Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1806.18ON94894849620.0
YOR005C (DNL4)6.18ON94494839660.0
Smik_15.1746.18ON94594838460.0
Skud_15.1666.18ON94794638080.0
TDEL0G045106.18ON96994525960.0
ZYRO0C07854g6.18ON94495225840.0
NCAS0D026506.18ON95094425660.0
KAFR0A050506.18ON94894825660.0
NDAI0I022606.18ON96796725540.0
KNAG0F028706.18ON95494624540.0
Kpol_1032.76.18ON96595023960.0
CAGL0E02695g6.18ON94694023770.0
TBLA0G010406.18ON97295823370.0
TPHA0M002606.18ON96695723140.0
Kwal_56.224146.18ON96394522910.0
KLTH0C11286g6.18ON95195121770.0
ACR008W6.18ON98194220500.0
KLLA0D01089g6.18ON90793319610.0
SAKL0F10912g7.343ON6934422835e-25
ACL155W7.343ON6974122772e-24
NDAI0A019407.343ON7654582712e-23
KLLA0D12496g7.343ON7004122657e-23
TBLA0E020507.343ON7204132542e-21
YDL164C (CDC9)7.343ON7554202542e-21
Suva_4.827.343ON7554612542e-21
Smik_4.747.343ON8454222506e-21
CAGL0I03410g7.343ON7242952488e-21
Skud_4.937.343ON7554222489e-21
TPHA0D045707.343ON7364232424e-20
Kwal_56.246167.343ON7154592415e-20
KAFR0B008307.343ON7104182415e-20
TDEL0C020407.343ON7054632381e-19
KLTH0H01408g7.343ON7233052353e-19
Kpol_2001.717.343ON7264342335e-19
KNAG0C037407.343ON7274132221e-17
NCAS0A141107.343ON7534132211e-17
ZYRO0F11572g7.343ON7314412093e-16
Suva_8.4007.46ON9851011068e-04
KAFR0C051907.46ON896851020.002
CAGL0E05588g7.46ON887901020.002
NDAI0E039307.46ON102888950.016
KNAG0E004107.46ON817130940.018
Ecym_63411.276ON767114940.019
NCAS0E023707.46ON89778910.039
Skud_10.1241.276ON76552910.046
TDEL0D014401.276ON60356900.048
AFR095C1.276ON67096900.049
ZYRO0E07150g6.228ON449118880.075
ZYRO0G15180g1.276ON68854880.083
Kpol_359.63.447ON588109880.090
YOR346W (REV1)7.46ON985101870.13
Kpol_367.97.46ON88078860.17
Smik_10.1521.276ON76331850.20
Skud_15.5137.46ON986101840.25
TBLA0A045207.46ON979113840.30
Ecym_21886.228ON461105810.58
Suva_6.1641.276ON75952810.65
ZYRO0D04664g7.46ON81785810.70
TDEL0E053706.228ON457107800.74
TDEL0H040507.46ON85590800.74
YJL090C (DPB11)1.276ON76458781.2
NCAS0A094201.276ON78453781.3
TPHA0E027706.228ON450118761.9
SAKL0B10912g7.46ON107577771.9
TBLA0A020706.228ON453120762.0
Smik_12.4294.173ON187858762.3
KLLA0F23375g7.46ON829111762.5
KLLA0B02200g6.228ON466107752.5
Skud_7.4023.447ON601109743.5
NCAS0G016102.48ON84099735.3
TBLA0C014202.618ON91784726.4
TPHA0H028307.46ON92378728.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.180
         (948 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...  1915   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...  1532   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...  1486   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...  1471   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...  1004   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   999   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   993   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   993   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   988   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   949   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   927   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   920   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   904   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   895   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   887   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   843   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   794   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   759   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   113   5e-25
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   111   2e-24
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   108   2e-23
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   106   7e-23
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   102   2e-21
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   102   2e-21
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   102   2e-21
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   100   6e-21
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   100   8e-21
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   100   9e-21
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...    98   4e-20
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...    97   5e-20
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    97   5e-20
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    96   1e-19
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    95   3e-19
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...    94   5e-19
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    90   1e-17
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    90   1e-17
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    85   3e-16
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    45   8e-04
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    44   0.002
CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} simila...    44   0.002
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    41   0.016
KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}...    41   0.018
Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar t...    41   0.019
NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.4...    40   0.039
Skud_10.124 Chr10 complement(230827..233124) [2298 bp, 765 aa] {...    40   0.046
TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {O...    39   0.048
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    39   0.049
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    39   0.075
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    39   0.083
Kpol_359.6 s359 complement(5679..7445) [1767 bp, 588 aa] {ON} co...    39   0.090
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    38   0.13 
Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON} ...    38   0.17 
Smik_10.152 Chr10 complement(254550..256841) [2292 bp, 763 aa] {...    37   0.20 
Skud_15.513 Chr15 (919666..922626) [2961 bp, 986 aa] {ON} YOR346...    37   0.25 
TBLA0A04520 Chr1 complement(1116582..1119521) [2940 bp, 979 aa] ...    37   0.30 
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    36   0.58 
Suva_6.164 Chr6 (286935..289214) [2280 bp, 759 aa] {ON} YJL090C ...    36   0.65 
ZYRO0D04664g Chr4 (387336..389789) [2454 bp, 817 aa] {ON} simila...    36   0.70 
TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {O...    35   0.74 
TDEL0H04050 Chr8 (693662..696229) [2568 bp, 855 aa] {ON} Anc_7.4...    35   0.74 
YJL090C Chr10 complement(262757..265051) [2295 bp, 764 aa] {ON} ...    35   1.2  
NCAS0A09420 Chr1 (1869312..1871666) [2355 bp, 784 aa] {ON} Anc_1...    35   1.3  
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    34   1.9  
SAKL0B10912g Chr2 (943757..946984) [3228 bp, 1075 aa] {ON} simil...    34   1.9  
TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {O...    34   2.0  
Smik_12.429 Chr12 (748638..754274) [5637 bp, 1878 aa] {ON} YLR34...    34   2.3  
KLLA0F23375g Chr6 (2181986..2184475) [2490 bp, 829 aa] {ON} simi...    34   2.5  
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    33   2.5  
Skud_7.402 Chr7 (679536..681341) [1806 bp, 601 aa] {ON}  (REAL)        33   3.5  
NCAS0G01610 Chr7 complement(285839..288361) [2523 bp, 840 aa] {O...    33   5.3  
TBLA0C01420 Chr3 (324857..327610) [2754 bp, 917 aa] {ON} Anc_2.6...    32   6.4  
TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.4...    32   8.0  

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 1915 bits (4962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 931/948 (98%), Positives = 931/948 (98%)

Query: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60
           MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL
Sbjct: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120
           WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120

Query: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180
           KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC
Sbjct: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180

Query: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240
           LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR
Sbjct: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300
           LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360
           FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360

Query: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420
           AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY
Sbjct: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420

Query: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI
Sbjct: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540
           IIGRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS
Sbjct: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540

Query: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600
           IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL
Sbjct: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600

Query: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL 660
           DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL
Sbjct: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL 660

Query: 661 VPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHG 720
           VPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHG
Sbjct: 661 VPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHG 720

Query: 721 GKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSY 780
           GKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSY
Sbjct: 721 GKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSY 780

Query: 781 CFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPLF 840
           CFSVSGKLRAVARRRVDCFGDSFENDI                 TRQADKSFELQIIPLF
Sbjct: 781 CFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQIIPLF 840

Query: 841 LFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEV 900
           LFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEV
Sbjct: 841 LFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEV 900

Query: 901 HSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPVSHY 948
           HSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPVSHY
Sbjct: 901 HSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPVSHY 948

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 1532 bits (3966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/948 (77%), Positives = 828/948 (87%), Gaps = 4/948 (0%)

Query: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60
           M SAL +IPEP NFAPSPDF+WLCEELF K+ EV INGTAGTGKS SF+YYEIISNF E+
Sbjct: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120
           WRKTVGNNIYPAL+LALPYRDRRIYNIKDYVLIRT+CSYLKLPKNS TEQRLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120

Query: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180
           KG +LSSLLVEEI+KRR EP+ K+IT+D+VN YLD LS +  ASGRGFK+LVKSKPFLHC
Sbjct: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180

Query: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240
           +ENM+FVELK+FFDI+LKNRVIGGQEHKLLNCWHPDAQDYLSV+SDL+VVTSKLYDP +R
Sbjct: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300
           LK+DDLSIKVGFAFAPQLAKKVNLSYEKIC  L +DF VEEKMDGERIQVHYMNYG+SIK
Sbjct: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300

Query: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360
           FFSRRGIDYTYLYG +L SGTISQ+L+F+DSVKECVLDGEMVTFDA R+VILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360

Query: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420
           AKEALSFN INN DFHPLYMVFDLLYLNGTSLTPLPL+QRK+YL+SIL P K++VEIVR 
Sbjct: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420

Query: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           SRCY  ES+KKSLEVAISLGSEGVVLK+Y+SSYNVASRNNNWIKVKPEYLEEFGENLDLI
Sbjct: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540
           +IGRDSGKKDSFMLGLLV+DE+E  K  Q   SEI++ SS E+   N ++RV+K+LSFCS
Sbjct: 481 VIGRDSGKKDSFMLGLLVLDEEEY-KKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCS 539

Query: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600
           IANGISQEEFKEIDRKTRGHWK+TS ++PP SILEFGSK+PAEWI+PSESIVLEIKSRSL
Sbjct: 540 IANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSL 599

Query: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL 660
           DNTETNMQKYATNCTLYGGYC+RIRYDK+WT+CYTL++LYE+R  KSNPS+Q E  QL L
Sbjct: 600 DNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGL 659

Query: 661 VPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHG 720
           + KKRKR L+SD F Q+R+Q PIS +FAGL FYVLSDY+   TG+RITR+EL   IV+HG
Sbjct: 660 IRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHG 719

Query: 721 GKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSY 780
           GKLI+NVILKRH IGDVRLI CK T EC+ALIDRGYDILHP W++DC AY +L+ IEP+Y
Sbjct: 720 GKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779

Query: 781 CFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPLF 840
           CF+VS K+RAVA +RVDC GDSFENDI                   + +   E++  PLF
Sbjct: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLF 839

Query: 841 LFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEV 900
           LFSNRI Y+PR KI  +D+ ++EMKI+LFGGKITDQQSL NLIIIPY DPI R DC+ EV
Sbjct: 840 LFSNRIAYVPRRKISTEDD-IIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEV 898

