Sbjct: 265 EGNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGR 323

Query: 164 SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    + ++R+G + +   + ++A+E Y+K L
Sbjct: 324 ELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 76/117 (64%), Gaps = 3/117 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+Y+ AI+ +T+AI+V  T N + Y+NR+A ++SLK++ +A+ DA+  I+++
Sbjct: 11  QGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININ 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATDAMKRDYESAKKRVEQ 221
           PS+ +GY+RLG A    G  +EA   YKK L+++  N  A D + + + + + R  Q
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASNKAAKDGLDQVHRTQQARQAQ 127

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 77/200 (38%), Gaps = 17/200 (8%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G       ++  A+K YTE I   P +A  Y+NRAAA + L  + EAI D   AI  D
Sbjct: 401 LEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKD 460

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           P++ R Y R   A+ A  +   ALE        + D    A  R+ +    +  Q     
Sbjct: 461 PNFVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKASQQRFQP 520

Query: 227 KTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNI 286
            T  E P +                            M +P +    Q+   NP A+   
Sbjct: 521 GTGNETPEE--------------TYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAAL--- 563

Query: 287 QNMMQDPSIRQMAEGFTSGG 306
           Q  M++P + +  +   + G
Sbjct: 564 QEHMKNPEVFKKIQTLIAAG 583

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAIS--- 164
           +GNK    ++++ AI+ Y +A + L  +  Y  NRAAA     EY  AI     A+    
Sbjct: 268 EGNKFYKARQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGR 326

Query: 165 -VDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    R ++R+G A +  G  ++ +E Y+K L
Sbjct: 327 EMRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 83.2 bits (204), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+Y+ AI  +++AIDV    N + Y+NR+A ++SLK++  A+KDAE  + ++
Sbjct: 11  QGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           PS+ +GY+R+G A +  G  +EA   YKK L+++  N
Sbjct: 71  PSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASN 107

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 44/85 (51%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G       ++  A+K YTE I   P +A  Y+NRAA  S L  + EAI D   AI  D
Sbjct: 402 LEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKD 461

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALE 191
           P++ R Y R   A+ A  +   ALE
Sbjct: 462 PNFVRAYIRKATAQIAVREFSSALE 486

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI----S 164
           GNK    ++++ A+ KY EA +    +  Y  NR+AA     +Y+ +IK  E A+     
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEA-HNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 165 VDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
           +   Y    + ++R+G         ++A++ YKK L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 111/223 (49%), Gaps = 41/223 (18%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +GN A A+K++  AI+ +TEAI    T N + Y+NR+A ++SLK++ EA+ DA+  + ++
Sbjct: 10  KGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKIN 69

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           P + +GY+R+G A    G  ++A   YKK L+++ +N         ++A + +EQ   ++
Sbjct: 70  PDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------KAASEGLEQVHRVQ 120

Query: 227 KTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNI 286
           ++   +P                               ++P L+   +K+  NP      
Sbjct: 121 ESRKSRP-----------------------DFGMTEMFSDPNLI---EKLRQNP----KT 150

Query: 287 QNMMQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329
           ++MM DPS+    + + S     + SDLM +P L  +  +L G
Sbjct: 151 KDMMNDPSLVAKLQSYKSNPQGLS-SDLMGDPRLMTIMATLLG 192

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K YTE I   P +A  Y+NRAAA + L  + EAIKD E AI  D
Sbjct: 395 LEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKD 454

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 455 PNFVRAYLRKATAQIA 470

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 62/129 (48%), Gaps = 10/129 (7%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAIS--- 164
           +GNK   + +++ AI +Y +A D L  +  Y  NR+AA     +++ A+     A+    
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWD-LHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 165 -VDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVLDIE--GDNATDAMKRDYESAKKR 218
            +   Y    + ++R+G A   Q   ++A+E Y+K L      D  T     + E  K+ 
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQE 380

Query: 219 VEQSLNLEK 227
           +E+ +N EK
Sbjct: 381 IEEYINPEK 389

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 113/225 (50%), Gaps = 45/225 (20%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K++E A + +++AI+   T N + Y+NR+A ++SLK++ EA++DAE  + ++
Sbjct: 9   QGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKIN 68

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           P++ +GY+R+G A+Y  G  ++A + YKK L+I+  N         ++A++ +EQ    +
Sbjct: 69  PTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN---------KAAQEGLEQVQKTQ 119

Query: 227 KTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNI 286
               +QP                               N+P ++   +K+ SNP   +  
Sbjct: 120 NARQQQP-----------------------DLGFGQLFNDPNMI---EKLKSNPKTAE-- 151

Query: 287 QNMMQDPSIRQMAEGFTSGGGTPNL--SDLMKNPALRNMAGSLFG 329
             +M+DP +      F S    P +   ++MK+P +  +  ++ G
Sbjct: 152 --LMKDPQLVSKVLQFQSN---PQMMGQEVMKDPRMMTIMAAILG 191

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (56%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +QG +     ++  A+  YTE I   P +A  Y+NRAA  + L  + +AIKD + AIS D
Sbjct: 406 LQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKD 465

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 466 PNFVRAYIRKASAQIA 481

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 8/128 (6%)

Query: 77  ESGKKDDAQNVEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYELAIKKYTEAIDVLPTNA 136
           ES    DA  +EV+ P               +GNK    ++++ AI+ Y +A D L  + 
Sbjct: 242 ESDLSADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWD-LHRDV 300

Query: 137 IYYANRAAAHSSLKEYDEAIKDAESAI----SVDPSY---FRGYSRLGFAKYAQGKPEEA 189
            Y  NR+AA     +Y++AIK    A+     +   Y    + ++R+G A       ++A
Sbjct: 301 TYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKA 360

Query: 190 LEAYKKVL 197
           +E Y++ L
Sbjct: 361 IEFYQRSL 368

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 110/223 (49%), Gaps = 42/223 (18%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+Y  AI  +T+AI+V  T N + Y+NR+A ++S K+++EA+KDAE  + + 
Sbjct: 9   QGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKIS 68

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           PS+ +GY+R+G A++   + +EA ++YK+ L+++  N         ++AK  +E  +   
Sbjct: 69  PSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN---------KAAKDGLEH-VQSA 118

Query: 227 KTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNI 286
           K  P+ P                               N+P L+   Q + +NP      
Sbjct: 119 KAGPQMP-----------------------DLGLSQMFNDPNLI---QNLKNNPKTA--- 149

Query: 287 QNMMQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329
            +MM+DP +    EG+ +   + +  DL  +  L  +  +L G
Sbjct: 150 -DMMKDPQLVAKLEGYRNNPQSIS-QDLFTDKRLMTIMAALLG 190

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +QG +     ++  A+K YTE +   P +A  ++NRAAA + L  + EAI+D   A+S+D
Sbjct: 385 LQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSID 444

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 445 PNFVRAYIRKATAQIA 460

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD- 166
           +GNK    +++E AI+ Y +A + L  +  Y  NR+AA     +YD AIK    A+    
Sbjct: 252 EGNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGR 310

Query: 167 ------PSYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
                  +  + ++R+G A Y      +A+E Y + L
Sbjct: 311 ELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+Y+ AI+ +T+AI+V  T N + Y+NR+A ++SLK++ +A+ DA   + ++
Sbjct: 11  QGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           PS+ +GY+RLG A    G  +EA   YKK L+++  N
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASN 107

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 88/205 (42%), Gaps = 27/205 (13%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K YTE I   P +A  Y+NRAAA + L  + EAI D   AI  D
Sbjct: 401 LEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKD 460

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAY--KKVLDIEGDNATDAMKRD---YESAKKRVEQ 221
           P++ R Y R   A+ A  +   ALE     +  D E +N + A + D   Y+++++R + 
Sbjct: 461 PNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQP 520

Query: 222 SLNLEKTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPG 281
                 T+ E P +                            M +P +    Q+   NP 
Sbjct: 521 G-----TSNETPEE--------------TYQRAMKDPEVAAIMQDPVMQSILQQAQQNPA 561

Query: 282 AMQNIQNMMQDPSIRQMAEGFTSGG 306
           A+   Q  M++P + +  +   + G
Sbjct: 562 AL---QEHMKNPEVFKKIQTLIAAG 583

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI---- 163
           +GNK    ++++ AI+ Y +A + L  +  Y  NRAAA     EY+ AI     A+    
Sbjct: 268 EGNKFYKARQFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGR 326

Query: 164 SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    + ++R+G A +  G  ++ +E Y+K L
Sbjct: 327 EMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 67/97 (69%), Gaps = 1/97 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K Y+ AI+K+T+AI+V  T N + Y+NR+A ++S K++ + ++DA   + ++
Sbjct: 11  QGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           P++ +GY+R+G A +  G  +EA +AYKK L+++  N
Sbjct: 71  PTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSN 107

