Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1816.19ON33633615680.0
Smik_15.1756.19ON31231213050.0
YOR006C (TSR3)6.19ON31331212951e-180
Skud_15.1676.19ON31231212691e-176
TDEL0G045006.19ON30123810861e-149
SAKL0E01144g6.19ON43024010721e-145
Kpol_1037.246.19ON36631810641e-144
TPHA0J003206.19ON34232110611e-144
ZYRO0C07832g6.19ON28124010391e-142
KNAG0M011506.19ON30731310281e-140
CAGL0E02717g6.19ON32527810201e-138
KLLA0D01111g6.19ON31427510131e-137
Ecym_30236.19ON34923910041e-136
ACR007W6.19ON3132389801e-133
NDAI0D007906.19ON4012899501e-127
NCAS0H008106.19ON3233259161e-123
Kwal_56.224216.19ON3372329161e-122
KLTH0C11264g6.19ON3462419141e-122
KAFR0L003906.19ON3292288211e-108
TBLA0A072506.19ON3043148151e-108
Suva_10.216singletonOFF5422690.36
CAGL0E03454g4.46ON867102780.37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.181
         (336 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   608   0.0  
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   507   0.0  
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   503   e-180
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   493   e-176
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   422   e-149
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   417   e-145
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   414   e-144
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   413   e-144
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   404   e-142
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   400   e-140
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   397   e-138
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   394   e-137
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   391   e-136
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   382   e-133
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   370   e-127
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   357   e-123
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   357   e-122
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   356   e-122
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   320   e-108
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   318   e-108
Suva_10.216 Chr10 complement(399264..399425) [162 bp, 54 aa] {OF...    31   0.36 
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    35   0.37 

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/336 (88%), Positives = 298/336 (88%)

Query: 1   MTIELLGTPELKALHCRAFYRATKMGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY 60
           MTIELLGTPELKALHCRAFYRATKMGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY
Sbjct: 1   MTIELLGTPELKALHCRAFYRATKMGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY 60

Query: 61  DNSEMTNFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCP 120
           DNSEMTNFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCP
Sbjct: 61  DNSEMTNFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCP 120

Query: 121 DDLEVVEQHGASVVECSWARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEAL 180
           DDLEVVEQHGASVVECSWARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEAL
Sbjct: 121 DDLEVVEQHGASVVECSWARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEAL 180

Query: 181 AACFAIVGRMDWASGLLSHFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKE 240
           AACFAIVGRMDWASGLLSHFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKE
Sbjct: 181 AACFAIVGRMDWASGLLSHFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKE 240

Query: 241 TQERKSQSKDEDIWMMGNVNRKDNGAXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAICI 300
           TQERKSQSKDEDIWMMGNVNRKDNGA                      IEYDSLGNAICI
Sbjct: 241 TQERKSQSKDEDIWMMGNVNRKDNGAQSDESESEEDSDQSELESDKQSIEYDSLGNAICI 300

Query: 301 DNVKSRKMLXXXXXXXXXXXXXXXXPVSYDSLGNII 336
           DNVKSRKML                PVSYDSLGNII
Sbjct: 301 DNVKSRKMLSEGSEDEESEFEEDEEPVSYDSLGNII 336

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/312 (78%), Positives = 263/312 (84%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           MGKGKNK HEPKNGRPQRGANGHSSRQNH+RMEMKY+NS+   FPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDDLEVVEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAS LLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264
           GFL+LN+ELLEIYQ+CTD++SVK+AEEEWLQKLEKETQERKSQ+K+EDIWMMGN+NR+  
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 265 GAXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAICIDNVKSRKMLXXXXXXXXXXXXXXX 324
           G                       +EYDSLGNAICID++ SRK L               
Sbjct: 241 GWQSDESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEENDLEENK 300

Query: 325 XPVSYDSLGNII 336
            PVSYDSLGN+I
Sbjct: 301 EPVSYDSLGNLI 312

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  503 bits (1295), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/312 (78%), Positives = 262/312 (83%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           MGKGKNK HEPKNGRPQRGANGHSSRQNH+RMEMKYDNSE   FPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDDLE+VEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAS LLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264
           GFL+LN+ELLEIYQ+CTD +SVK+AEEEWLQKLEKETQERKS++K+EDIWMMGN+NR+ N
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240