Query: 901 HSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPVSHY 948
           H +I E +KA  SDT+P+I R+V PEWVDHSI+ENCQVPEEDFPV +Y
Sbjct: 899 HEKIKEQIKA--SDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY 944

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 1486 bits (3846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/948 (74%), Positives = 811/948 (85%), Gaps = 3/948 (0%)

Query: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60
           M S L ++PEP NFAPSPDF+WLCEELF+K++EV + GT GTGKS SF+YYE++SNF E+
Sbjct: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120
           WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRT+CSYLKLPKNS TE RLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120

Query: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180
           KG++LSSLLVEEI+KRR+EP  K+IT+D +N  LDELSK+ + SGRGFKNLVKS PFLHC
Sbjct: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180

Query: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240
           LE+M+FVELK+FFDILLK+RVIGGQEHK L+CWHPDAQDYLSVVSDL+VV SKLYDP +R
Sbjct: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300
           LKNDDL+IKVGFAFAPQLAKKVNL YEKIC AL NDF VEEKMDGERIQVHYMNYGKS++
Sbjct: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300

Query: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360
           F+SRRGIDYTYLYG +L SGTIS +L F+D+V+ECVLDGEMVTFDA RKVILPFGLVKGS
Sbjct: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360

Query: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420
           AK+ALSFN INN DFHPLY+VFDLLYLNGTSLTPLPL+QRKEYL SIL P K+VVE+VR 
Sbjct: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420

Query: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           SRCY+ ES+KKSLEVAISLGSEGVVLK+Y+SSYNVASRNNNWIKVKPEYLEEFGENLDL+
Sbjct: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480

Query: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540
           IIGRD GKKDSFMLGLL+++E+E  K DQE  S I N+S  E      +K+V+K+LSFCS
Sbjct: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNE-NILYSQKKVKKILSFCS 539

Query: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600
           +ANGISQEEFKEIDRKTRG WKKTS ++PP SI EFGSK+PAEWIEP+ESIVLEIKSRSL
Sbjct: 540 VANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSL 599

Query: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL 660
           DNTETNMQKYAT+CTLYGGYC+RIR+DKDWT+C+TL+ELY++R  + NPS+Q E   L+L
Sbjct: 600 DNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKL 659

Query: 661 VPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHG 720
           V KKR+  L S+ F Q  EQ P S +FAGL+FYVLSDY+ + + VRITR EL + IV+HG
Sbjct: 660 VRKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHG 719

Query: 721 GKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSY 780
           G+LI+N+ILKRH IGDVRLI CK T ECRALI+RGYDILHP W++DC AY KL+PIEP Y
Sbjct: 720 GRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCY 779

Query: 781 CFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPLF 840
           CF+VS K+RAVA +RVDC GDSFENDI                   + ++  E+Q+ PLF
Sbjct: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLF 839

Query: 841 LFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEV 900
           LFSNRIVYIP  KIG K E  LEMKIRLFGGKITD+QSL NL+IIPY DP WR DC++EV
Sbjct: 840 LFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEV 899

Query: 901 HSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPVSHY 948
           + QI E VKA   DT+P+IPRIV PEWVDHSI  NCQVPEEDFPV  Y
Sbjct: 900 NEQIKEQVKA--LDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVTY 945

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 1471 bits (3808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/946 (75%), Positives = 809/946 (85%), Gaps = 4/946 (0%)

Query: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60
           M  A + IPEP NFAPSPDF+WLCEELF +++ V INGTAGTGKS SF+YYEIISNF E 
Sbjct: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120
           WRK VGNNIYPAL+LALPYRDRRIYNIKDY+LIRT+CSYLKLP+NS TEQRLK WKQRV 
Sbjct: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120

Query: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180
           + R+LSSLLVEEI+KRR EP  KSIT+D VN YLDELSKE + SGRGFK+LV SKPFL C
Sbjct: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180

Query: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240
           LE+M+FVELK+FFDI+LKNRVIGGQEH+ LNCWHPDAQDYLSVVSDL+VVTSKLYDP +R
Sbjct: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300
           LKNDDLSIKVGFAFAPQLAKKV+L YEKIC AL NDF +EEKMDGERIQVHYMNYGKSIK
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360
           FFSRRGIDYTYLYG +L SGTISQYLK +++VKECVLDGEMVTFD+ RKVILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360

Query: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420
           AK  LS +DINN+DF PLYMVFDLLYLN  SL PLPL+QRK+YLSSIL P K+VVEIV+ 
Sbjct: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420

Query: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           +RCYD +SVK SLEVAISLGSEGVVLK+Y+SSYN+ASRN NWIKVKPEYLEEFGENLDLI
Sbjct: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQE-GPSEILNDSSTERRATNPKKRVRKVLSFC 539
           IIGRDSGKKDSFMLGLLV+DE+E  + DQE   SE++NDS  E+   N KK+V+KVLSFC
Sbjct: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540

Query: 540 SIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRS 599
           S+ANGIS EEFKEI+R+TRGHWK+TS  S PPSIL+FGS++PAEWIEPS+SIVLEIKSRS
Sbjct: 541 SVANGISHEEFKEINRRTRGHWKRTSDFS-PPSILQFGSRIPAEWIEPSDSIVLEIKSRS 599

Query: 600 LDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQ 659
           LDNTET++++YAT+CTLYGGYCRRIRYDKDWT+CYTL +LYE+R  KS P+ Q EN QLQ
Sbjct: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQ 659

Query: 660 LVPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKH 719
           L  KKRKRAL+SDPF Q REQK IS +FAGLFFYVLSDY+   TGVRITR+ L D IVKH
Sbjct: 660 LAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719

Query: 720 GGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPS 779
           GGKLIHNVILKRHCIGDVRLI CK T ECR LIDRGYDI+HP W+MDC AY +L+ IEPS
Sbjct: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779

Query: 780 YCFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPL 839
           YCFSVS KLR VA +RVDC GDSFEN+I                   +     E Q+IPL
Sbjct: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPL 839

Query: 840 FLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEE 899
           FLFSNRIVYIPR+K G ++E LLEMKIRLFGG+IT QQSL NLIIIPY D   R DC+E+
Sbjct: 840 FLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEK 899

Query: 900 VHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945
           V+ QI E +KAS+  TVP++ RIV+P WVDHSI+ENCQVPEEDFPV
Sbjct: 900 VNEQIKEQMKASH--TVPKVARIVSPGWVDHSINENCQVPEEDFPV 943

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/945 (54%), Positives = 651/945 (68%), Gaps = 19/945 (2%)

Query: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTG-KSVSFRYYEIISNFTELWRKTVGNNI 69
           P NFAPSPDF WLCEELF K+E+V   G    G K +S RYYE+IS+F  LWRKTVGNNI
Sbjct: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129
           +PAL+L+LPYRDRRIYNIKDY L++ +CSYL LPK S TE+RL  WK+R  +G  LS+  
Sbjct: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146

Query: 130 VEEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188
           VEEI KR++EP+  + IT+D +N  LD L +E NA G GFK L  S  F  CL+NM+F+E
Sbjct: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205

Query: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248
           L+FFFDI+LKNRVIGGQEHKLLNCWHPDA DYLSVVSDL  V S+L+DP+ RL+ DDLSI
Sbjct: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265

Query: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308
            +G+AF PQLAKK+ +SYEKIC  L NDF +EEKMDGERIQVHYM+YG  I+F SRRG+D
Sbjct: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325

Query: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368
           YT LYG NL SGT++ YL F  +V++CVLDGEM+TFD  R V+LPFG+VK SA++ALS  
Sbjct: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385

Query: 369 DINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428
            I +    P+ MV DL+YLNG SL  LPLYQRKE+L+ +L P    VEI+ Y RC +  +
Sbjct: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445

Query: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488
           ++KSLE +IS+GSEG+VLK Y + Y + +RN+ WIKVKPEYLE+FGENLDL+IIGR  GK
Sbjct: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505

Query: 489 KDSFMLGLLVVD-EQETGKTDQEGPSEILNDSST--ERRATNPKKRVRKVLSFCSIANGI 545
           KDS M GL V + E++  + + +  S I+N  S   E   T+ KK ++  +SFC IANGI
Sbjct: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565

Query: 546 SQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTET 605
           SQ+EFKEIDRKTRG W K+    P   +L FGSK+P EWI+P  SI+LE+K+RSLDNTE+
Sbjct: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625

Query: 606 NMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKKR 665
           + +K+A  CTL+GGYCRRIR DKDWT CY+  EL++ R  KS  S  V +   Q   K +
Sbjct: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKS--STGVGSFNKQYSKKMK 683

Query: 666 KRALVSDPFQQSREQK----PISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGG 721
            +    DPF     +K      + +F GL FYVLSDYI+    VRIT+SE +D+I+++ G
Sbjct: 684 SKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSG 743

Query: 722 KLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYC 781
           KL+ N+I K H     R+I  K T ECRALI+RGYDIL P+WI+DC     ++ +EP +C
Sbjct: 744 KLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHC 803

Query: 782 FSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXX---TRQADKSFELQIIP 838
           F+VS +L  +   RVD +GDSF N I                     R+A+   EL ++P
Sbjct: 804 FNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANS--ELDVVP 861

Query: 839 LFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLE 898
           LFLFS R VYIP       D   L  K +L GG I       NLII+P  +       L 
Sbjct: 862 LFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLV 921

Query: 899 EVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943
           E+   + + +    +D+ P IP IVTP+WV+ SI ENCQVPEEDF
Sbjct: 922 EMRQSVLQAM--GRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDF 964

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/952 (52%), Positives = 664/952 (69%), Gaps = 20/952 (2%)

Query: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLING-TAGTGKSVSFRYYEIISNFTE 59
           M++      +PHNFAPSPDF+WLC+ELF K++ V       G  KS++ +Y+EIIS F +
Sbjct: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60

Query: 60  LWRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRV 119
           LWRKTVG+NIYPALIL LPYRDRRI+NIKDY LI+ +CS+L+LP NS TE+RL  WK+R 
Sbjct: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120

Query: 120 GKGRSLSSLLVEEISKRRTEPTR-KSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFL 178
           G+G  LS   VEEI +RR+EP   + IT+D +N  LD+L++E N  GRGFK+L  S  F 
Sbjct: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180