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 89/204 (43%), Gaps = 25/204 (12%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K YTE I   P++A  Y+NRAAA S L  + EAI D  +AI  D
Sbjct: 394 LEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKD 453

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAY--KKVLDIEGDNATDAMKRD--YESAKKRVEQS 222
           P++ R Y R   A+ A      A+E     +  D E +N  ++ + D  Y  A ++  Q 
Sbjct: 454 PNFIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREIDQLYLKANQQRFQP 513

Query: 223 LNLEKTAPEQPRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 282
            N  +T PEQ  +                            M +P +    Q+  +NP A
Sbjct: 514 SNANET-PEQTYE-----------------RAMKDPEVAAIMQDPVMQSILQQAQTNPAA 555

Query: 283 MQNIQNMMQDPSIRQMAEGFTSGG 306
           +   Q  M++P I +  +   + G
Sbjct: 556 L---QEHMKNPEIFKKIQTLIAAG 576

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 77/117 (65%), Gaps = 3/117 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +GN A A K++E AI+ + +AI+V    N + Y+NR+A ++S++++ EA+ DA+  + + 
Sbjct: 10  EGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIK 69

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATDAMKRDYESAKKRVEQ 221
           P + +G++RLG A Y  G  +EA E+YKK L+++  N  A D + +   + ++R+EQ
Sbjct: 70  PDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQRMEQ 126

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +QG +   N ++  A+K YTE I   P +A  Y+NRAAA + L  + +AIKD + AI  D
Sbjct: 393 LQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKD 452

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 453 PNFVRAYIRKATAQIA 468

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI---- 163
           +GN+    ++++ AI  Y +A D L  +  Y  NRAAA     +Y+ AIK  E A+    
Sbjct: 260 KGNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGR 318

Query: 164 SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    + ++RLG A Y     ++A+E Y+K L
Sbjct: 319 ELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 80.1 bits (196), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+YE A + +T+AI+     N + Y+NR+A  +SLK+++EA+ DA   + ++
Sbjct: 9   QGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKIN 68

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           P++ +GY+R+G A +  GK +EA + YKK L+I+  N
Sbjct: 69  PAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +QG +     ++  A+K YTE     P +A  Y+NRAAA + L  + EAIKD + AIS D
Sbjct: 406 LQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKD 465

Query: 167 PSYFRGYSRLGFAKYA 182
           P++ R Y R   A+ A
Sbjct: 466 PNFIRAYIRKATAQIA 481

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 8/118 (6%)

Query: 87  VEVNIPXXXXXXXXXXXXXXIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAH 146
           +EV+ P               +GNK    ++++ AI+ Y +A D L  +  Y  NR+AA 
Sbjct: 252 MEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWD-LHKDVTYLNNRSAAE 310

Query: 147 SSLKEYDEAIKDAESAI----SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
               +Y++AIK    A+     +   Y    + ++R+G A       ++A+E Y+K L
Sbjct: 311 YEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +GN A   K+Y+ AI  +T+AI+V  T N + Y+NR+AA++S K+Y++A+ DA+  I ++
Sbjct: 11  EGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           PS+ +GY+R G A     K EEA + Y + L I+ +NA
Sbjct: 71  PSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (56%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K YTE I   P +A  Y+NRAAA + L  + +AI D   AI  D
Sbjct: 390 LEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKD 449

Query: 167 PSYFRGYSR 175
           PS+ R Y R
Sbjct: 450 PSFIRAYLR 458

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 75/117 (64%), Gaps = 3/117 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K Y+ AI+ +T+AI+V  T + + ++NR+A ++SLK++ +A+ DA   + ++
Sbjct: 11  QGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATDAMKRDYESAKKRVEQ 221
           PS+ +GY+RLG A    G  +EA   YKK L+++ +N  A D +++ + + + R  Q
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQARQAQ 127

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K YTE I   P +A  Y+NRAAA + L  + EAI D   AI  D
Sbjct: 401 LEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKD 460

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
           P++ R Y R+  A+ A  +   ALE     LD+
Sbjct: 461 PNFVRAYIRMAAAQIAVKEFAAALE----TLDV 489

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 68/97 (70%), Gaps = 1/97 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +GN+A A+K+Y  AI+ +T+AI+V    N + ++NR+A ++S K++ +A+ DA   + ++
Sbjct: 9   EGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKIN 68

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           PS+ +GY+RLG A Y  G  +EA ++YKK L+++  N
Sbjct: 69  PSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +QG +     ++  A++ YTE I   P +A  Y+NRAAA S L  + +AI+D + AI  D
Sbjct: 394 LQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKD 453

Query: 167 PSYFRGYSR 175
           P++ R Y R
Sbjct: 454 PNFVRAYIR 462

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAI----KDAESAI 163
           +GNK    ++++ AI+KY EA +    +  Y  NRAAA     +Y+ AI    K  E   
Sbjct: 261 EGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGR 319

Query: 164 SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    + ++R+G + +  G  ++A++ Y+K L
Sbjct: 320 ELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 78/127 (61%), Gaps = 10/127 (7%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+YE A + + +AIDV    N + Y+NR+A ++SLK++ E +KDAE  + ++
Sbjct: 10  QGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKIN 69

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           P + +GY+R+G A++     E+A ++Y+K L+++  N         ++AK+ ++Q L   
Sbjct: 70  PGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN---------KAAKEGLDQVLKTR 120

Query: 227 KTAPEQP 233
           ++  + P
Sbjct: 121 ESRQQMP 127

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +  +  ++  A+K YTE I   P +A  Y+NRAAA + L  + EAI D + AI  D
Sbjct: 387 LEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKD 446

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATDAMKRD 211
           P++ R Y R   A+ A  +   A+E    V   D E +N  +A + D
Sbjct: 447 PNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREID 493

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 50/97 (51%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI---- 163
           +GNK    ++++ AI+ Y +A + L  +  Y  NRAAA     +Y+ AI    +A+    
Sbjct: 254 EGNKFYKARKFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEGR 312

Query: 164 SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    + ++R+G A +  G  ++++  Y+K L
Sbjct: 313 EMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSL 349

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 71/117 (60%), Gaps = 3/117 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPT-NAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           QGN A   K+Y  AI  +T+AI+V    N + Y+NR+A ++SLK++ +A+ DA   + ++
Sbjct: 11  QGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKIN 70

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATDAMKRDYESAKKRVEQ 221
           PS+ +GY+RLG A    G  ++A   YKK L+++  N  A D + + + S + R  Q
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAANKAAKDGLDQVHRSQQARQAQ 127

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           ++G +     ++  A+K YTE I   P +A  Y+NRAAA + L  + EAI D   AI  D
Sbjct: 398 LEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKD 457

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAY--KKVLDIEGDNATDAMKRD---YESAKKRVE 220
           P++ R Y R   A+ A  +   ALE     +  D E +N   A + D   Y+++++R +
Sbjct: 458 PNFVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKASQQRFQ 516

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI---- 163
           +GNK    +++E AI+ Y +A + L  +  Y  NRAAA     +Y+ AI     A+    
Sbjct: 265 EGNKFYKARQFEEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGR 323

Query: 164 SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    + ++R+G A +  G  ++ ++ Y+K L
Sbjct: 324 EMRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSL 360

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 51/87 (58%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           I+G +   N+EY  A+K YTE I   PT+ + + NRAA    L    + I D + AISVD
Sbjct: 434 IEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVD 493

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAY 193
           PSY + Y R GFA+  +   +EALE +
Sbjct: 494 PSYIKAYVRKGFAQITERDLDEALETW 520

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (58%), Gaps = 1/97 (1%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTN-AIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           GNK    K YE A+  +T A+    TN  I Y+NRAAAH  LK Y EA++D ++ + + P
Sbjct: 15  GNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAP 74

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++ +GYSR+G A     K +EA E +KK L +   N 
Sbjct: 75  NWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNV 111

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAI-DVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +GN A   K+++ A++ +T AI +    N + Y+NR+ A++SLK++DEA+ DA   + + 
Sbjct: 10  EGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIK 69

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + +G++RLG A +  G  +EA E+YKK L+++  N
Sbjct: 70  ADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (57%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           + G +     ++  A+K Y+E I   P +A  Y+NRAAA S L  + +AIKD + AI +D
Sbjct: 397 LDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEID 456

Query: 167 PSYFRGYSRLGFAKYA 182
           PS+ R Y R   A+ A
Sbjct: 457 PSFVRAYIRKATAQIA 472

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI---- 163
           +GN+    ++++ AI KY EA + L  +  Y  NRAAA     +Y+ AIK    A+    
Sbjct: 264 EGNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGR 322

Query: 164 SVDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            +   Y    + ++RLG A Y   + ++A+E Y+K L
Sbjct: 323 ELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  K +  AI+KYTEAID+  T +IY++NRA AH  +  +  A+ D + AI +DP
Sbjct: 18  EGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDP 77