Query: 265 GAXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAICIDNVKSRKMLXXXXXXXXXXXXXXX 324
           G+                      IEYDSLGNAI IDN+KSR+                 
Sbjct: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKSREAQSEESEDEESGSKENG 300

Query: 325 XPVSYDSLGNII 336
            P+SYD LGN+I
Sbjct: 301 EPLSYDPLGNLI 312

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  493 bits (1269), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/312 (75%), Positives = 257/312 (82%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           MGKGKNKTHEPKN R QRGANGHS+RQNHK MEMKYD SE   FPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG GVVCP+DLE+VEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWAS LLSHFSWGL
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264
           GFLDLN+ELLEIYQ+CTD++SVKKAE+EWL+KLE ETQERKS +K  DIWMMGN+NR+ N
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRGN 240

Query: 265 GAXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAICIDNVKSRKMLXXXXXXXXXXXXXXX 324
           G                       IEYD+LGNAI +D+VKSR ML               
Sbjct: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300

Query: 325 XPVSYDSLGNII 336
            PV+YDSLGN+I
Sbjct: 301 KPVNYDSLGNLI 312

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  422 bits (1086), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 217/238 (91%), Gaps = 1/238 (0%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           M KGKNK  E KNG   +G+NGHSSRQNHKRMEMK   +E T FPVKLAMWDFDHCDPKR
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKR-GTEDTKFPVKLAMWDFDHCDPKR 59

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCPDD  +VE+HGASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWAS LLSHFSWGL
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262
           GFL+LN+ELLEIYQ+CTD++SVK AE  WL K++KE +ERKSQ+KDEDIWM GNVNRK
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  417 bits (1072), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 217/240 (90%), Gaps = 2/240 (0%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY--DNSEMTNFPVKLAMWDFDHCDP 82
           MGKGKNK HE ++ RP RGANGHSSR NHKRMEMK   D+S    FPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 83  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLE 142
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCP+D  +VE+HGASVVECSWARL+
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 143 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSW 202
           EVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D AS LLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 203 GLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262
           GLGFL+LN+ELLEIYQ+CTD++SVK AEE WL+K+E+E Q+RK QSK+EDIWMMGNVNR+
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  414 bits (1064), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 233/318 (73%), Gaps = 17/318 (5%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY---DNSEMTNFPVKLAMWDFDHCD 81
           M KGKNK HE + G+P RG+NGHSS+ NHK MEMK    + S+   FPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 82  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARL 141
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNG GV+CP+D E+VE+ GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 142 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFS 201
           +EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA+ LLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 202 WGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNR 261
           WGLGFL++N ELL+IYQ+CTDS SVKKAEEEWL K+E+E QERK+Q+++ DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 262 KDNGAXXXXXXXXXXXXX---XXXXXXXXXIEYDSLGNAICIDNVKSRKMLXXXXXXXXX 318
             NG                            YD+LGN I                    
Sbjct: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII-----------ESEEDYDDY 289

Query: 319 XXXXXXXPVSYDSLGNII 336
                   V YDSLGNII
Sbjct: 290 DDEEDRVEVKYDSLGNII 307

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  413 bits (1061), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 206/321 (64%), Positives = 236/321 (73%), Gaps = 11/321 (3%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDN------SEMTNFPVKLAMWDFD 78
           M KGKNK+ E ++G+P RG+NGH +R NHKRMEMK+ N      S+   FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 79  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSW 138
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDD E VE+ GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 139 ARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLS 198
           ARL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ LL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 199 HFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGN 258
           HFSWGLGFL+LN+ELLE+YQKCTDS SVKK EEEWL+K++KE QERKSQS++ DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 259 VNRKDNGAXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAIC---IDNVKSRKMLXXXXXX 315
            NR  +                        I YD+LGN +     +  +  + +      
Sbjct: 241 TNR--DLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLISEEENESEEEEEVRYDALG 298

Query: 316 XXXXXXXXXXPVSYDSLGNII 336
                      + YDSLGN+I
Sbjct: 299 NIIESEEEAAELKYDSLGNLI 319

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  404 bits (1039), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 187/240 (77%), Positives = 215/240 (89%), Gaps = 3/240 (1%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY---DNSEMTNFPVKLAMWDFDHCD 81
           MGKGKNK HE ++ RP RGANGH+S+QNHK MEMK+    NS  TNFPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 82  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARL 141
           PKRCSGKKLERLGLI+SLRVGQKFQG+VV+PNG GVVCP+D  +VE+HGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 142 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFS 201
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWAS LLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 202 WGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNR 261
           +G  FL++N ELLEIYQ+CTD+ SVK AE  WL+K+EKE ++RK+Q+K+EDIWM GNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 235/313 (75%), Gaps = 23/313 (7%)

Query: 26  GKGKNKTHEPKNGR-PQRGANGHSSRQNHKRMEMK-YDNSEMTNFPVKLAMWDFDHCDPK 83
           GKGKNK+   +  R   +G+NGHSSR NHKRME++ +D  + T FPVK+AMWDFDHCDPK
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63

Query: 84  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEE 143
           RCSGKKLERLGLI SL+VGQKFQGIVVSPNG GVVCPDD  +VE+ GASVVECSWARL+E
Sbjct: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123

Query: 144 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWG 203
           VPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD AS LLS+FSWG
Sbjct: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183

Query: 204 LGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKD 263
           LGFL+LN+ELLE+YQKCTD  SVKKAEE+WL K+E+E Q+RK++++D DIWMMGNVNR  
Sbjct: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243

Query: 264 NGAXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAICIDNVKSRKMLXXXXXXXXXXXXXX 323
           N                        I YD+LGNAI  ++ +    +              
Sbjct: 244 N------KMTLSDEESDEEETEASSIRYDNLGNAIIDESDEEEPEI-------------- 283

Query: 324 XXPVSYDSLGNII 336
              + YD+LGN+I
Sbjct: 284 -SSIRYDNLGNVI 295

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  397 bits (1020), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 191/278 (68%), Positives = 220/278 (79%), Gaps = 5/278 (1%)

Query: 26  GKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY-DNSEMTNFPVKLAMWDFDHCDPKR 84
           GKGKNK+H+        G+NGH +R+NH+ MEMKY   S+ ++FPVKLAMWDFDHCDPKR
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG  VVCPDD E+VE HGASVVECSWARLEEV
Sbjct: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A  LLSHFSWGL
Sbjct: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264
           GFL+LN++LLE YQ+CTDS S+KK EE+WLQ++++E QERK +++ ED+WMMGN NR ++
Sbjct: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243

Query: 265 G----AXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAI 298
           G    +                      + YD+LGN I
Sbjct: 244 GLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNII 281

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  394 bits (1013), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/275 (70%), Positives = 219/275 (79%), Gaps = 2/275 (0%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           MGKGKNK    +  R Q+G+NGHSSR NHKRMEMK+ +S  + FPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNG  VVCPDD  +VE++GASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A+ LLS+FSWG 
Sbjct: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264
            FL+LN+ELL+IYQ+CTD +SVK AEE+WLQK+E+E  ERK Q+K EDIWM+GNVNR   
Sbjct: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR 239

Query: 265 G-AXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAI 298
                                    I+YDSLGN I
Sbjct: 240 DLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  391 bits (1004), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/239 (74%), Positives = 208/239 (87%), Gaps = 2/239 (0%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           MGKG+NK ++  +   Q+G+NGHSSR NH+R+E KY+  + + FPV LAMWDFDHCDPKR
Sbjct: 1   MGKGRNKDYDKNHS--QKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLIKSLRV QKFQGIVVSPNG  VVCP+D E+ E++G SVVECSWARLEE+
Sbjct: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLSHFSWGL
Sbjct: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKD 263
           GFL+LN+E+LEIYQKCTD +S+K AEE WL+++E E  ER+ Q+K+ DIWMMGNVNRK+
Sbjct: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKN 237