Query: 179 HCLENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPD 238
           +CLENM+F E+K++FDI+LK+RVIGGQEHK LNCWHPDA+DYLSVVSDL+ V  KL+DP 
Sbjct: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240

Query: 239 IRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKS 298
            RLKNDDL + +G  FAP LAK++ +SY+K+   L++DF++EEKMDGERIQ+HYM+YG+ 
Sbjct: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300

Query: 299 IKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVK 358
           +K+FSRRG DYTYLYG ++ +GT+++YL+    V+ECVLDGEM++FD     +LPFGLVK
Sbjct: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360

Query: 359 GSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIV 418
            SA+++L+   I    + PLYMV D LYLNG SL  +PL  RK+YLS+IL P    VEI+
Sbjct: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420

Query: 419 RYSRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLD 478
           +   CYD  S+K SLE AI +GSEG++LKH+ S Y + +R +NWIK+KPEYLE+FGENLD
Sbjct: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480

Query: 479 LIIIGRDSGKKDSFMLGLLVV--DEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVL 536
           L++IGRD GKKDS M GL V+  DE+   ++D+    +++N  S E     P+K V+K +
Sbjct: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK----QVVNLDSEEEE--EPRKAVKKFI 534

Query: 537 SFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIK 596
           SFC+IANGISQEEFK+I+RKT G WK T     PP ILEFGSKLP EWI P +S+VLE+K
Sbjct: 535 SFCTIANGISQEEFKQIERKTAGKWKNTED-HKPPKILEFGSKLPEEWIYPEDSVVLEVK 593

Query: 597 SRSLDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENL 656
           +RSLDNTE++ +K+   CTL+GGYCRRIR DK+WTECYTL EL++ RR K  P  +  N 
Sbjct: 594 ARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKV-PLSEDSNN 652

Query: 657 QLQLVPKKRKRALVSDPFQQS---REQKPISGVFAGLFFYVLSDYINSVTGVRITRSELN 713
           Q  +  KK +R  +     Q+    ++   S +F GL FYV+SDY+ S    RI++ +L 
Sbjct: 653 QKPMKSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLC 712

Query: 714 DVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKL 773
           D+I  +GGKL  NVI      G +R+I  K T EC+ALI+RGYDIL P+W+MDC     L
Sbjct: 713 DLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFL 772

Query: 774 LPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXX--XXXXTRQADKS 831
           + IEP +CFSVS  +  +AR RVD FGDS++ +I                   T   D  
Sbjct: 773 VTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVI 832

Query: 832 FELQIIPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPI 891
            +++ IPLFLFS RIV+IP       D  LL+ K+RL+GG++TD  +  NLII+P     
Sbjct: 833 SDVEDIPLFLFSRRIVFIPEG-FSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKIN 891

Query: 892 WRGDCLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943
            RG  + ++   ++    A+ ++  P IP IV P W+D SI EN QVPEEDF
Sbjct: 892 LRGRIISDLRRLLSTF--AAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDF 941

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/944 (51%), Positives = 656/944 (69%), Gaps = 20/944 (2%)

Query: 11  PHNFAPSPDFRWLCEELFAKVEEVLIN-GTAGTGKSVSFRYYEIISNFTELWRKTVGNNI 69
           P NF+PSP F+WLC+ELF K+E++         GK V+ RYYE+I++F  LWRKTVGN+I
Sbjct: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129
           +PALIL LPYRDRR++NI+DY LI+ +C+YLKLP+NS TE+RL  WK R GKG  LS   
Sbjct: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136

Query: 130 VEEISKRRTEPTRK-SITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188
           V EI KR++EP  K  IT+D +N  LD+L++E N+ GRGFK L  S  F  CLENM+F+E
Sbjct: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196

Query: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248
           L+FFFDILLKNRVIGGQEHK LN WHPDAQDYLSVVSDLR VT++L+DP+IRL+N+DL I
Sbjct: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256

Query: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308
             GFAFAPQLAKK+++SYEKIC  L+NDF +EEKMDGERIQ+HY +YG+ +KFFSRRG D
Sbjct: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316

Query: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368
           YTYLYG ++  G I ++LK +  VK+C+LDGEM+T+D  + +ILPFGLVK SA+  L+ +
Sbjct: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376

Query: 369 DINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428
            I N  + PL+MVFDL+++NGTSL  +PL  RKEYL+ I  P   ++E++     ++ +S
Sbjct: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436

Query: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488
           ++KSLE+AIS+GSEG+VLK Y S Y VASRN++WIKVKPEYLE+FGEN+DLI+IGRD GK
Sbjct: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496

Query: 489 KDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQE 548
           KDS M GL VV+E E    ++     ++     E      ++ + K +SFC IANG+SQE
Sbjct: 497 KDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHKFVSFCVIANGLSQE 556

Query: 549 EFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNMQ 608
           EFK+IDRKTRG W ++  + PP ++L+FG++LP EWI+P +S+V+E+K+RS+D  E+N +
Sbjct: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616

Query: 609 KYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKS--NPSHQVENLQLQLVPKKRK 666
           K+AT CTLYGGYCR IR DKDW  CYTL E    +  KS  N S QV +  ++   K R+
Sbjct: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIH-GVKRQKKNRR 675

Query: 667 RALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHN 726
           + ++    ++       +  F  L+FYV+SD  + V G RI +  +   I + GG LIHN
Sbjct: 676 KYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHN 735

Query: 727 VILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSG 786
           +I K+    ++R+I  KLT EC ALI+RGYD+++P+WI+DC     LL +EP YCF+VS 
Sbjct: 736 IISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVST 795

Query: 787 KLRAVARRRVDCFGDSF-----ENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPLFL 841
           +L+ +  +RVD FGDS+     E  +                 T  AD+  EL  IPLFL
Sbjct: 796 ELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYADE--ELIKIPLFL 853

Query: 842 FSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVH 901
           F +RI+  P ++   K    L+ KI+L+GGK+T      NLII+P  +       L+   
Sbjct: 854 FQDRIMLFPNTE--SKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNQ----QLLQRTR 907

Query: 902 SQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945
             + +++   NS  VP IP IV P W++ SI EN QVPEED+PV
Sbjct: 908 DLLTKNI--MNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPV 949

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/948 (51%), Positives = 677/948 (71%), Gaps = 17/948 (1%)

Query: 7   AIPE---PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRK 63
            +PE   P NFAPSP F+WLCEELF+K+EEV  N    T K ++ RYYEII+NF  LWR 
Sbjct: 4   TVPEVEVPRNFAPSPQFKWLCEELFSKLEEV-PNQRHLTTKRITLRYYEIITNFVNLWRT 62

Query: 64  TVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGR 123
           TVG++IYPALILALPYRDRR+YN+KDY LI+ +C+YLKLPKNS TE+RL +WKQR  +  
Sbjct: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122

Query: 124 SLSSLLVEEISKRRTEPTRKS-ITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLE 182
            LS   V E+ KR++EP  KS IT+D +N  LD LS++ N  GRG+KNL +S  F +C+E
Sbjct: 123 KLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIE 182

Query: 183 NMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLK 242
            M+F+EL++FFDI+LK RVIG  EHKLLN WHPDA+DYLSVVSDL+ V ++L++P+IRL+
Sbjct: 183 KMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLR 242

Query: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302
           +D+LSI +G+AFAP LAKK+++SY+KIC  L+NDFF+EEKMDGERIQ+HYM+YG  IKF 
Sbjct: 243 HDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFL 302

Query: 303 SRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAK 362
           SRRG+DYTYLYG NL +GTI+ YLK +  VKECVLDGEMVT+D  + ++LPFG+VK +A 
Sbjct: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362

Query: 363 EALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR 422
            AL+  +I+  D+HPL MVFDL++LNG+SL   PLYQRK+YL+S+L P ++ V+IV ++R
Sbjct: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422

Query: 423 CYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482
           C +   ++KSLE AIS+GSEG+VLK+Y+S Y + SRN++WIK+KPEYLE+FGEN+DLI+I
Sbjct: 423 CSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

Query: 483 GRDSGKKDSFMLGLLVVDEQETGKTD--QEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540
           GRDS KKDSF  GL V+DE+E    +   +G   +++D S      N  + ++KV+SFC 
Sbjct: 483 GRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPEN-NRHIKKVVSFCM 541

Query: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600
           IANGISQ E+KEI RKTRG WKKT  + PPP ++EFG+++P EWIEP  S+VLEIK+RSL
Sbjct: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSL 601

Query: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL 660
           DNTE++ +++   CTLYGGYCRRIR D DW   ++L EL  +RR K  P    ++  L+ 
Sbjct: 602 DNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKS 661

Query: 661 VPKKRKRALVSDPFQQS---REQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIV 717
             +++K+ L   P  Q+   R+ +  S +F GLFFY+LSDY ++   VRI++ +L  +++
Sbjct: 662 KKRRKKQLLT--PLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLL 719

Query: 718 KHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIE 777
           ++GGK+ HN++ KR    ++R++  K T EC  LI RGYDIL P+W++DC    K++ IE
Sbjct: 720 ENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIE 779

Query: 778 PSYCFSVSGKLRAVARRRVDCFGDSFEN--DIXXXXXXXXXXXXXXXXXTRQADKSFELQ 835
           PS+CFSVS  L A+A RRVD +GDS+E+   +                    A+ S + +
Sbjct: 780 PSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFE 839

Query: 836 IIPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGD 895
            +P FLF  R  ++              +KI+L+GGK+    S  N++I P A+     +
Sbjct: 840 KVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRE 899

Query: 896 CLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943
            ++ + + + + V  S S  +P +PRIV+ EW+D SI +N QVPEED+
Sbjct: 900 SMKFIRNTLAKTV--STSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/967 (52%), Positives = 659/967 (68%), Gaps = 51/967 (5%)

Query: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKS----VSFRYYEIISNFTELWRKTVG 66
           PHNFAPSP FRWLC+ELF K+E +    T+   K     ++ +YYE+I +F  LWRKTVG
Sbjct: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78

Query: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLS 126
           N+IYPALIL LPYRDRRIYN++DY LI+ +CSYLKLPKNS TE+RL  WKQR G+   LS
Sbjct: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138

Query: 127 SLLVEEISKRRTEP---TRKSITVDSVNFYLDELSKEMNASGR-GFKNLVKSKPFLHCLE 182
           S +V EI KR++EP   TR+ IT+D +N  LD LS+E N+ G  G++ L  S  F+ CLE
Sbjct: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198