Query: 168 SYFRGYSR 175
              + Y R
Sbjct: 78  KNIKAYHR 85

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  K +  AI+KYTEAID+  T +IY++NRA AH  +  +  A+ D + AI +DP
Sbjct: 18  EGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDP 77

Query: 168 SYFRGYSR 175
              + Y R
Sbjct: 78  KNIKAYHR 85

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 48/72 (66%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           QGNK +A+K+Y  AI+ YT+AI++    +I+++NRA A+  L  +  A++D+  AI +D 
Sbjct: 15  QGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDS 74

Query: 168 SYFRGYSRLGFA 179
           S  +GY R G A
Sbjct: 75  SNVKGYHRRGMA 86

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  K +  AI+KYTEAID+  T  IY++NRA +H  +  +  A+ D + AI +DP
Sbjct: 18  EGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDP 77

Query: 168 SYFRGYSR 175
              + Y R
Sbjct: 78  KNIKAYHR 85

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (61%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  K +  AI+KYT+AID+  T +IY++NRA AH  +  +  A+ D + A+ +DP
Sbjct: 18  EGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDP 77

Query: 168 SYFRGYSR 175
              + Y R
Sbjct: 78  KNIKAYHR 85

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 61/114 (53%), Gaps = 2/114 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN A+  ++Y  AI+ YTEAI +  T +IY++NRA  H  +  +   I D + A+ +DP
Sbjct: 18  RGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDP 77

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQ 221
              + Y R G +     + + A +  K VL  + ++AT   KR  +  +K + +
Sbjct: 78  KNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT--AKRGLDVCEKFIRE 129

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 46/72 (63%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  + +++Y+ AI+ YT+AI++  T++I+Y+NRA AH  L  +  A+ D   AI +D 
Sbjct: 18  EGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDN 77

Query: 168 SYFRGYSRLGFA 179
           +  + Y R G A
Sbjct: 78  NNIKAYHRRGLA 89

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GNK +  K+Y  A++ YT+AI++  T +I+++NRA A   L  +   + D  SA+ +DP
Sbjct: 19  EGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDP 78

Query: 168 SYFRGYSRLGFAK 180
              + Y R G ++
Sbjct: 79  KNIKAYHRRGLSQ 91

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 56/108 (51%), Gaps = 5/108 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GNK +  ++++ A + YT+AI+  PT +I+Y+NRA A+  L  +  A+ D  +AI ++ 
Sbjct: 15  EGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNS 74

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVL-----DIEGDNATDAMKR 210
           S  + Y R G A       + A   +  VL     DI   N  D  ++
Sbjct: 75  SNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIAKNGFDTCEK 122

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  ++Y  AI+KY +AI++  T ++Y++NRA  H  L  +  A +D + A+++DP
Sbjct: 15  EGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDP 74

Query: 168 SYFRGYSRLGFA 179
              + Y R G A
Sbjct: 75  KNVKAYHRRGLA 86

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 70/137 (51%), Gaps = 18/137 (13%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+ +   +Y+ AI+ Y++AI +  T +IY++NRA AH     +  A+ D ++A+ +DP
Sbjct: 18  KGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDP 77

Query: 168 S-----YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-------------DAMK 209
                 + RG S +G  ++ + K +  +    K  DI   NA              +A+ 
Sbjct: 78  KNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENFIREERFKNAIG 137

Query: 210 RDYESAKKRVEQSLNLE 226
              ++AK  + Q+LNLE
Sbjct: 138 GSGDNAKSNICQTLNLE 154

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 53/98 (54%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  + Y  AI+ Y++AI++ PT +I+++NRA A   L  +   + D + A+ +DP
Sbjct: 18  EGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDP 77

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
              + Y R G +     + ++A    + VL  +  +AT
Sbjct: 78  KNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           QGN  +  K +  A + Y++AI++  T +IY++NRA AH  L  +  A+ D   AI +DP
Sbjct: 18  QGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDP 77

Query: 168 SYFRGYSRLGFA 179
              + Y R G +
Sbjct: 78  KNVKAYHRRGLS 89

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  +++  AI  YT+AI +  T +IY++NRA AH  L  +  ++ D + A+ +DP
Sbjct: 18  EGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDP 77

Query: 168 SYFRGYSRLGFA 179
              + Y R G +
Sbjct: 78  KNAKAYHRRGLS 89

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN  +  + Y  AI+ YT+AI++ P  +I+Y+NRA A   L  +  A  D   A+++D 
Sbjct: 18  EGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDS 77

Query: 168 SYFRGYSRLGFA 179
              + Y R G A
Sbjct: 78  KNVKAYHRRGLA 89

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 58/131 (44%), Gaps = 17/131 (12%)

Query: 108 QGNKAMANKEYELAIKKYTEAI----DVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K +  A + YT+ I    DV   N   YANRAA    LK +   I D ++A+
Sbjct: 84  QGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTAL 143

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSL 223
           + +P   + Y R+G A  A  K E A E+ +    I+ DN             K  E  L
Sbjct: 144 TYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDN-------------KSFENLL 190

Query: 224 NLEKTAPEQPR 234
           N+ K   E+ R
Sbjct: 191 NIIKNKEEEIR 201

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (58%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+ +  K+Y  A++ YT AI+   T +I+++NRA A+  L  +  A++D+  AI +D 
Sbjct: 44  EGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDA 103

Query: 168 SYFRGYSRLGFAK 180
              + Y R G A 
Sbjct: 104 GNVKAYHRRGLAH 116

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 68/138 (49%), Gaps = 22/138 (15%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           QGN  +  K+Y  A++ Y++AI++  T +I+++NRA +   L  +  A++D   +I +DP
Sbjct: 18  QGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDP 77

Query: 168 S-----YFRGYSRLGFAKYA----------QGKPEE-----ALEAYKKVLDIEGDNATDA 207
                 + RG S +G  +++          Q KP E     ALE  ++   I  +    A
Sbjct: 78  KNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCERF--IREERFKKA 135

Query: 208 MKRDYESAKKRVEQSLNL 225
           +  D E +K  V  SL L
Sbjct: 136 ISGDGEESKVNVCASLQL 153

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 50/83 (60%), Gaps = 5/83 (6%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           QGN  +  K+Y+ A++ Y++AI++  T +IY++NRA +   L  +  A +D + AI++DP
Sbjct: 16  QGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDP 75

Query: 168 S-----YFRGYSRLGFAKYAQGK 185
                 + RG S +G  ++ + +
Sbjct: 76  KNIKAIHRRGLSYVGLLEFFKAR 98

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 48/101 (47%), Gaps = 4/101 (3%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           Q N     K +  A + YT+ I V       N   +ANRAA    LK Y   + D + A+
Sbjct: 91  QANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAM 150

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            ++P   + + R+G A  A GK +EA +A    L I+ +N 
Sbjct: 151 EINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENV 191

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDV-LPTNAI---YYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K +  A + Y++ IDV    N I    YANRAA    +K Y   I D + A+
Sbjct: 87  QGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQAL 146

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEA 192
            ++P   + Y R+  A  A  + +EALE+
Sbjct: 147 QLNPKNIKCYYRIAKAFTALERLDEALES 175

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 51/83 (61%), Gaps = 1/83 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   NK++E A+K Y+ AI+V   + ++Y+NR+A + SL + ++ ++D  +A+ + P
Sbjct: 102 KGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKP 160

Query: 168 SYFRGYSRLGFAKYAQGKPEEAL 190
            Y +   R   A  + GK  +A+
Sbjct: 161 DYSKCLLRRASANESLGKFADAM 183

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K +  A   Y + I++       N   +ANRAA    LK Y   I D + A+
Sbjct: 86  QGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHAL 145

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEA 192
           +++P   + Y R+G A Y     EEA E+
Sbjct: 146 TLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 44/68 (64%), Gaps = 1/68 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    K++E AI+ YT AI  L  + ++Y+NR+AA+ S+  +++ ++D  +A+ + P
Sbjct: 110 KGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168

Query: 168 SYFRGYSR 175
            Y + + R
Sbjct: 169 DYSKCWLR 176

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 68/131 (51%), Gaps = 11/131 (8%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           +GN+    K+Y  A + YT+ IDV       N   YANRAA    LK + + I+D + A+
Sbjct: 80  RGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKAL 139

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----DAM-KRDYESAKK 217
           S +    + Y R+G A  +  + +E+ E+ +  L I+ +N +      A+ KR  E  ++
Sbjct: 140 SFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRR 199

Query: 218 R-VEQSLNLEK 227
           + +E  + LEK
Sbjct: 200 KDMEMKIKLEK 210

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 4/102 (3%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K +  A + Y +AIDV       N   YANRAA    LK Y   I D + A+
Sbjct: 80  QGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMAL 139