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 205/238 (86%), Gaps = 1/238 (0%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           M KGKNK  E +  +P +G++ H+ + N +R E+K+ +++ T FP KLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNG  VVCP+D E+VEQHG SVVECSWARL+E+
Sbjct: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119

Query: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A  LLSHFSWG 
Sbjct: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179

Query: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262
           GFL+LN+ELLE YQ+CTD  S+K AEE WLQKLE+E ++R+ Q+ +EDIWMMGNVNRK
Sbjct: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 237

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  370 bits (950), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 216/289 (74%), Gaps = 31/289 (10%)

Query: 6   LGTPELKALHCRA-------FYRATKMGKGKNKTHE--PKNGRPQRGANGHSSRQNHKRM 56
           L  P L+    R         +   KMGKGKNK+ +  PKN R  RGANGHSSR NHK M
Sbjct: 19  LSLPNLRQTKTRGDGTEEEHIFITIKMGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNM 78

Query: 57  EMK----YDNSEMTN--------------FPVKLAMWDFDHCDPKRCSGKKLERLGLIKS 98
           EMK    + +++M N               PVKL MWDFDHCDPKRCSGKKLERLGLIKS
Sbjct: 79  EMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKS 138

Query: 99  LRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKI----GGKHE 154
           L++GQ+FQG+++SPNG  VV PDD +++++ GA+VVECSWARL+E+PF+K+    GGK+E
Sbjct: 139 LKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNE 198

Query: 155 RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGLGFLDLNRELL 214
           RLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR DWAS LLS+FSWGL FL LN EL 
Sbjct: 199 RLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASDLLSNFSWGLNFLKLNEELF 258

Query: 215 EIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKD 263
           E+Y KCTDS+SVK A+EEWL K+E+E  ERK Q+++ DIWMMGN NR D
Sbjct: 259 ELYSKCTDSDSVKAAQEEWLDKIEQEATERKLQAQETDIWMMGNTNRLD 307

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  357 bits (916), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 228/325 (70%), Gaps = 17/325 (5%)

Query: 25  MGKGKNKTHEPKN--GRPQRGANGHSSRQNHKRMEM-KYDNSEMTN---FPVKLAMWDFD 78
           MGKGKNK  +  +  GR  RGANGHSSR NHK MEM K++N + +N    PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 79  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSW 138
           HCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNG  VV P+D +++++ GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 139 ARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAS 194
           ARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR DWA+
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 195 GLLSHFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIW 254
            LLS+FSWG+ FL LN EL E+Y +CTDS+S+++A+E WL K+++E +ERK Q++D DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 255 MMGNVNRKDNGAXXXXXXXXXXXXXXXXXX---XXXXIEYDSLGNAICIDNVKSRKMLXX 311
           +MGN NR ++                           ++YD+LGN I      S   +  
Sbjct: 241 LMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVI----ESSEDEITL 296

Query: 312 XXXXXXXXXXXXXXPVSYDSLGNII 336
                            YD+LGN+I
Sbjct: 297 RYDNLGNVIEEEEEEKRYDALGNLI 321

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  357 bits (916), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 166/232 (71%), Positives = 199/232 (85%), Gaps = 5/232 (2%)

Query: 36  KNGRPQRGAN----GHSSRQNHKRMEMKYD-NSEMTNFPVKLAMWDFDHCDPKRCSGKKL 90
           K GR  +G+N    GHS+R +   +E K+  ++   NFPVKLAMWDFD CDPKRCSGKKL
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62

Query: 91  ERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIG 150
           ERLG+IKSLRVGQKFQGIVVSPNG GVVCP+D ++VE+ GA+VVECSWARL E+PFNKIG
Sbjct: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122

Query: 151 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGLGFLDLN 210
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A+ LL+HFSWGLGFL+LN
Sbjct: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182

Query: 211 RELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262
           +EL+E+YQKCTD+ SVK+AE  WL+K+E+E  ER++ S  +D+WM GNVNR+
Sbjct: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  356 bits (914), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 204/241 (84%), Gaps = 6/241 (2%)

Query: 23  TKMGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYD-NSEMTNFPVKLAMWDFDHCD 81
           +  GKG NK     + +P   ++GH+S   H+ +E K+  N    NFPVKLAMWDFD CD
Sbjct: 4   SSKGKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCD 58