Query: 183 NMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLK 242
           NMTFVEL+FFFDI+LK+RVIGG EHK LN WHPDAQDYLSVVSDL+ V +KL+DP + LK
Sbjct: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258

Query: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302
           NDDL+I VG  FAPQ AKK+++SYEKIC  L++DFF+EEKMDGERIQ+HY +YG  + F 
Sbjct: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318

Query: 303 SRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAK 362
           SRRG DYTYLYG ++  GT+S+YL   ++V+ CVLDGEMVTFD  R  +LPFGLVK SA+
Sbjct: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378

Query: 363 EALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR 422
             ++   + N  + PL MVFDL+YLNG SL  +PLYQRK YL  I  P + +VE++R  R
Sbjct: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438

Query: 423 CYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482
           C D  S+K +LE AIS+GSEGVVLKHY+S Y VASRN++WIKVKPEYLE+FGEN+DLI+I
Sbjct: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

Query: 483 GRDSGKKDSFMLGLLVVDEQET------------GKTDQEGPSEILNDSSTERRATNPKK 530
           G+D GKKDS M GL VV+E E                D  G  E    +  ER  T    
Sbjct: 499 GKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKT---- 554

Query: 531 RVRKVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSES 590
            +++ +SFCSIANGISQEEFK I R T+G WKK+  + PP  +LEFGS++PAEWI+P +S
Sbjct: 555 -IKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDS 613

Query: 591 IVLEIKSRSLDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPS 650
           IV+E+K+RSL+N E   +K+ T  TLYGGYCR+IR DKDW  CYTL EL   +R K   +
Sbjct: 614 IVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSN 673

Query: 651 HQVENLQLQLV--PKKRKRALVSDPFQQSREQKPI----SGVFAGLFFYVLSDYINSVTG 704
            +  N     +   K+RK   +   F++  EQ P     S +F GL+FYV+SD +++ TG
Sbjct: 674 KRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDA-TG 732

Query: 705 VRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWI 764
            R++R EL D I+  GG ++HNVI K H     R++  K T EC++LIDRGYDI+ P+W+
Sbjct: 733 SRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWV 792

Query: 765 MDCTAYNKLLPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXX 824
           +DC   + LL +EP YCF+VS +L  +A+RRVD FGDSFE  I                 
Sbjct: 793 LDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQI--SEDSFSRLIERNVRS 850

Query: 825 TRQADKSFE---LQIIPLFLFSNRIVYIPRSKIGPKDEML---LEMKIRLFGGKITDQQS 878
            R A  S +   +  +PLFLF  R + +   +I  KD+ L   L+++IRL+GGK T   +
Sbjct: 851 LRNAPPSIQYDMVDTVPLFLFYGRTILL---RI--KDKALFTKLKVQIRLYGGKTTGDLA 905

Query: 879 LSNLIIIPYADPIWRGDCLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQV 938
             NL++I   +        ++V S + +    S++D  P +P IVTPEW+D SISE CQV
Sbjct: 906 SCNLVVIQQNEIA----VAKDVRSSLLKL--TSDTDKPPVLPYIVTPEWIDSSISEGCQV 959

Query: 939 PEEDFPV 945
           PEED PV
Sbjct: 960 PEEDHPV 966

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/946 (50%), Positives = 639/946 (67%), Gaps = 13/946 (1%)

Query: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIY 70
           P NFAPSPDF+WLC+ELF K + V         K ++ RYYE++SNF +LWRKTVGNN Y
Sbjct: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68

Query: 71  PALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLV 130
           P LILALPYRDRR YNIKD  LI+ +C YL LPK S TE++L +WKQR  +   LSS  V
Sbjct: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128

Query: 131 EEISKRRTEP---TRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFV 187
            EI KR++ P    R++IT+D +N  LD+L+   ++ G+G + L  S  F  CLENM+F+
Sbjct: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188

Query: 188 ELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLS 247
           ELK+FFDILLK R+IGG EHKLLN WHPDA DY SVVSDL  VT KLY+P +RL+N+DL+
Sbjct: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248

Query: 248 IKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGI 307
           +K+G AFAP LAK++N+SYEKI   L +DF +EEKMDGERIQ+HYM+YG  IKF SRRG 
Sbjct: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308

Query: 308 DYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSF 367
           DYTYLYG +  +GTI+ YLK +++VKEC+LDGEMVT+D  +++ILPFGLVK SAK  LS 
Sbjct: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368

Query: 368 NDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAE 427
             I+N  +HPL+M FDL+YLNGTSL  LPLYQRK+YLS IL      V+IV ++RC + E
Sbjct: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428

Query: 428 SVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSG 487
           S+ KSL  AIS+GSEG++LK  +S Y VASRN++WIK+KP+YL++FGEN+DLIIIGRD G
Sbjct: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488

Query: 488 KKDSFMLGL-LVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGIS 546
           KKD+FM  L + +D+ +     QE    +  D+      T    R+ K +SFC+IANGIS
Sbjct: 489 KKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGIS 548

Query: 547 QEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETN 606
             EFKEID+KTRG W++   + PP   L+FG+K P EWI+P ES+VLE+KSRSLDNTE+N
Sbjct: 549 NAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTESN 608

Query: 607 MQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKKRK 666
           ++KY    TL+GGYCR +RYDKDWT CYT+ E   +R+ K    +  E++      +K++
Sbjct: 609 VKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKGRKKR 668

Query: 667 RAL----VSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGK 722
                  V  P ++   +   S +F  L F VLSDY++  TG RI R+ L  +I+ +GGK
Sbjct: 669 NTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGGK 728

Query: 723 LIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCF 782
           +I+NV+ K    G +R+I      EC ALI RGYDIL P W++DC    +LL +E ++CF
Sbjct: 729 VIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNHCF 788

Query: 783 SVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQ---ADKSFELQIIPL 839
           +VS +L  ++  RVD + DSFEN+I                 +      +  FEL+ +P 
Sbjct: 789 NVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGLPP 848

Query: 840 FLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEE 899
            LF +R V+I  +K+  +    +  + +LFGG++T      NLIIIP  D   +   L++
Sbjct: 849 LLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQVLQK 908

Query: 900 VHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945
           +  ++   ++  NS    RIP IV+ EW+  SI EN QVPEE++ V
Sbjct: 909 IRGKLASMIQKLNS--TERIPPIVSEEWLYQSIKENIQVPEENYSV 952

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/950 (49%), Positives = 640/950 (67%), Gaps = 25/950 (2%)

Query: 8   IPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSF-RYYEIISNFTELWRKTVG 66
           I EPHNF+PSPDF+WLC+ELF K++++        G    +  YY+II+NF ++WR+TVG
Sbjct: 28  IEEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVG 87

Query: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLS 126
           N+IYPALIL +PYRDRR+YNIK+  LIR VC YLKLPKNS TE+RL  WK R  +   LS
Sbjct: 88  NDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLS 147

Query: 127 SLLVEEISKRRTEPTRK-SITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMT 185
           +  VEEI KR+ EP  K  IT+D +N  LD L  E    G   + + +S+ F  C ENMT
Sbjct: 148 TFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENMT 207

Query: 186 FVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDD 245
           +VELK+FFDILLK++++GG EHK LNCWHPDAQDYLSVVSDL++V+SKL++P+ RLK DD
Sbjct: 208 YVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDD 267

Query: 246 LSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRR 305
           L+I +  AF P+ AK++  SY+ I   L+NDFF+EEKMDGERIQ+HYMNYG  +KF SRR
Sbjct: 268 LTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRR 327

Query: 306 GIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL 365
           G+DY+YLYG N  +G I +YL F   VKEC+LDGEMVT+D+++  ILPFGLVK SA ++L
Sbjct: 328 GLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSL 387

Query: 366 SFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYD 425
           S +DI  + +HPLYM FDL+YLNG+SL+ LPL+QRK YL  +LIP    VEI+    C D
Sbjct: 388 SVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCND 447

Query: 426 AESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRD 485
           +  +K SLE AI LGSEG++LK + S Y VA R+++WIK+KPEYLE+FGEN+DLI+IGRD
Sbjct: 448 SSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGRD 507

Query: 486 SGKKDSFMLGLLVVDEQETGKTDQEGPSEI--LNDSSTERRATNPKKRVRKVLSFCSIAN 543
            GKKDS M GL++  + E        P EI  L+ + T+   +  K   RK++SFC+IAN
Sbjct: 508 PGKKDSLMCGLILTGDNE--------PEEITSLDSNPTDTAESFLKPDKRKIISFCNIAN 559

Query: 544 GISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT 603
           GISQ+EF++IDR T GHW K     PP  + EFG+K P EWI P  S+VLEIK+RSL+  
Sbjct: 560 GISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETN 619

Query: 604 ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQL---QL 660
           E+   KY T  TL+GGYCR+IRYDKDW  C+T +E  E+R  K+   +  +N  L   + 
Sbjct: 620 ESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKK 679

Query: 661 VPKKRKRALVSDPFQQSREQKPISGV-FAGLFFYVLSDYINSVTGVRITRSELNDVIVKH 719
            PKKR    +++ F+ +++    S V F GL FYV+SDYI+   G R+++S+L +++++H
Sbjct: 680 RPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEH 739

Query: 720 GGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPS 779
            GKL+HN I +   +  +R+I  K TRE  +LI+RGYDI+HP+WI+DC +  KL+ + PS
Sbjct: 740 NGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPS 799

Query: 780 YCFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSF---ELQI 836
           +CF+VS  L  V + RVD +GDS+E  +                 +  ADK     E  +
Sbjct: 800 HCFNVSSSLMEVTKTRVDRYGDSYETSL--TEKDFEILINRQVLKSESADKRITEGENHL 857

Query: 837 -IPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGD 895
            IP+ LF NR  +IP + +       L+ K+ L+GGK+ ++ S  N+I+        R +
Sbjct: 858 KIPILLFCNRRFFIPET-LPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTENRKE 916

Query: 896 CLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945
            ++++   +       NS  VP +PRIV   W+D  ISE  QVPEED+P 
Sbjct: 917 VMKKIRRAL--VCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPA 964

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/940 (49%), Positives = 634/940 (67%), Gaps = 29/940 (3%)