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           S++P   + Y R+  A  A  K ++  EA +  L  + +N +
Sbjct: 140 SLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GNK +  K Y  A + YT+AI+  P N I Y+NRA  +  L  +  ++ DA+ AI +D 
Sbjct: 19  EGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDN 78

Query: 168 SYFRGYSR 175
           +  + Y R
Sbjct: 79  NNLKAYHR 86

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 44/68 (64%), Gaps = 1/68 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   NK+Y+ AI+ Y+ AI+V   + ++Y+NR+A + SL + ++ ++D  +A+ + P
Sbjct: 101 KGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKP 159

Query: 168 SYFRGYSR 175
            Y +   R
Sbjct: 160 DYSKCLLR 167

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDV----LPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN+    K ++ A + YT+ I V       N   +ANRAA    LK Y   I+D   A+
Sbjct: 89  QGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKAL 148

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEA 189
           +++P   + Y R   A ++  K EEA
Sbjct: 149 TINPKNIKCYYRTSKAFFSLSKLEEA 174

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     + Y+ A + Y + ++V       N   + NRAA    LK +   I D + A+
Sbjct: 86  QGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEAL 145

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
             +P   + + R+G A ++  K EEA EA +  L  + +NA
Sbjct: 146 RYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           QGN  +  +++  A + YT+AI++  T +I+++NRA AH     +  ++ D + A+ +D 
Sbjct: 18  QGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDS 77

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE-GDNATD 206
              + Y R G +     + ++A    K VL  + GD A D
Sbjct: 78  KNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAAD 117

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 14/101 (13%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GNK    K+Y  AIK Y  A+D L  + I+Y+N +A + SL + D+ I+ +  A+ ++P
Sbjct: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
           +Y +   R       +    E+LE Y        VL + GD
Sbjct: 187 NYSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 6/117 (5%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDV-LPTNAI---YYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN+    K Y+ A + Y + I++   +N I    ++NRAA    LK Y   + D   A+
Sbjct: 84  QGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQAL 143

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVE 220
             +P+  + + R+  A +   K E+A EA +  L ++ ++A  A+K   +   KR E
Sbjct: 144 QFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA--ALKALLQKVIKREE 198

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 8/77 (10%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN     K++E AIK YT A+  L  + +YY+N +A +SSL  Y++ I+ A  A+++ P
Sbjct: 101 KGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALALRP 159

Query: 168 SYFR-------GYSRLG 177
            Y +        Y +LG
Sbjct: 160 DYSKVLVRRANAYEKLG 176

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K++E AIK + +A  V P  A  Y  +   HSS   +D A      A++ DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG +    G+ +EAL  ++K   I   N 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV 637

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 11/134 (8%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           +QG++  +N  ++ A   Y +A+   P +   Y     +   L +YDEA+   E A S++
Sbjct: 574 LQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSIN 633

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKR--------DYESAKKR 218
           P         G A       E+AL  Y+   +++  ++    KR         Y  A + 
Sbjct: 634 PINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQY 693

Query: 219 VEQSLNLEKTAPEQ 232
            E+   L K AP++
Sbjct: 694 FEE---LTKLAPDE 704

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 13/127 (10%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDV----LPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K ++ A   Y +A+DV    L  N   Y N AA    +K Y   I     A+
Sbjct: 76  QGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREAL 135

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN---------ATDAMKRDYES 214
            ++    + + R+G A    G+ E++LEA +  L ++ +N         AT+ +KR  E 
Sbjct: 136 KLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRKKEL 195

Query: 215 AKKRVEQ 221
             + + Q
Sbjct: 196 ENRTLAQ 202

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 4/100 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDV----LPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K ++ A + Y + I++       N   YANRAA    +K Y   + D ++A+
Sbjct: 84  QGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTAL 143

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             +P   + Y R+G A  A    EEA ++ +  L ++  N
Sbjct: 144 QYNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSN 183

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDV----LPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN+    K ++ A + Y++ + V       N   YANRAA    LK Y   I+D   A+
Sbjct: 89  QGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKAL 148

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEA 189
           +++P   + Y R   A +   K EEA
Sbjct: 149 TINPKNVKCYYRTSKAFFQLNKLEEA 174

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN+A   K+Y  A   Y   I+V       N + + N+AA    +K Y   I D + A+
Sbjct: 80  QGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCKKAL 139

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT--DAMKRDYESAKKRVEQ 221
           S +P   + Y R+  A  A  K +E+ E+ +  L ++  N++  + +K   +  +++   
Sbjct: 140 SFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLNLLKTIIKKQEEKTAY 199

Query: 222 SLNLEKTAPEQ 232
            L LE+   E+
Sbjct: 200 RLKLEREKQEK 210

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 139 YANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVL- 197
           Y N +A +  L+E D+A + +   I ++P   +GY R+G     QGK  EA + YKK L 
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLL 133

Query: 198 ----------DIEGDNATDAMKRDYESAKKRV-EQSL 223
                      +  +   D +K+  +  KKR+  QSL
Sbjct: 134 MSREMLQKFDIVVPEKFRDIIKQQRDIVKKRINNQSL 170

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDV----LPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN+    K ++ A + YT+ + V       N   +ANRAA    LK Y + ++D   A+
Sbjct: 89  QGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKAL 148

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEA 189
           +++P   + Y R+  + +   K EEA
Sbjct: 149 TINPKNIKCYYRISKSFFQLRKLEEA 174

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAIS 164
           GN+     EY+LAI++Y + I + PTNA+ Y+N A A+   +  DEA    E  +S
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGLS 97

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 130 DVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEA 189
           D L  +  ++ +    H    EYD AI+     IS++P+   GYS L  A      P+EA
Sbjct: 29  DKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEA 88

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+     ++E AIK Y  A+  L  + IYY+N +A ++SL +Y++ I+ A  A+ + P
Sbjct: 116 KGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174

Query: 168 SYFRGYSRLGFAKYAQG 184
           ++ +   R   A  A G
Sbjct: 175 TFSKVLMRRALAYEAMG 191

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    K+YE AIK Y+ A+  L  + ++Y+NR+A    L + ++ ++D  +A+ + P
Sbjct: 104 KGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKP 162

Query: 168 SYFRGYSRLGFAKYAQGKPEEAL 190
            Y +   R   A  + G   +A+
Sbjct: 163 DYSKCLLRRATANESLGNFADAM 185

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    K+YE A+K Y  A+ +L  + ++Y+N +A + SL E D+ I+ +  A+ + P
Sbjct: 114 KGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKP 172

Query: 168 SYFRGYSR 175
            Y +   R
Sbjct: 173 DYSKALLR 180

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 34/70 (48%)

Query: 133 PTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEA 192
           P   +   NRAA    L + D A+ DA   I+VD    +GY R G      G+ EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 193 YKKVLDIEGD 202
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 15/63 (23%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQNMMQDPSIRQMAEGFTSGGGTPNLSDLMK---NPALR 321
           +PQ+MQ AQ ++  NPG MQN+QNM              +GGG P+++++MK   +P ++
Sbjct: 527 SPQMMQQAQQRLRQNPGMMQNMQNMFGG-----------AGGGMPDMNEMMKMMQDPNMQ 575

Query: 322 NMA 324
            MA
Sbjct: 576 KMA 578

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K +  AIK + +A  V P  A  Y  +   ++S   +D A +    AI+ DP 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG      G+ EEAL  ++K   I   N  
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVV 631

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K+++ AIK + +A  + P  A  Y  +   HSS    D A      A++ DP 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 4/100 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNA----IYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K +  A   Y + I+V   +A    +   NRAA    LK Y   I D   A+
Sbjct: 83  QGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREAL 142

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            ++P   + + R+G A     K EEA EA    L ++ +N
Sbjct: 143 KLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTEN 182

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K+++ AIK + +A  + P  A  Y  +   HSS    D A      A++ DP 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 46/97 (47%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G  AM   +YE A+  + +A  + P N +       +   L   ++A++  E A  + P+
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
                 ++G   Y+  +   AL+ +++++ +  D+AT
Sbjct: 675 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 711

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   ++ YE AIK Y  A+  L  + ++Y+NR+A +  L + ++ ++D  +A+ + P
Sbjct: 101 KGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159

Query: 168 SYFRGYSRLGFAKYAQGKPEEAL 190
            Y +   R   A  + G   +A+
Sbjct: 160 DYSKCLLRRATANESLGNYADAM 182

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%)

Query: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184
           + +A+++ P ++  Y +RA  +  ++++D+A KD + A   DPS    Y +L    Y + 
Sbjct: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421

Query: 185 K 185
           K
Sbjct: 422 K 422

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLP----TNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN+    K ++ A + Y + ++V       N   +AN+AA    LK Y   I+D   A+
Sbjct: 89  QGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCSKAL 148