Query: 82  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARL 141
           PKRCSGKKLERLG+IKSLRVGQKFQGIVVSPNG  VVCP+D  +VE++GA+VVECSWARL
Sbjct: 59  PKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARL 118

Query: 142 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFS 201
           +EVPFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ LLSHFS
Sbjct: 119 DEVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFS 178

Query: 202 WGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNR 261
           WGL FL+LN+ELLE+YQ+CTD++S+KKAE+ WL+++EKE QERK+++  +D+W+ GNVN 
Sbjct: 179 WGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNH 238

Query: 262 K 262
           K
Sbjct: 239 K 239

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  320 bits (821), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 150/228 (65%), Positives = 183/228 (80%), Gaps = 3/228 (1%)

Query: 37  NGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKRCSGKKLERLGLI 96
           NG  +  +NGH SR N+K+ME K   S  T+FPVKLAMWDFDHCDPKRCSGKKLERL LI
Sbjct: 16  NGAIRTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLI 75

Query: 97  KSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIGG-KHER 155
           +SL++ QKFQGI VSPNG   V P+D E+V + G +VVECSWAR++E+PF+K    K +R
Sbjct: 76  RSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDR 135

Query: 156 LLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGLGFLDLNRELLE 215
           LLPYLVAANQVNYGRPW+LNCVEA+AAC AIVG MD A  LLSHFSWG+ FL LNRELLE
Sbjct: 136 LLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLE 195

Query: 216 IYQKCTDSNSVKKAEEEWLQKLEKETQERKSQ--SKDEDIWMMGNVNR 261
           IYQ+CTDS+ ++ A++ W+ ++EKE QERK+   +++ DIWM GNVNR
Sbjct: 196 IYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR 243

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  318 bits (815), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 169/314 (53%), Positives = 202/314 (64%), Gaps = 15/314 (4%)

Query: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84
           M KGKNK HE ++ R       ++SR+N  +  +    S  TNFPVKLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKGHEERSNRKS-----NNSRRNESKHSLSI-KSTKTNFPVKLAMWDFDHCDPKR 54

Query: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144
           CSGKKLER GL +SLRVGQ+F G+VVSPNG  VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114

Query: 145 PFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSW 202
           PFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS +L  FSW
Sbjct: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174

Query: 203 GLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262
           G  FL+LN ELL+IY  CTDS SV+KA++EWL+K+E E +ERK +    D W++GN NRK
Sbjct: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234

Query: 263 DNGAXXXXXXXXXXXXXXXXXXXXXXIEYDSLGNAICIDNVKSRKMLXXXXXXXXXXXXX 322
           +                           YD+LGN I  D+      L             
Sbjct: 235 N---LNDFDNSSESTEDNISTVSSADERYDALGNLISNDS----HSLKYDSLGNVIESEG 287

Query: 323 XXXPVSYDSLGNII 336
              P  YD LGNII
Sbjct: 288 DALPPKYDKLGNII 301

>Suva_10.216 Chr10 complement(399264..399425) [162 bp, 54 aa]
          {OFF} YOR006C (INTER)
          Length = 54

 Score = 31.2 bits (69), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 34 EPKNGRPQRGANGHSSRQNHKR 55
          EP+ GRPQ G +GH +RQ  K+
Sbjct: 27 EPEIGRPQAGFSGHKARQGKKK 48

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 152 KHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGLGFLD--L 209
           K+E+  P L+ A +    +  ++  +E + A    VG +D A   L  F   L   +  L
Sbjct: 55  KYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSML 114

Query: 210 NREL--LEIYQKCTDSNSVKKAEEEWLQKLEK--ETQERKSQ 247
           N E+  L + QK TD++    A E  +++LE+  ETQ R S+
Sbjct: 115 NEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSK 156

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,537,365
Number of extensions: 1382518
Number of successful extensions: 6447
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6558
Number of HSP's successfully gapped: 30
Length of query: 336
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 226
Effective length of database: 40,868,139
Effective search space: 9236199414
Effective search space used: 9236199414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)