Query: 13  NFAPSPDFRWLCEELFAKVEEVLINGTAGT-GKSVSFRYYEIISNFTELWRKTVGNNIYP 71
           NFAPSPDF WLCE+LFAK++ V          K V+ RYYE+ISNFT LWR TVGNNIYP
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 72  ALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLVE 131
           AL L LPYRDRR++NIKDY LI+ +C++LKLPK+S TE++L +WKQ  G+   LS   VE
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 132 EISKRRTEPT---RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188
           EI KRR+EP     + IT+D +N YLD+L+ E    GR FKNL  S     CL +MTF+E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248
           +++FFDILLKNR +GG EHKLLNCWHPDAQDYLSVVSDL  V  +L+DP  RL N DL I
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308
            +G AFAPQLA K+++SY+KI   L  DFF+EEKMDGERIQ+HY N+G  IKF+SRR  D
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368
           YTYLYG NL +GT++ ++  + +VK+CVLD E+VTFD+  K++LPFG+VK SAK  LS +
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 369 DINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428
            I+   FHPL MVFD+LYLNG +L  LP Y+R+EYL  IL P+   +EI++  R  D + 
Sbjct: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443

Query: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488
           +KKSLE A+S+GSEG++LK Y S Y +ASR+++WIK+KPEYLE+FGEN+DL+++GRD  K
Sbjct: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503

Query: 489 KDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQE 548
           KDS MLGLL  +E       Q+ P  + + SS E       +R R  +S C IANGIS E
Sbjct: 504 KDSLMLGLLDYEE-----VIQDSPIMVNSQSSEEN-----SQRFRGFVSLCIIANGISNE 553

Query: 549 EFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNMQ 608
           E+KEIDRKT+G W  +  + PP   ++FGSK+P +WI+P +S++LEIK+RSLDNT ++ +
Sbjct: 554 EYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSER 612

Query: 609 KYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKKRKRA 668
           K+A  CTL+GGYCR+IR DK+W  CYTL E +E  ++ +N   +  +   +++ KKR+  
Sbjct: 613 KFAAGCTLFGGYCRQIREDKNWKTCYTLQE-FERAKSGNNWRKRGSSKPQKVISKKRRYN 671

Query: 669 LVSD---PFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIH 725
           ++S      +   E +  S +F G++FYVLSDY + V   RI +SE+  VIV +GG+L+ 
Sbjct: 672 IISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQ 731

Query: 726 NVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVS 785
           NVI + + + D+R+I  + T EC +LI RGYDI+ P+W+ DC    K++ +EPS+CF+ S
Sbjct: 732 NVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFS 791

Query: 786 GKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFE--LQIIPLFLFS 843
            +L   A +R+D +GD +E DI                  +Q D  F+  L  +P FLF 
Sbjct: 792 KQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFH 851

Query: 844 NRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVHSQ 903
            RIV++       + E  +   +  +GGK+T++ S +NL+I+  A    R   + ++  Q
Sbjct: 852 GRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQRR---INDIRKQ 905

Query: 904 INEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943
           I+  V     D  PRIP +V+  W+   I +N QV E+++
Sbjct: 906 ISSEV--IKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/958 (47%), Positives = 642/958 (67%), Gaps = 32/958 (3%)

Query: 11  PHNFAPSPDFRWLCEELFAKVEEV---LINGTAGT--GKSVSFRYYEIISNFTELWRKTV 65
           P NFAPSPDF+WLC+ELF K++++   + N TA T   K +S RY++ I++F +LWR T+
Sbjct: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82

Query: 66  GNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSL 125
           G++I+PAL L LPYRDRR+YNIKD  LIR +CSYLKLPKNS  E+RL  WK +  +  +L
Sbjct: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142

Query: 126 SSLLVEEISKRRTEPTR---KSITVDSVNFYLDELS-KEMNASGRGFKNLVKSKPFLHCL 181
           ++  + EISKR+ EP     + I++D +N  LD+L     N + +   NL++ + F  CL
Sbjct: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202

Query: 182 ENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRL 241
           ENMTF+ELK+FFDI++KN+++G  E+  L  WHPD+++YLSVVSDLR +++KL++P I++
Sbjct: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262

Query: 242 KNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKF 301
            N DLSIKVG+ FAPQLAK++ LSY+ I + L NDFF+EEKMDGERIQ+HYMNYG+++KF
Sbjct: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322

Query: 302 FSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSA 361
           FSR G DYTYLYG +  +GTI+++L+   +VKECVLDGEMVTFD+  K +LPFGLVK SA
Sbjct: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382

Query: 362 KEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYS 421
              L+  DI+N+ FHPL+MVFD+LYLNG+SL  LPL++RKE+L+++L P K  VEI+   
Sbjct: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442

Query: 422 RCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLII 481
           RC D+  +KK L+ AIS+GSEG+VLK Y S Y   +R+NNWIKVKPEYLEEFGEN+DLI+
Sbjct: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502

Query: 482 IGRDSGKKDSFMLGLLVVDEQE--TGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFC 539
           IGRDSGKKD  + G+LV +E++  +    +E   EI++DS  +   T P + ++KV+SFC
Sbjct: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKVISFC 562

Query: 540 SIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRS 599
           +IANG+SQ E KEI+R TRG WK  +  +PP  +LEFG+K P EWI P +S+VLEIK+RS
Sbjct: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622

Query: 600 LDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYEN---RRTKSNPSHQVENL 656
           LD T+    KYAT CTLYGGYCR+IR DKDWT CYTL +L  N   R  K N     +N 
Sbjct: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKN-----KNK 677

Query: 657 QLQLVPKKRKRALVSDP---FQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELN 713
           Q  +    RK++ +  P        + + IS +F GL+FY++SDYI      RI R ++ 
Sbjct: 678 QTLIRSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDIC 737

Query: 714 DVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKL 773
            +I+K+GG++I+NVI K + I  +R++  K T EC  L+ RGYD+++  W+ DC     +
Sbjct: 738 SLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVI 797

Query: 774 LPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQA----- 828
           LP+EP++C  VS +L A+A  R+D FGDS+E  +                    +     
Sbjct: 798 LPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNLLLI 857

Query: 829 DKSFELQIIPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYA 888
           +K   +  IP+FLF+NR  ++ +  I   D   L  +I+L+GG +  +    N+I+    
Sbjct: 858 NKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCG 917

Query: 889 DPIWRGDCLEEVHSQINEHVKASNSDTVPR-IPRIVTPEWVDHSISENCQVPEEDFPV 945
             +      +     + ++V A+     P+ IPR V   W+  SI    Q+  ED+P+
Sbjct: 918 SQLVNKKLGDLRCKLVKQYVDAN----FPQPIPRAVNVSWITESIKAGYQLSPEDYPI 971

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/957 (48%), Positives = 636/957 (66%), Gaps = 28/957 (2%)

Query: 10  EPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNI 69
           EP NF+PSPDF+WLC ELF K++EV +   +   +  + +Y  +I+NF  LWR TVGN+I
Sbjct: 15  EPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVTVGNDI 74

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129
           YPAL L LPYRDRR Y I+++ LIR VC YLKL KNS TEQRL+ WKQ+  +  +LSS  
Sbjct: 75  YPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSFC 134

Query: 130 VEEISKRRTEP-TRKSITVDSVNFYLDELSKEMNAS----GRGFKNLVKSKPFLHCLENM 184
           ++EI KR +EP +++ IT+D +N  LD LS E ++S    G   K L + +   +C ENM
Sbjct: 135 IQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCFENM 194

Query: 185 TFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKND 244
           +F+EL++FFDIL+K R+IGG EHK LN WHPDA DYLSVVS+L +VT KL++P+ RL + 
Sbjct: 195 SFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSK 254

Query: 245 DLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSR 304
           DL+I +  AF PQLAKKVNLSYE +   + N F +EEKMDGERIQ+HYM+YG  IK+FSR
Sbjct: 255 DLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSR 314

Query: 305 RGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEA 364
           RG DYTYLYG +  + TIS+YL+ ++ VKEC+LDGEMV++D  R  ILPFG+VK  A  +
Sbjct: 315 RGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANS 374

Query: 365 LSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCY 424
           L  + + N+   PL++VFD+L+LNG+ LT LPLYQRKEYLS+IL P KS +EI+++S  +
Sbjct: 375 LKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH 434

Query: 425 DAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGR 484
           D+ES++ +L+ AIS+GSEG+VLK Y S Y+V  RNN+WIKVKPEYLE+FGENLDLI+IGR
Sbjct: 435 DSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR 494

Query: 485 DSGKKDSFMLGLLVVDEQET-GKTDQEGPSEILNDSSTERRATNP--------KKRVRKV 535
           D GKKDS M G+ V++ +E+  K  QE   E++  +S +  + N          KR+ K 
Sbjct: 495 DPGKKDSLMCGVAVLENEESYEKILQE---EVITLTSDDDDSQNNIPEDKPIRTKRITKF 551

Query: 536 LSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEI 595
           +SFC IANGIS EEFKEIDRKT G WKK S  +PP   LEFG++LP EWI P +S+VLE+
Sbjct: 552 ISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEV 611

Query: 596 KSRSLDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVEN 655
           K+RSL+N E    K+ T  TLYG YCRRIR DKD+ +CYT  +L      K + S    N
Sbjct: 612 KARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYGN 671

Query: 656 LQLQLVPKKRKRALVSDPFQQSREQKP-----ISGVFAGLFFYVLSDYINSVTGVRITRS 710
                + KKR R    +   Q+   +       S +F GL F+V+SDY++S +  R+   
Sbjct: 672 --HSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRLRID 729

Query: 711 ELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAY 770
           EL ++I  +GG+LI N++ +      VR++ CK T EC  LI RGYDI+HP+WI+DC A 
Sbjct: 730 ELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCIAN 789

Query: 771 NKLLPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADK 830
           +KLL  EPS+CF+VS  L  ++++RVD  GDS++  I                       
Sbjct: 790 DKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQLYSNPL 849

Query: 831 SFELQI--IPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYA 888
            F+ QI  IP+FLFSN+  Y P+     K      + I+L+GG   +  +  N+III   
Sbjct: 850 QFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNVIIIGDE 909

Query: 889 DPIWRGDCLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945
                 + +  +  +++ H  +SN + +P IPRIV+ +W++ SI++  QV EEDFP+
Sbjct: 910 HSKSSNEKISSIRKELSIHAVSSN-NVIP-IPRIVSYKWIEKSIAQGTQVVEEDFPI 964