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEA 189
           S++P   + Y R   A +   K EEA
Sbjct: 149 SINPKNTKCYYRTSKAFFQLNKLEEA 174

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K+++ AIK + +A  + P  A  Y  +   HSS    D A      A++ DP 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 636

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 14/101 (13%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN      ++E AIK Y  AI+ L  N I+Y+N +A + SL + +E IK    A+ + P
Sbjct: 117 KGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKP 175

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
            Y +   R       +    E LE Y        VL + GD
Sbjct: 176 DYSKVLLR-------RANANEKLENYADAMFDLSVLSLNGD 209

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISV 165
           +GN +  N  Y  AI  Y   I + P+N I Y+N+A A      +DEAI   E  + +
Sbjct: 9   KGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN    +K ++ AIK Y  AI++ P + ++Y+N +A + S  + ++ ++    A+ + P
Sbjct: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKP 190

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            + +   R   A  + G   +A+     VL + GD
Sbjct: 191 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 4/86 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K Y+ A   Y++ I+V       N   Y NRAA    L+ +   I D + A+
Sbjct: 85  QGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKAL 144

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEA 189
           + +    + + R+G A +   K EEA
Sbjct: 145 NFNAKCVKAFYRMGQAYFKLKKLEEA 170

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     ++++ AI+ + +A +V P  A  Y  +   HSS    D A      AI+ DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      G+ EEAL  ++K   I   N 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV 611

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 33/71 (46%)

Query: 127 EAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKP 186
           E ++  P     + +    +S  +++DEAI+  E A  VDP +  GY+  G    +    
Sbjct: 500 ELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSI 559

Query: 187 EEALEAYKKVL 197
           + A   Y+K +
Sbjct: 560 DMAKTCYRKAI 570

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+      Y++A + Y + +D+ P N I Y+N+A A   L  Y E ++     ++  P
Sbjct: 9   EGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTP 68

Query: 168 S 168
           +
Sbjct: 69  N 69

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 14/101 (13%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    K+Y+ A+K Y  A+ V+  + ++Y+N +A + SL + D+ ++++  A+ + P
Sbjct: 107 RGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKP 165

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
            Y +   R       +    E+LE Y        VL + GD
Sbjct: 166 DYSKALLR-------RASANESLENYADAMFDLSVLSLNGD 199

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K++E AI+ + +A  + P  A  Y  +    SS   +D A K    AI+ DP 
Sbjct: 558 GNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPR 617

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  +G      G  +EAL  ++K   I   NA 
Sbjct: 618 HYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAV 654

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 55/115 (47%), Gaps = 5/115 (4%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVL----PTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN     K Y+ A + Y   ID+       N   ++NRAA    LK Y   + D + A+
Sbjct: 84  QGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRAL 143

Query: 164 SVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN-ATDAMKRDYESAKK 217
             +    + Y R+  A     K E+A +A +  L ++ +N A +A++++ +  K+
Sbjct: 144 QYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNVDKKKQ 198

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%), Gaps = 2/95 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   NK+Y+ AIK Y  A++ L  + ++Y+N +A + S+ +  + ++ +  A+ + P
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            Y +   R   A    GK  +A+     VL + GD
Sbjct: 164 DYSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQNMMQDPSIRQMAEGFTSGGGTPNLSDLMK---NPALR 321
           +PQ+MQ AQ ++  NPG M+   NMM          G  S GG PN++D+MK   +P ++
Sbjct: 472 SPQMMQQAQQRLRQNPGMME---NMMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQ 528

Query: 322 NMA 324
            MA
Sbjct: 529 EMA 531

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN     K +  AIK Y  AI++ P + ++Y+N +A + S  + D+ ++    A+ + P
Sbjct: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            + +   R   A  + G   +A+     VL + GD
Sbjct: 197 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN A  N  +  A + Y + I + P N I Y+NRA A   L+++ E I   +  +
Sbjct: 10  QGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 52/95 (54%), Gaps = 2/95 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   +K+ E AIK Y  A+  L  + ++Y+N +A + ++ + D+ I+ +  A+ + P
Sbjct: 164 KGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALELKP 222

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            Y +   R   A  A G  +EAL  +  +L + G+
Sbjct: 223 DYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAIS 164
           ++GN    N +YE AI  Y +A  +  +N IY++N A A   L+ + EA+   +  ++
Sbjct: 46  VKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGLN 103

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 14/101 (13%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    K+Y+ A+K Y  A+  L  + ++Y+N +A + S+ + D+ ++++  A+ + P
Sbjct: 112 KGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
            Y +   R       +    E+LE Y        VL + GD
Sbjct: 171 DYSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN     K+YE AI  Y  A+  L  + ++Y+N AA + SL+   EAI+    A+ ++P
Sbjct: 92  RGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALELNP 150

Query: 168 SY 169
            Y
Sbjct: 151 DY 152

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184
           + +AID+ P  A  Y +R   +  +++Y++A +D + A   DP+    Y +L    Y +G
Sbjct: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREG 413

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   NK+Y+ AIK Y  A++ L  + ++Y+N +A + S+ +  + ++ +  A+ + P
Sbjct: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            Y +   R   A    G   +A+     VL + GD
Sbjct: 164 DYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184
           + +A+ + P N+  Y +R   +  L+ YD+A KD + A  +DP     Y +L    Y + 
Sbjct: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 185 K 185
           K
Sbjct: 446 K 446

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN     K +  AIK Y  AI++ P   ++Y+N +A + S  + ++ I+    A+ + P
Sbjct: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            + +   R   A  + G   +A+     VL + GD
Sbjct: 193 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%)

Query: 136 AIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKK 195
           A+   NR     + K ++EAIK  + AI +DP+    YS +     + G  E+ +E   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 196 VLDIEGDNATDAMKR 210
            L+I+ D++   ++R
Sbjct: 187 ALEIKPDHSKALLRR 201

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 45/107 (42%), Gaps = 11/107 (10%)

Query: 133 PTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLG--FAKYAQGKPEEAL 190
           P   I   NRAA+   +    +A+ DA+  I VD    +GY R G    K AQ K  EAL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EAL 124

Query: 191 EAYKKVL-------DIEGDNATDAMKRDYESAKKRVEQSLNLEKTAP 230
             Y++ L        +  +          E  K  V + LNL+K  P
Sbjct: 125 YVYREGLSKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTP 171

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN     K +  AIK Y  AI++ P + ++Y+N +A + S  + ++ ++    A+ + P
Sbjct: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            + +   R   A  + G   +A+     VL + GD
Sbjct: 190 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%)

Query: 134 TNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAY 193
           T A+   N+     + K + EAIK  + AI +DP+    YS +     + G   + LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 194 KKVLDIEGDNATDAMKR 210
            K L+I+ D++   ++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   NK+Y+ AIK Y  A++ L  + ++Y+N +A + S+ +  + ++ +  A+ + P
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            Y +   R   A    G   +A+     VL + GD
Sbjct: 164 DYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184
           + +A+ +   N+  Y +R   +  L+ YD+A KD + A  +DP     Y +L    Y + 
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 185 KPEEA----LEAYKK------VLDIEGDNATDAMKRDYESAKKRVEQSLNLE 226
           K ++      EA +K      V +   +  TD  K D+E A K+ + ++ LE
Sbjct: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFEKALKQYDLAIELE 495

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    ++YE A+K Y  A+D L  + ++Y+N +A + SL   ++ ++ +  A+ + P
Sbjct: 105 KGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163

Query: 168 SYFRGYSR 175
            Y +   R
Sbjct: 164 DYSKALLR 171

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 20/117 (17%)

Query: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184
           + +A+DV P +A  Y +R   H   ++Y++A  D E A   D S    Y +L    Y +G
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 185 KPE-----------------EALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLN 224
           K +                 E    Y +VL  +GD   DA  + Y+ A KR+E+SL+
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD--FDAASKQYDIA-KRLEESLD 479

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+   NK+Y+ AIK Y  A++ L  + ++Y+N +A + S+ +  + ++ +  A+ + P
Sbjct: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 168 SYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
            Y +   R   A    G   +A+     VL + GD
Sbjct: 164 DYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K+++ AIK + +A  + P  A  Y  +   HSS    D A      A++ D  
Sbjct: 558 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQ 617

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 618 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 654

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 46/97 (47%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G  +M   +YE A+  + +A  + P N +       +   L   ++A++  E A  + P+
Sbjct: 626 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 685

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
                 ++G   Y+  +   AL+ +++++ +  D+AT
Sbjct: 686 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 722

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 54/123 (43%), Gaps = 13/123 (10%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G    AN+E+   I  +  A++V P + + +    A+ ++    +EAI+    A+++ PS
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLD-------------IEGDNATDAMKRDYESA 215
           + R    L  +    G  +EA E+    L              ++ +N  + +KR + + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQSNNILETLKRSFVAM 542

Query: 216 KKR 218
            +R
Sbjct: 543 DRR 545

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN    NK+++ AI  + +AI + P  A  Y  +   +S+   +D A      A++++ +
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKK 195
           ++     LG      GK EEAL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%)

Query: 135 NAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYK 194
           N I + +    HS  K++DEAI     AI +DP +   Y+  G         + A   ++
Sbjct: 491 NPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFR 550

Query: 195 KVLDIE 200
           K L IE
Sbjct: 551 KALTIE 556

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN       Y  A+  Y + I   P N + Y+N+A A   L EY +AI+  +  +
Sbjct: 10  QGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    K  E AIK Y  A++    + ++YAN +A + SL ++++ +++   A+ + P
Sbjct: 112 KGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKP 170

Query: 168 SY 169
            Y
Sbjct: 171 DY 172

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     K+++ AI+ + +A  + P     Y  +   + S+  YD A      AIS D  
Sbjct: 597 GNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLH 656

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  +G      G+ E+AL  ++K   I   NA
Sbjct: 657 HYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA 692

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G  +M   EYE A+  + +A  + P+NAI           L   ++A+   E A  + P+
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
                 +     Y+  K  +AL+A+++++ I  + AT
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDP 167
           +GN+    K+++ AIK Y  A++ L  + ++Y+NR+A + S+ + ++ ++D  +A+ +  
Sbjct: 108 KGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKS 166

Query: 168 SYFRGYSRLGFAKYAQGKPEEAL 190
            Y +   R   A  + G   +A+
Sbjct: 167 DYSKCLLRRASANESLGNYADAM 189

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 141 NRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAY 193
           NRAA+   L + D+A+KDA++ I V+P   + Y R G       K +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 47/96 (48%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN    N++++ AIK   +A  + P  A  Y  +   +S+   +D A      A++++P+
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 540

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLK--EYDEAIKDAESAIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S +K  +YDEA+   E A S
Sbjct: 477 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 534

Query: 165 VDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKR 210
           ++P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 535 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 48/96 (50%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN    N++++ AIK   +A ++ P  A  Y  +   +S+   +D A      A++++P+
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 559

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLK--EYDEAIKDAESAIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S +K  +YDEA+   E A S
Sbjct: 496 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 553

Query: 165 VDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKR 210
           ++P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 554 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%)

Query: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180
           AIK + + ++  P + I + +  A  ++ K YD AI+   + I + PS+ R    LG   
Sbjct: 410 AIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNLGSTL 469

Query: 181 YAQGKPEEALEAYKKVLDIEG 201
              G+ +  +E+    L ++G
Sbjct: 470 VKNGELQRGIESLLTALVMQG 490

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           AN E++  I  +  A+ V P + + +    A+ ++    +EAI+    A+ + PS+ R  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEGD 202
             L  +    G  +EA E     L   D+EG+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN     +++E AIK + +A  +    A  Y  +   HSS    D A      A++ DP 
Sbjct: 489 GNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQ 548

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      G+ ++AL  ++K  +I   N 
Sbjct: 549 HYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV 584

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 17/91 (18%)

Query: 119 ELAIKKYTEAIDVLPT---------NAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSY 169
           E+  K++    + LP            ++Y+N         E+D+ I   ++A+ + P  
Sbjct: 413 EIVTKQFLNIANKLPNADADVQLGLGLLFYSN--------NEFDKTIDCFKTALVIHPED 464

Query: 170 FRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
              ++RLG +     +PEEA++AY K L ++
Sbjct: 465 ELMWNRLGASLANSSRPEEAIQAYHKALQLK 495

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 37/78 (47%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           +N E++  I  +  A+ + P + + +    A+ ++    +EAI+    A+ + PS+ R  
Sbjct: 443 SNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVRAR 502

Query: 174 SRLGFAKYAQGKPEEALE 191
             L  +    G  +EA E
Sbjct: 503 YNLAVSSINIGCYKEAAE 520

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 55/125 (44%), Gaps = 6/125 (4%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G   M   +Y  A + + +A++    N I++ +    +  + +Y +A+     AI ++P 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 169 YFRGYSRLG-FAKYAQGKPEEALEAYKKVLDIEGDNA-----TDAMKRDYESAKKRVEQS 222
               +  LG   +    +  +AL+AYK+   +E DN       DA+     + +  + Q 
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPDNTHIRERLDALTNQLSTQQGNINQK 412

Query: 223 LNLEK 227
           +  +K
Sbjct: 413 IEYQK 417

>ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR088C
          Length = 285

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 48/109 (44%), Gaps = 13/109 (11%)

Query: 119 ELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGF 178
           EL +KK    ++  P +A  +   A  +  L ++D+AI   E  + + P  +  +++L  
Sbjct: 142 ELWMKKLLSLLEKFPLDAELWWTLAMEYYKLGQFDQAIYCFEEVLLISPLAYSAFAQLAE 201

Query: 179 AKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEK 227
             Y +   E+ +             +TD ++   E+A + VE S N  K
Sbjct: 202 VLYCKAMREKPV-------------STDVLQEALENALRAVELSSNCLK 237

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 120 LAIKKYTEAIDVLPTN-AIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGF 178
           + IKK+    + LP + A     R   + +  ++D+ I+  + ++ ++P+    ++RLG 
Sbjct: 414 VMIKKFNRLAESLPEHDAKLELIRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGA 473

Query: 179 AKYAQGKPEEALEAYKKVLDI 199
           +     KPE+A++AY + L++
Sbjct: 474 SLANSNKPEDAIQAYHRALNL 494

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAI 156
           +GN      +YE A+  Y +AI   P+N I Y+N A     L+++ EA+
Sbjct: 10  KGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAV 58

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 139 YANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYK 194
           Y N +A +  L+  D+A   ++  I+VDP   +GY  +G     Q K + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 26/66 (39%)

Query: 267 PQLMQAAQKMMS-NPGAMQNIQNM-------------------------MQDPSIRQMAE 300
           PQLMQ AQ+ +S NP  M+N+ NM                         MQDP +++MA+
Sbjct: 473 PQLMQQAQQKLSQNPNLMKNMMNMFGGAGGMPGMGGAGGMPDMNEMMKMMQDPGMQEMAK 532

Query: 301 GFTSGG 306
            F  GG
Sbjct: 533 QFGMGG 538

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI--SV 165
           +GN+     +Y  A K Y   I   PTN I Y+N+A +    + +D+AI+   + +  S 
Sbjct: 9   EGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLYSS 68

Query: 166 DPSY 169
           DP +
Sbjct: 69  DPEH 72

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 151 EYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ I   ESA+ V+P+    ++RLG +     + EEA++AY + L ++
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 35/55 (63%)

Query: 146 HSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           H S  ++D+ ++  ++A+ ++P+    ++RLG +     + EEA++AY K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 41/87 (47%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           +N +++  ++ +  A+ + P + + +    A+ ++    +EAIK    AI++ PS+ R  
Sbjct: 453 SNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRAR 512

Query: 174 SRLGFAKYAQGKPEEALEAYKKVLDIE 200
             L  A    G  +EA      VL + 
Sbjct: 513 YNLAVASMNIGCYQEAAGHLLTVLKMH 539

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISV 165
           QGN     ++Y  A++ Y + ++   TN I ++NRA     L    EA K  ++ +++
Sbjct: 10  QGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGLAL 67

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 151 EYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ I   ESA+ V+P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 151 EYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ I   ESA+ V+P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           +GN+      Y  AIK Y + I++ P N I Y+N+A A     +  EA++  +  +
Sbjct: 9   EGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           + GN     K++  AIK + +A  +    A  Y  +   H++ + YD A      AI+ D
Sbjct: 526 VVGNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACD 585

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           P ++  Y  LG      GK ++AL  ++K   I   NA
Sbjct: 586 PQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA 623

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           GN       Y  A+  Y + I   P N + Y+N+A A   L EY  AI+  +  +
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGL 69

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 151 EYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ I   ESA+ V+P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 141 NRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    + E ++A++DA     ++P   + + R G       K ++A   YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 201 GDNATDAMK 209
            + ATD++K
Sbjct: 158 ANFATDSLK 166

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 9/91 (9%)

Query: 110 NKAMANKEYELAIKKYTEAIDV-LPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           N+ +  +  ++A K  T   DV L    ++Y+N         E+D+ I   ++A+ V P+
Sbjct: 431 NEIVTKQFLQVANKLETADADVQLGLGLLFYSN--------NEFDKTIDCFKAALKVSPN 482

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
               ++RLG +     + EEA++AY K L++
Sbjct: 483 DELLWNRLGASLANSNRSEEAIQAYHKALNL 513