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/945 (48%), Positives = 619/945 (65%), Gaps = 28/945 (2%)

Query: 10  EPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNI 69
           +P NFAPSPDFRWLC+ELF+K+EE+        GK+V+ +  E+I  F +LWR TVG+NI
Sbjct: 35  KPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNI 93

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129
           YP L L LPYRD R YNIKDY L++ VC  L LPK+S TE+RL +WKQ   +G SLS   
Sbjct: 94  YPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFC 153

Query: 130 VEEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188
           VEEI KRR EP   + +T+D++N  LDELSKE +A   GF  L KS  F +CL+NM+F E
Sbjct: 154 VEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSE 213

Query: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248
            ++FFDI+LK RVIGG EHK LNCWHPDAQDYL VVSDL+V++  L++P +RL  ++LSI
Sbjct: 214 QRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSI 273

Query: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308
            +G AFAP LAK+++LSYE++C  L+ DF +EEKMDGERIQ+HY+  G  I+F SRRG D
Sbjct: 274 NIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTD 333

Query: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368
           +T+LYG +L  G ISQ+LKF + V++CVLDGEMV+FD  + V+LPFG+VK +A E L  +
Sbjct: 334 FTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNS 393

Query: 369 D--INNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDA 426
           D  ++ + + PLYM+FDL+YLNG SLT LPL+ RK YL SIL P  ++VEI+   R  + 
Sbjct: 394 DTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEP 453

Query: 427 ESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDS 486
            ++K SLE AI +GSEG++LK +SS Y + +RN++WIK+KPEY EE GE +DL++IGRD 
Sbjct: 454 NAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDP 513

Query: 487 GKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGIS 546
           GKKDS M GL++ DE +    +     + L           PK+R  KV+SFC+IANG+S
Sbjct: 514 GKKDSLMCGLILADETDGSSVNLASQDDPL----------RPKQRNPKVISFCNIANGVS 563

Query: 547 QEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETN 606
             EFKEI+RKTRG W  T+   PP  +LEFG+KLP EWI+P  S+VLE+K+RS+D  E +
Sbjct: 564 DAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELS 623

Query: 607 MQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKK-R 665
            +KY T  TL G YCR +R++KDW+ C T+ +  + +R  +   H+ +    Q+ P+K R
Sbjct: 624 SKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHN--YHKGKRKSHQISPRKQR 681

Query: 666 KRALVSDPF----QQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGG 721
           K A VS+ +      SRE    S +F GL FY+LSDYI+S    R  + ++  ++ K+ G
Sbjct: 682 KLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKK-RYEKDQIGTLVRKNSG 740

Query: 722 KLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYC 781
            ++HN  ++R     +R+I  K T ECR+L ++GYDI+HP WI DC  Y  L+ +EP +C
Sbjct: 741 HVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHC 800

Query: 782 FSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPLFL 841
           F  S KL   +R+RVD FGDSF   +                    A +  EL  IPLFL
Sbjct: 801 FRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPE--ELDGIPLFL 858

Query: 842 FSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLII--IPYADPIWRGDCLEE 899
           F N  +Y  R    P  E  LE  +RLFGG+ +      NL++  + + +       +E 
Sbjct: 859 FQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEG 918

Query: 900 VHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFP 944
           +  +I     +S  D   RIP +V+  W++  I+E C VPEEDFP
Sbjct: 919 LRKRIASTAYSSEVDH--RIPHLVSSNWLEACINEQCLVPEEDFP 961

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/951 (46%), Positives = 621/951 (65%), Gaps = 39/951 (4%)

Query: 10  EPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNI 69
           EPHNFAPSPDFRWLCEELF +++ +        GK+V+ +  EII+ F +LWR TVG++ 
Sbjct: 20  EPHNFAPSPDFRWLCEELFHRLDAI-NEHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129
           +PAL L  PYRD R Y+IKD+ LI+ VC  L L ++S TE+RL +WKQ  G+G SLS   
Sbjct: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138

Query: 130 VEEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGR---GFKNLVKSKPFLHCLENMT 185
           V+EISKRR EP   + +T+D +N  LDEL+KE  ASG+   G   L +S  F  CL+N++
Sbjct: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKE--ASGKKAWGTTGLSESHSFQFCLKNLS 196

Query: 186 FVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDD 245
           F+EL++FFDI+LKNRVIGG EHK L CWHPDAQ YL VV+DL++++ KL++P +RL   D
Sbjct: 197 FLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRD 256

Query: 246 LSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRR 305
           LSI +G AFAP LAK++++SYE+IC  L++DF +EEKMDGERIQ+HY+N G  +KF SRR
Sbjct: 257 LSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRR 316

Query: 306 GIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL 365
           GID+++LYG  +  G ISQYLK    V++CVLDGEMV++D  RK+ILPFG+VK +A + L
Sbjct: 317 GIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDEL 376

Query: 366 SFNDINN-ND-FHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRC 423
             +++ N ND + PLYMVFDL+YLNG SLT +PL+ RKEYL  IL P   VVEI++  R 
Sbjct: 377 INSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436

Query: 424 YDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIG 483
            DA+++K  ++ AI +GSEGV++K  SS+Y V +RN++W+K+KPEY E+ GE +DL++IG
Sbjct: 437 CDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIG 496

Query: 484 RDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIAN 543
           RD GKKDS M GLLV D +     +  GP E         +  +P   + K +SFC++AN
Sbjct: 497 RDPGKKDSLMCGLLVSDSEHI--LENFGPIE-------HGKEGDP---IIKCVSFCNVAN 544

Query: 544 GISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT 603
           G+S EEFKEI+RKTRG W       PP S+LEFGSK+P EWI+P  S+V+E+K+RS++N+
Sbjct: 545 GVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS 604

Query: 604 ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPK 663
           E + ++Y    TL+  YCRRIR DKDWT C ++ + Y+  +   N  H+ +    Q+ P+
Sbjct: 605 EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ-YQQAKAAHN-YHRYKRKVHQVSPR 662

Query: 664 KRKRALVSDPFQ------QSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIV 717
           +++   V + F+      +S      S +F GL FY+LSDY+ S    R  R  +   +V
Sbjct: 663 RKRN--VHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTS-QRRRYERGMVAAKVV 719

Query: 718 KHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIE 777
           KHGG ++ N+ ++   +  +R++  K T ECR L++RGYDI+ P WI DC +    L IE
Sbjct: 720 KHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIE 779

Query: 778 PSYCFSVSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQI- 836
           P +CF  S +L   +R+RVD +GDSF   +                    +  S  LQ  
Sbjct: 780 PKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDD 839

Query: 837 ---IPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWR 893
               PLFL     +Y+  + + P+   +L  KI L+GG +++    +NL+++P A    R
Sbjct: 840 LDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTAR 899

Query: 894 -GDCLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943
               ++E+  +I  +  A N++T  RIP IV  EW+D   +E C VPEEDF
Sbjct: 900 TAYYVQELRQKIAGNAFAGNTNT--RIPHIVRSEWLDTCTTEQCLVPEEDF 948

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/942 (44%), Positives = 582/942 (61%), Gaps = 23/942 (2%)

Query: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIY 70
           P NF+PSPDF WLC+ELF K+EEV +      GK    R  EI SNF  LWRKTVGN+IY
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALK-KKDLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109

Query: 71  PALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLV 130
           PAL+L+LPY DRR Y +KD  L++ +C ++KLP+NS TE+RL  WKQ   +G  LS+  V
Sbjct: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169

Query: 131 EEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVEL 189
           EE+ KRR EP   K +++D VN  LD+L  E N     + +L +S  F +CLE+M++VEL
Sbjct: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229

Query: 190 KFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIK 249
           +FFFDI+LK  ++ G E  LL+CWHPDA+ Y  VVSDLR+V   LYDP+ RL+ +DLS++
Sbjct: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289

Query: 250 VGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDY 309
           +G+AFAP +A++V + YEK+   L NDF+VEEKMDG+RIQVHYM+YG SI +FSR GI+Y
Sbjct: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349

Query: 310 TYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFND 369
           TYLYG N   G+IS +LKF + VKEC+LDGEMV++D   + ILPFGL K  A   ++F  
Sbjct: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409

Query: 370 INNND--FHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAE 427
             + +  + PLY VFDLLYLNG  LT   + +RKEYL  ILIPSK+VV ++   RC DAE
Sbjct: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469

Query: 428 SVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSG 487
           ++  +L  A++ GSEG+VLK   S Y+V  R+++WIK+KPEYLE FGEN+DL++IGRD G
Sbjct: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529

Query: 488 KKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQ 547
           +KDSF+  L V D+ E         S   +DS +E     PK  + K +SFCSIANGIS 
Sbjct: 530 RKDSFICALAVTDDSEKNNPSSYE-SGSDSDSDSEPIIVQPK--IEKFISFCSIANGISN 586

Query: 548 EEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNM 607
           EEFKEIDR TRG+W       PP   +EFG+K P EWI+P  S+VLE+K+RS+DN E+  
Sbjct: 587 EEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKS 646

Query: 608 QKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKS--NPSHQVENLQLQLVPKKR 665
             Y T  TLY  YC+RIR+DK+W+   T+ E    R  +S  N S   +  + +  P+KR
Sbjct: 647 DLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKR 706

Query: 666 KRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIH 725
           +   +      ++  K  +    G +FYV S Y +  +   I  SE+ + +V  GG  IH
Sbjct: 707 RTFHLVGDIDVTKPSK--ADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIH 764

Query: 726 NVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVS 785
           N+ + R  +  + ++GCK TRE + LI+RGYDI+HP W+MDC  Y  +L IEP Y +S S
Sbjct: 765 NLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSAS 823

Query: 786 GKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPLFLFSNR 845
            +L   AR + D +G+S++  +                   +       +   L +F   
Sbjct: 824 EELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKGW 883

Query: 846 IVYIPRSKIGPKD-EMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVHSQI 904
           + YI            +++  I   GG++T+   L+ +++          DC  ++  Q 
Sbjct: 884 LFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAV-------KDCFSQLSLQA 936

Query: 905 ---NEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943
              N   + + S+ V  IP+IVT EWV+  +     V E+++
Sbjct: 937 VRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEY 978

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/933 (43%), Positives = 575/933 (61%), Gaps = 52/933 (5%)

Query: 13  NFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIYPA 72
           NF+PSP+F+WLC+EL  K+ E   +     GK V+ RY EII+NF +LWR TVGN IYPA
Sbjct: 6   NFSPSPEFKWLCDELLGKIYET-SSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPA 64

Query: 73  LILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLVEE 132
           L L +P+RDRRIYN+K+  LI+ +C YL+LPK+S TE RL  WKQR  +G  LS   VEE
Sbjct: 65  LRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEE 124

Query: 133 ISKRRTE-PTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVELKF 191
           I KR+ +      IT+D +N YLDE+S+E N    G+  L  S+ F +CL +MTF+E+KF
Sbjct: 125 IRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKF 184

Query: 192 FFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVG 251
           FFDI+LK RV+ G E+  L  WHPDA DYLSVVSDL V++ +LY+P+ RL+  DLSI + 
Sbjct: 185 FFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITIS 244

Query: 252 FAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTY 311
            AF PQLAK+ +LSYE++   L++DF +EEKMDGER+Q+HY+NYG+ IK+ SRRG+D++Y
Sbjct: 245 HAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSY 304

Query: 312 LYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDIN 371
           LYG N  SG IS  LK   +VK+C+LDGEM+T+D  + ++LPFGLVK SA   +      
Sbjct: 305 LYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAG 364

Query: 372 ---NNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428
                 + PL++ FDL+YLNG SLT L L +RK+YL+ IL P +  VEI++Y +  +AE+
Sbjct: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424

Query: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488
           +K SLE AIS+GSEG+VLKH  S Y V SRN +WIK+KPEYLE+FGEN+DL+IIGR+ GK
Sbjct: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484

Query: 489 KDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQE 548
           KDSF  GL + D           P+E+         A  P     + +SFC+IANG+S E
Sbjct: 485 KDSFFCGLSISD-----------PNEV---------AEKP-----RFISFCTIANGLSNE 519

Query: 549 EFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNMQ 608
           EFK+I+RKT G W   S   P P++L FG+K+P EWI P +S+VLE+K+R++D  E+  +
Sbjct: 520 EFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKR 579

Query: 609 KYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSN-----PSHQVENLQLQLVPK 663
           KY + CTL+ GYC++IRYDKDW    +  E +E+ +   N      SHQV + + +    
Sbjct: 580 KYRSGCTLHFGYCKQIRYDKDWKTVASFSE-FEDMKDARNFYNKRKSHQVTDGKKR--AS 636

Query: 664 KRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKL 723
           KR +  + +  + +    P+S  F+   F V+SDY +S    RI++ +L  VI++HGG++
Sbjct: 637 KRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEI 696

Query: 724 IHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFS 783
           ++          ++ +IG KLTREC+ L++    I+ P WI  C       P      F+
Sbjct: 697 VYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTP------FT 750

Query: 784 VSGKLRAVARRRVDCFGDSFENDIXXXXXXXXXXXXXXXXXTRQADKSFELQIIPLFLFS 843
            S   R      +DC    F  D                   +  D    L  +PLFLFS
Sbjct: 751 ESDIFRGELESSMDC--SQFYTDF--NTASLNHLLETANRGIKNPDSDLLLPEVPLFLFS 806

Query: 844 N-RIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVHS 902
           N ++  +    +     + +E  I+  GG++   ++ S  III + D I R D       
Sbjct: 807 NLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFISREDLFSLRQK 864

Query: 903 QINEHVKASNSDTVPRIPRIVTPEWVDHSISEN 935
             ++ VK S +++ PRIPR+V   W   SI +N
Sbjct: 865 IASKAVKES-TESTPRIPRMVDISWALDSIKDN 896

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 116/442 (26%), Positives = 180/442 (40%), Gaps = 62/442 (14%)

Query: 218 QDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDF 277
           +D    V +  +V +   +  I   N    +K G    P LAK      E +       F
Sbjct: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKF 352

Query: 278 FVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVL 337
             E K DGER QVH +  G S+  +SR G + T  Y        I  YL   ++    +L
Sbjct: 353 TCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERYP----ELHIRDYLADPETTHSLIL 407

Query: 338 DGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D  +  ILPF ++    ++ +   D+           FD+L  NG SL    L
Sbjct: 408 DCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSL 464

Query: 398 YQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGV---VLKHYSSSYN 454
            +R+EYL  +L P     +        + E V+K LE ++    EG+   VL+   S Y 
Sbjct: 465 LERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYE 524

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVVDEQETGKTD 508
            + R+ NW+K+K +YL+  G++LDL ++      G+ +G    F+LG      Q+TG+ +
Sbjct: 525 PSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCY---NQDTGEFE 581

Query: 509 QEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLS 568
                                       + C I  G S E    +  K      K S L 
Sbjct: 582 ----------------------------TCCKIGTGFSDEMLVSLYEKL-----KPSSLE 608

Query: 569 PPPSILEFGSKL-PAEWIEPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRI 624
            P +   + S   P  W EP  +++ E+ +  L  +   +     Y    +L      RI
Sbjct: 609 QPKAFYVYDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRI 666

Query: 625 RYDK---DWTECYTLDELYENR 643
           R DK   D T    + ELYE++
Sbjct: 667 RDDKDVEDATSSEQIVELYESQ 688

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 103/412 (25%), Positives = 170/412 (41%), Gaps = 57/412 (13%)

Query: 251 GFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310
           G    P LAK      E +       F  E K DGER QVH M  G +I+ +SR   + T
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388

Query: 311 YLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDI 370
             Y          Q+L    + +  ++D E V +D  ++ ILPF ++    ++ +   D+
Sbjct: 389 ERYP----EIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444

Query: 371 NNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVK 430
                      FDLLYLNG SL    L  R+++L S+L      ++        +   ++
Sbjct: 445 K---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501

Query: 431 KSLEVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDLIII----- 482
             LE ++S   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++     
Sbjct: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYG 561

Query: 483 -GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSI 541
            G+ +G    F+LG    D +E                                 + C I
Sbjct: 562 RGKRTGTYGGFLLGCYNPDLEE-------------------------------FETCCKI 590

Query: 542 ANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLD 601
             G S+E  + +        K T   +P   +    S  P  W EP  +++ E+ +  L 
Sbjct: 591 GTGFSEEVLQSL----HAQLKDTVIAAPRGDVSYDDSSPPDVWFEP--AMLFEVLTADLS 644

Query: 602 NT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPS 650
            +   +     Y    +L      RIR DK  T+  + D++ E  + ++N S
Sbjct: 645 LSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 112/458 (24%), Positives = 189/458 (41%), Gaps = 60/458 (13%)

Query: 206 EHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLS 265
           + +LL       +D    V +  +V +      I   N+  S++ G    P LAK     
Sbjct: 353 DMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAI 412

Query: 266 YEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQY 325
            E +       F  E K DGER QVH +  G +++ +SR G + T  Y        I  +
Sbjct: 413 NEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERYP----EIHIGDF 467

Query: 326 LKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLL 385
           +K  +  K  +LD E V +D  ++ ILPF ++    ++ +   D+           FD+L
Sbjct: 468 VKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVK---VRVCLFAFDIL 524

Query: 386 YLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGVV 445
             N   L    L +R+E L  +  P+    +        + + ++K L+ +++   EG++
Sbjct: 525 CHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLM 584

Query: 446 LKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGL 496
           +K      S Y  + R+ NW+K+K +YLE  G++LDL ++      G+ +G    F+LG 
Sbjct: 585 VKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLG- 643

Query: 497 LVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEIDRK 556
                               ND++ E              + C I  G S E  +++  K
Sbjct: 644 ------------------CYNDNTGEFE------------TCCKIGTGFSDEMLQQLHEK 673

Query: 557 TRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT---ETNMQKYATN 613
                K T    P  + +   S  P  W EP  S++ E+ +  L  +   +     Y   
Sbjct: 674 ----LKATVIDGPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAGSSAYDKG 727

Query: 614 CTLYGGYCRRIRYDK---DWTECYTLDELYENRRTKSN 648
            +L      RIR DK   D T    + ELYEN+  +S+
Sbjct: 728 VSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS 765

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 98/412 (23%), Positives = 174/412 (42%), Gaps = 59/412 (14%)

Query: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302
           N  + ++ G    P LAK      E +       F  E K DGER QVH    G S+K +
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384

Query: 303 SRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAK 362
           SR G D T  Y        +  Y+K   + K  ++D E V +D  +  ILPF ++    +
Sbjct: 385 SRNGEDMTERYP----EIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440

Query: 363 EALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR 422
           + +   D+           FD+L LN   L     ++R++ L      ++   +      
Sbjct: 441 KGVELKDVK---VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497

Query: 423 CYDAESVKKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479
             + + ++K L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557

Query: 480 III------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVR 533
           +++      G+ +G    F+LG   +D +E                              
Sbjct: 558 VVLGAYYGRGKRTGTYGGFLLGCYNLDSEE------------------------------ 587

Query: 534 KVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAE-WIEPSESIV 592
              + C I  G S E  +++  K      K + +  P + + + S  PA+ W EP  S++
Sbjct: 588 -FETCCKIGTGFSDEMLQDLYTKL-----KDTTVEHPSTNVIYDSSAPADVWFEP--SML 639

Query: 593 LEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYE 641
            E+ +  L  +   +   + +    +L      RIR DK+ T+  + D++ E
Sbjct: 640 FEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIE 691

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 107/413 (25%), Positives = 168/413 (40%), Gaps = 70/413 (16%)

Query: 251 GFAFAPQLAKKVNLSYEKICHALRN-DFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDY 309
           G    P LAK    S  ++    +N  F  E K DGER QVH +  G S++ +SR G D 
Sbjct: 353 GIPLKPMLAKPTK-SISEVLDTFQNIQFTSEYKYDGERAQVHLLPDG-SMRIYSRNGEDM 410

Query: 310 TYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFND 369
           T  Y        I  YL  S +  + +LD E V +D   + ILPF ++    ++++   D
Sbjct: 411 TQRYP----ELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKD 466

Query: 370 INNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESV 429
           I           FD+L  N  SL    L +R++ L SI  P     +        + + +
Sbjct: 467 IK---VRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDEL 523

Query: 430 KKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII---- 482
           +  L+ AI    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL ++    
Sbjct: 524 QTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYY 583

Query: 483 --GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540
             G+ +G    F+L     D +E                                 + C 
Sbjct: 584 GRGKRTGTYGGFLLACYNQDTEE-------------------------------FETCCK 612