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 37/76 (48%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           +N E++  I  +  A+ V P + + +    A+ ++    +EAI+    A+++ PS+ R  
Sbjct: 462 SNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRAR 521

Query: 174 SRLGFAKYAQGKPEEA 189
             L  +    G  +EA
Sbjct: 522 YNLAVSSINIGCYKEA 537

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 151 EYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
           E+D+ I   ++A+SV+P+    ++RLG +     + EEA++AY K L +
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQL 459

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 54/121 (44%), Gaps = 16/121 (13%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           A+ E++  I  +  A+ V P + + +    A+ ++    +EAI+    A+ + PS+ R  
Sbjct: 408 ADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVRAR 467

Query: 174 SRLGFAKYAQGKPEEALE---AYKKVLDIEG-------------DNATDAMKRDYESAKK 217
             L  +    G  +EA E   +  K+ ++EG             +N  + +KR + +  +
Sbjct: 468 YNLAVSSINIGCYKEAAEYLLSALKMHEVEGVSQNGTANPVSGNNNILETLKRAFVAMDR 527

Query: 218 R 218
           R
Sbjct: 528 R 528

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLP----TNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           +G++   N +Y  A+++Y ++++ LP       I Y+N  A    + EY ++I+D + A+
Sbjct: 420 RGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIAL 479

Query: 164 SVDP 167
           S+ P
Sbjct: 480 SLFP 483

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 15/120 (12%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           AN E++  I  +  A+ V P +   +    A+ ++    +EAI+    AI + P++ R  
Sbjct: 433 ANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRAR 492

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG------------DNATDAMKRDYESAKKR 218
             L  +    G  +EA E     L   ++EG             N  + +KR + + ++R
Sbjct: 493 YNLAVSSMNIGCYKEAAEQLLTALSMHEVEGVVMSAGSGTVPSSNILETLKRAFMALERR 552

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%)

Query: 139 YANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLD 198
           Y     AH   +   E+I+  +SA+ V+P+    +  LG A Y+ G+ E +++ ++K L+
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 199 IEGDNA 204
           +   NA
Sbjct: 744 VSPGNA 749

>Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {ON}
           YPR088C (REAL)
          Length = 539

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 24/64 (37%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQN-----------------------IQNMMQDPSIRQMAEG 301
           +PQ+MQ AQ K+  NPG MQN                       +  MMQDP +++MA+ 
Sbjct: 476 SPQMMQQAQQKLKQNPGLMQNMMSMFGGSGMGGGMGGGMPDMNEMMKMMQDPQMQEMAKQ 535

Query: 302 FTSG 305
           F  G
Sbjct: 536 FGMG 539

>KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 132 LPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK--YAQGKPEEA 189
            P + + +   A  +  + +  EA K    +  +DPS+  GYS LGFA    A+G+ E+A
Sbjct: 428 FPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSF--GYSWLGFAHTYVAEGEHEQA 485

Query: 190 LEAY 193
           L AY
Sbjct: 486 LSAY 489

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNA----IYYANRAAAHSSLKEYDEAIKDAESAI 163
           +G +   N +Y  + ++Y ++++ LP N     I Y+N  A+   + EY +++K++ SA+
Sbjct: 409 RGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSSSAL 468

Query: 164 SVDP 167
            + P
Sbjct: 469 EMFP 472

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 14/119 (11%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           AN++Y+  I  +  A+ V P + + +    A+ ++    +EAI+    A+ + PS+ R  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG-----------DNATDAMKRDYESAKKR 218
             L  +    G  +EA E     L   ++EG            N  + +KR + + ++R
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASGGSIPSTNILETLKRAFIAMERR 552

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 52/117 (44%), Gaps = 12/117 (10%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           +N +Y+  +  +  A+ V P + + +    A+ ++    +EAI+    A+ + P++ R  
Sbjct: 438 SNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRAR 497

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG---------DNATDAMKRDYESAKKR 218
             L  +    G  +EA E     L   ++EG         +N  + +KR +   ++R
Sbjct: 498 CNLAVSCMNMGCYKEAAEYLLTALSMHEVEGILPSETPASNNLIETLKRAFIGMERR 554

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 137 IYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKV 196
           ++Y+N         +YD+ +    +A++V P     ++RLG +     + EEA++AY+K 
Sbjct: 435 LFYSN--------DDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKA 486

Query: 197 LDIE 200
           L ++
Sbjct: 487 LQLK 490

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 10/94 (10%)

Query: 117 EYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRL 176
           +YE  +  + +A  + P N I       A   L   + A+++ + A  + P      S L
Sbjct: 493 QYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM-----SSL 547

Query: 177 GFAKYAQ-----GKPEEALEAYKKVLDIEGDNAT 205
              K AQ     GK   ALE+++K++ I  D AT
Sbjct: 548 ALFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 42/89 (47%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           + GN     K+++ AIK + +A ++ P  A  Y  +   ++S + +D A      A++ D
Sbjct: 499 VLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACD 558

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKK 195
             ++  Y  LG      G  + +L  ++K
Sbjct: 559 SQHYNAYYGLGTCDSQNGNHDRSLLFFEK 587

>ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088C SRP54 Signal recognition particle
           (SRP) subunit (homolog of mammalian SRP54) contains the
           signal sequence-binding activity of SRP interacts with
           the SRP RNA and mediates binding of SRP to signal
           receptor contains GTPase domain
          Length = 536

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQNMM 290
            PQ+MQ AQ ++  NPG M+N+QNM+
Sbjct: 468 TPQMMQQAQQRLKQNPGLMKNMQNML 493

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISV 165
           +GN   +  EYE A+  Y  A    P+N ++ AN + A   L+ +++A+   + A+ +
Sbjct: 14  KGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALEI 71

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           GN    +  Y  A++ Y + I+V P N I Y+N A +   L +Y EA++   + +
Sbjct: 10  GNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGL 64

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEA 155
           I+GN A     +  A+  Y +AI   PTN + Y+N A A   L  Y +A
Sbjct: 9   IKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G  A+   + E+A + +T    + PT+A+ ++N +AA+    +  EA    + AIS D  
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ 699

Query: 169 Y-FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
             +R +           + E+ L A K++++I+ D +
Sbjct: 700 KNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKS 736

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 151 EYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +YD+ I   ++A++V+P+    ++RLG +     + EEA+ AY + L ++
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLK 557

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLP----TNAIYYANRAAAHSSLKEYDEAIKDAESAIS 164
           G +     +Y+ A+ +Y ++++ LP       I Y+N  AA   + EY +++KD + A+ 
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 165 VDPSYFRGYSRL 176
           + P   + +++ 
Sbjct: 613 LFPKNDKQWTQF 624

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 17/90 (18%)

Query: 120 LAIKKYTEAIDVLP---------TNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYF 170
           L I++Y    + LP            ++YAN        +++D+ I    +A++V P   
Sbjct: 400 LIIEQYLRVANALPEVDPDVQLGLGILFYAN--------EDFDKTIDCFRAALAVRPDDE 451

Query: 171 RGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
             ++RLG +     + EEA++AY + + ++
Sbjct: 452 CMWNRLGASLANSNRSEEAIQAYHRAIQLK 481

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           GN    NK+++ AIK + +A  + P     Y  +   +SS   +D A      A++ +  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++     LG      G+ EE+L  ++K   I   N 
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNV 516

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 47/100 (47%), Gaps = 1/100 (1%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G   + + + ELA + ++  + + PT+   ++N +AA+  L +  EA    + A+S D  
Sbjct: 638 GCVGLESGKMELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQAVSTDAR 697

Query: 169 Y-FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDA 207
             +R +           + ++ L A K ++ I+ D   +A
Sbjct: 698 KNWRIWENYMLVAMKLNEWQDVLMACKNLVTIKRDRVGEA 737

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           QGN       Y  A+  Y   I   P N + Y+N+A A   L E+ +AI+  +  +
Sbjct: 14  QGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGL 69

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 155 AIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           +I+  +SAI VDP+    +  LG A  A G+ E +++ ++K ++++G +
Sbjct: 688 SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSH 736

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 132 LPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK-YA-QGKPEEA 189
            P +++ +      + S+    EA K    A  +DP++  GY+ LGFA  YA +G+ E+A
Sbjct: 418 FPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNF--GYAWLGFAHTYAVEGEHEQA 475

Query: 190 LEAY 193
           L AY
Sbjct: 476 LSAY 479

>Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL313C
           - Protein required for cell viability [contig 124] FULL
          Length = 904

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 5/98 (5%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           I+ +  +  K +E  I KY  A + L   A YY N  A     K+Y   +K    ++S+ 
Sbjct: 578 IRQDPELWKKSWE--IGKYVNAKNSL---ARYYYNPPATSGLSKDYVACLKHLNESLSLY 632

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           P  F  +   G      GK E A EA+ + + ++  ++
Sbjct: 633 PLAFDTWYFYGCVGLECGKMELAAEAFTRCVSLDSTHS 670

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 34/56 (60%)

Query: 145 AHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           AH   +E  ++I+  +SA+ VDP+    +  LG A +A G+ E +++ + K ++++
Sbjct: 704 AHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQ 759

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 137 IYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKV 196
           ++Y+N         +YD+ +    +A++V P     ++RLG +     + EEA++AY+K 
Sbjct: 428 LFYSN--------DDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKA 479

Query: 197 LDI 199
           L +
Sbjct: 480 LQL 482

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 51/117 (43%), Gaps = 12/117 (10%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           +N +Y+  +  +  A+ V P + + +    A+ ++    +EAI+    A+ + P++ R  
Sbjct: 431 SNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRAR 490

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG---------DNATDAMKRDYESAKKR 218
             L  +    G  +EA E     L   ++EG          N  + +KR +   ++R
Sbjct: 491 CNLAVSCMNMGCFKEAAEYLLTALSMHEVEGILPSETPASSNLIETLKRAFIGMERR 547

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 139 YANRAAAHSSLKEYDEAIKDAESAISVDP----SYFRGYSRLGFAKYAQGKPEEALEAYK 194
           Y N   A  +LK+YDE++K     + +D        + Y R+G + +A+ + +EAL+ Y+
Sbjct: 289 YLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYR 348

Query: 195 KVLD 198
              D
Sbjct: 349 LCRD 352

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTNA----IYYANRAAAHSSLKEYDEAIKDAESAI 163
           +G+    N +Y  A+++Y ++++ LP +     I Y+N  AA   + EY   +K A+ A+
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 164 SVDP 167
            + P
Sbjct: 423 KLFP 426

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 141 NRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    + +  +A+KDA  A   +P   + Y R G          +ALE Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 201 GDNATDAMKRDYE 213
           G  A   M R Y 
Sbjct: 131 GVKAIRDMTRKYH 143

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 132 LPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK-YA-QGKPEEA 189
            P +++ +      + S+    EA K    A  +DP++  GY+ LGFA  YA +G+ E+A
Sbjct: 428 FPKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNF--GYAWLGFAHTYAVEGEHEQA 485

Query: 190 LEAY 193
           L AY
Sbjct: 486 LSAY 489

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQNMMQDPSIRQMAEGFTSGGGTPNLSDLMK---NPALR 321
           +PQ+MQ AQ ++  NPG M+N+ +M    +              PN++D+MK   +P ++
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMDMFGGANGGAGG--------MPNMNDMMKMMQDPKMQ 525

Query: 322 NMA 324
            MA
Sbjct: 526 QMA 528

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 10/100 (10%)

Query: 141 NRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    L +  +A+KDA  A+  +P   + Y R G         + AL+ Y+     E
Sbjct: 76  NRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKGKILQKLQLDDMALKNYE-----E 130

Query: 201 GDNATDAMKRDY-----ESAKKRVEQSLNLEKTAPEQPRD 235
           G    D M+  Y     +   + VE   +L K+   + RD
Sbjct: 131 GLQKADEMRSRYGLEPPQKLSRIVEHQKSLIKSRITETRD 170

>Smik_14.5 Chr14 (8441..11695) [3255 bp, 1084 aa] {ON} YNL327W
           (REAL)
          Length = 1084

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 11/77 (14%)

Query: 119 ELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYS-RLG 177
           E  +  Y+  ID         A + A H+SL      IKDA+S++S + S   GYS  +G
Sbjct: 859 ESVVASYSTTID---------AAQYAKHTSLVAVS-TIKDAKSSLSTEESVVTGYSTTVG 908

Query: 178 FAKYAQGKPEEALEAYK 194
            A+YA+     A+   K
Sbjct: 909 AAQYAKHTSLVAVSTIK 925

>CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088c
          Length = 532

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 26/65 (40%)

Query: 267 PQLMQAAQ-KMMSNPGAMQN-------------------------IQNMMQDPSIRQMAE 300
           PQLMQ AQ K+  NPG M+N                         +  MMQDP ++ MA 
Sbjct: 467 PQLMQQAQQKLRQNPGLMKNMMNMFGGAGGMGGMGGPGGMPDMNEMMKMMQDPQMQDMAR 526

Query: 301 GFTSG 305
            F  G
Sbjct: 527 QFGMG 531

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 141 NRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYK 194
           N +A +  L +  +A+  A   + VDP   + Y RLG     Q + ++A E YK
Sbjct: 78  NMSATYEKLGDLKKALSYATKMVEVDPYNLKCYIRLGKILQKQVRDKQAYETYK 131

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 10/102 (9%)

Query: 109 GNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPS 168
           G   +   +YE  +  + +A  + P N I       A   L   ++A++  + A  + P 
Sbjct: 484 GMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQPV 543

Query: 169 YFRGYSRLGFAKYAQ-----GKPEEALEAYKKVLDIEGDNAT 205
                S L   K AQ     GK   ALE ++K++ I  D AT
Sbjct: 544 -----SSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEAT 580

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 145 AHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
           AH   +E  ++I+  +SA+ VDP+    +  LG A +A G+ E +++ + K + +
Sbjct: 711 AHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQL 765

>KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 924

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 5/94 (5%)

Query: 107 IQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVD 166
           I+ +  +  K +E  I KY  A + L   A YY N  ++    K+Y+  +K    ++S+ 
Sbjct: 598 IRQDPNLWLKSWE--IGKYVNAKNSL---ARYYYNPPSSSGLTKDYNACLKHLNESLSLY 652

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           P  F  +   G      GK + A EA+ + + ++
Sbjct: 653 PLAFDTWYFYGCIGLECGKTDLAAEAFTRCVSLD 686

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 29/141 (20%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLPTN----AIYYANRAAAHSSLKEYDEAIKDAESAI 163
           +G +     +Y  A ++Y ++++ LP N     + Y+N  AA   + EY   + D ESA+
Sbjct: 279 RGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESAL 338

Query: 164 SV---DPSYF----------RGYSRLGFAKYAQGKPE--EALEAYKKVLD-----IEGDN 203
            +   DP+ +          R +  + + K    + E  E +E Y++ L      IE +N
Sbjct: 339 EMFPKDPNLWDEPIQDSQPIRTFKEM-WPKIVTRRAEAFEHIENYERALQDYQSLIEKNN 397

Query: 204 ATDAMKRDYESAKKRVEQSLN 224
             D +       K+R ++ LN
Sbjct: 398 FNDKIM----GGKRRCQKVLN 414

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 130 DVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK-YA-QGKPE 187
           +  P +AI + + A  + SL    EA K    +  +DPS+   +  LGFA  YA +G+ +
Sbjct: 525 ETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 582

Query: 188 EALEAY 193
           +AL AY
Sbjct: 583 QALTAY 588

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%)

Query: 145 AHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           AH   +E  ++I+  +SA+ VDP+    +  LG A +A G+ E +++ + K + ++
Sbjct: 704 AHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIGLK 759

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 32/55 (58%)

Query: 145 AHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
           AH   +E  ++I+  +SA+ +DP+    +  LG A +A G+ E +++ + K + +
Sbjct: 696 AHLEKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQL 750

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%)

Query: 117 EYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRL 176
           E E +IK +  AI++  TNA  Y +R   +   ++Y++A  D + A  +D S    Y +L
Sbjct: 364 ETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQL 423

Query: 177 GFAKYAQGK 185
               Y + K
Sbjct: 424 ACLAYKENK 432

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 51/110 (46%), Gaps = 20/110 (18%)

Query: 108 QGNKAMANKEYELAIKKYTEAIDVLP----TNAIYYANRAAAHSSLKEYDEAIKDAESAI 163
           +G     N +Y  A+++Y ++++ LP       I Y+N  A+   + ++ +++ DA+ A+
Sbjct: 368 RGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAM 427

Query: 164 SVDPSY-------------FRGYSRLGFAK--YAQGKPEEALEAYKKVLD 198
            + P                R Y+ + + K    Q +  EA+E YK  LD
Sbjct: 428 KLLPEEKSLWTAAIQNSDPVRSYNDI-WPKIILRQAESYEAIEKYKLALD 476

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 34/66 (51%)

Query: 114 ANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGY 173
           AN +++  I+ +  A++  PT+ + +    AA ++    +++IK    AI + PS+ R  
Sbjct: 418 ANDDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKAIQLKPSFVRAR 477

Query: 174 SRLGFA 179
             L  A
Sbjct: 478 YNLAVA 483

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,101,377
Number of extensions: 1096811
Number of successful extensions: 3858
Number of sequences better than 10.0: 233
Number of HSP's gapped: 3717
Number of HSP's successfully gapped: 335
Length of query: 346
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 236
Effective length of database: 40,868,139
Effective search space: 9644880804
Effective search space used: 9644880804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)