Query: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600
           I  G S E  + +        K+T+  SP  + +   S  P  W  P  ++V E+ +  L
Sbjct: 613 IGTGFSDEMLQTL----YNGLKETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTADL 666

Query: 601 DNTETNMQKYATNCTLYGGYCR-------RIRYDK---DWTECYTLDELYENR 643
             +      Y    T+YG           RIR DK   D T    + + YEN+
Sbjct: 667 SLSPI----YKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQ 715

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 108/420 (25%), Positives = 179/420 (42%), Gaps = 66/420 (15%)

Query: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E +       F  E K DGER QVH +N G +++ +SR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 307 IDYTYLY-GVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL 365
            + T  Y  +N     I+ +++  D+ K  +LD E V +D  +  ILPF ++    ++ +
Sbjct: 443 ENMTERYPEIN-----ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDV 497

Query: 366 SFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYD 425
             ND+           FD+L  N   L    L +R+EYL+ +        +        +
Sbjct: 498 ELNDVK---VKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNN 554

Query: 426 AESVKKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482
            + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 555 LDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614

Query: 483 ------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVL 536
                 G+ +G    F+LG      Q+TG+ +                            
Sbjct: 615 GAYYGRGKRTGTYGGFLLGCY---NQDTGEFE---------------------------- 643

Query: 537 SFCSIANGISQEEFKEI-DRKTRGHWKKTSGLSPPPSILEFGSKL-PAEWIEPSESIVLE 594
           + C I  G S E  + + DR T       + +  P +   F S   P  W EP  + + E
Sbjct: 644 TCCKIGTGFSDEMLQLLHDRLT------PTIIDGPKATFVFDSSAEPDVWFEP--TTLFE 695

Query: 595 IKSRSLDNTETNMQKYAT---NCTLYGGYCRRIRYDK---DWTECYTLDELYENRRTKSN 648
           + +  L  +       AT     +L      RIR DK   D T    + ELYEN+    N
Sbjct: 696 VLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 111/461 (24%), Positives = 196/461 (42%), Gaps = 72/461 (15%)

Query: 209 LLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEK 268
           +L       +D    V +  +V +   +  I   +   ++K G    P LAK      E 
Sbjct: 346 VLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEV 405

Query: 269 ICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKF 328
           +       F  E K DGER QVH ++ G +++ +SR G + T  Y        I+ +++ 
Sbjct: 406 LDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERYP----EIKITDFIQD 460

Query: 329 SDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLN 388
            D+ K  +LD E V +D  +  ILPF ++    ++ +  +D+           FD+L  N
Sbjct: 461 LDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVK---VRVCLFAFDVLCHN 517

Query: 389 GTSLTPLPLYQRKEYLSSI--LIPS--KSVVEIVRYSRCYDAESVKKSLEVAISLGSEGV 444
           G  L    L +R+E L+ +  ++P   +   +IV      + + ++K L+ +++   EG+
Sbjct: 518 GERLINKSLRERRECLTKVTKVVPGEFQYATQIV----TDNLDELQKFLDESVNQSCEGL 573

Query: 445 VLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLG 495
           ++K      S Y  + R+ NW+K+K +YLE  G++LDL ++      G+ +G    F+LG
Sbjct: 574 MVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 633

Query: 496 LLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEIDR 555
                 Q+TG+ +                            + C I  G S E  +++  
Sbjct: 634 CY---NQDTGEFE----------------------------TCCKIGTGFSDESLQQL-- 660

Query: 556 KTRGHWKKTSGL--SPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT---ETNMQKY 610
               H + T  +   P  + +   S  P  W EP  + + E+ +  L  +   +     +
Sbjct: 661 ----HERLTPTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTF 714

Query: 611 ATNCTLYGGYCRRIRYDK---DWTECYTLDELYENRRTKSN 648
           A   +L      RIR DK   D T    + ELYEN+    N
Sbjct: 715 AKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 106/422 (25%), Positives = 181/422 (42%), Gaps = 70/422 (16%)

Query: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E +       F  E K DGER QVH +N G +++ +SR G
Sbjct: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532

Query: 307 IDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALS 366
            + T  Y        I+ +++  D  K  +LD E V +D  +  ILPF ++    ++ + 
Sbjct: 533 ENMTERYP----EIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVE 588

Query: 367 FNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR---C 423
            ND+           FD+L  N   L  + L +R+EYL+ +   +K V    +Y+     
Sbjct: 589 LNDVK---VRVCLFAFDILCHNDERLINMSLRERREYLTKV---TKVVPGEFQYATQIIT 642

Query: 424 YDAESVKKSLEVAISLGSEGVVLKHYSSS---YNVASRNNNWIKVKPEYLEEFGENLDLI 480
            + + ++K L+ +++   EG+++K    S   Y  + R+ NW+K+K +YLE  G++LDL 
Sbjct: 643 NNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 702

Query: 481 II------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRK 534
           ++      G+ +G    F+LG      Q+TG+ +                          
Sbjct: 703 VLGAYYGRGKRTGTYGGFLLGCY---NQDTGEFE-------------------------- 733

Query: 535 VLSFCSIANGISQEEFKEIDRKTRGHWKKTSGL--SPPPSILEFGSKLPAEWIEPSESIV 592
             + C I  G S E  + +      H + T  +   P  + +   S  P  W EP  + +
Sbjct: 734 --TCCKIGTGFSDEMLQLL------HARLTPTIIDGPKATYVFDSSAEPDVWFEP--TTL 783

Query: 593 LEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENRRTK 646
            E+ +  L  +   +     +    +L      RIR DK   D T    + ELYEN+   
Sbjct: 784 FEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHV 843

Query: 647 SN 648
            N
Sbjct: 844 QN 845

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 134/295 (45%), Gaps = 17/295 (5%)

Query: 218 QDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDF 277
           +D    V +  +V +   D  I   ++  +I+ G    P LAK      E +       F
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTF 383

Query: 278 FVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVL 337
             E K DGER QVH +  G +++ +SR G + T  Y        I  +L    S    +L
Sbjct: 384 TSEYKYDGERAQVHLLKDG-TMRIYSRNGENMTERYP----EIQIKDFLADPASTTSLIL 438

Query: 338 DGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D  +  ILPF ++    ++ ++ N++           FD+L  N   L   PL
Sbjct: 439 DCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVK---VRVCLFAFDILLHNDMRLINEPL 495

Query: 398 YQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGVVLKHY---SSSYN 454
            +R+E L  +  P +   +        + + ++K L+ ++    EG+++K      S Y 
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVVDEQE 503
            + R+ NW+K+K +YLE  G++LDL ++      G+ +G    F+LG    D ++
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSED 610

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 107/422 (25%), Positives = 182/422 (43%), Gaps = 70/422 (16%)

Query: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E +       F  E K DGER QVH +N G +++ +SR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 307 IDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALS 366
            + T  Y        I+ +++  +S K  +LD E V +D  +K ILPF ++    ++ + 
Sbjct: 443 ENMTERYP----EIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498

Query: 367 FNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR---C 423
            +D+           FD+L  N   L    L +R+E+L+ +   +K V    +Y+     
Sbjct: 499 LHDVK---VKVCLFAFDILCYNDERLINKSLRERREHLAKV---TKVVPGEFQYATQIIT 552

Query: 424 YDAESVKKSLEVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
            + + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL 
Sbjct: 553 NNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 612

Query: 481 II------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRK 534
           ++      G+ +G    F+LG      Q+TG+ +                          
Sbjct: 613 VLGAYYGRGKRTGTYGGFLLGCY---NQDTGEFE-------------------------- 643

Query: 535 VLSFCSIANGISQEEFKEIDRKTRGHWKKTSGL--SPPPSILEFGSKLPAEWIEPSESIV 592
             + C I  G S E  + +      H + T  +   P  + +   S  P  W EP  + +
Sbjct: 644 --TCCKIGTGFSDEMLQLL------HERLTPTIIDGPKATFVFDASAEPDVWFEP--TTL 693

Query: 593 LEIKSRSLDNTETNMQKYAT---NCTLYGGYCRRIRYDK---DWTECYTLDELYENRRTK 646
            E+ +  L  +       AT     +L      RIR DK   D T    + ELYEN+   
Sbjct: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHV 753

Query: 647 SN 648
            N
Sbjct: 754 QN 755

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 173/423 (40%), Gaps = 62/423 (14%)

Query: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E +      +F  E K DGER QVH +  G  ++ +SR G
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410

Query: 307 IDYTYLYGVNLLSGTISQYLKFSDS---------VKECVLDGEMVTFDAMRKVILPFGLV 357
            + T  Y    +   +      ++          VK+ +LD E+V +D  +K ILPF ++
Sbjct: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470

Query: 358 KGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEI 417
               ++ +   D+           FDLLYLN   +    L +R+E L  + +      + 
Sbjct: 471 TTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527

Query: 418 VRYSRCYDAESVKKSLEVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFG 474
                  D + ++  L+ A+    EG+++K      S Y  + R+ NW+K+K +YL+  G
Sbjct: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587

Query: 475 ENLDLIII------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNP 528
           ++LDL+++      G+ +G    F+LG    D QE                         
Sbjct: 588 DSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQE------------------------- 622

Query: 529 KKRVRKVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPS 588
                   + C I  G S E    +        + T   +PP + +   S  P  W +  
Sbjct: 623 ------FETCCKIGTGFSDEMLGNL----HTLLQPTEIDNPPMTYIYDSSAEPDVWFQA- 671

Query: 589 ESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRT 645
             ++ E+ +  L  +   +    +Y    +L      RIR DKD T+  T +++ E   +
Sbjct: 672 -KVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYES 730

Query: 646 KSN 648
           +S+
Sbjct: 731 QSH 733

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 112/459 (24%), Positives = 183/459 (39%), Gaps = 64/459 (13%)

Query: 203 GGQE--HKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAK 260
           GG+E    L++      +D    V +  +V +   +  I        +  G    P LAK
Sbjct: 299 GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAK 358

Query: 261 KVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYG-VNLLS 319
                 E +       F  E K DGER QVH +  G S++ +SR G + T  Y  +N   
Sbjct: 359 PSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYPEIN--- 414

Query: 320 GTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLY 379
             IS ++   D     +LD E V +D  + VILPF ++    ++ +   D+         
Sbjct: 415 --ISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK---VRVCL 469

Query: 380 MVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISL 439
             FD+L  N   L    L +R+ YL  IL P    +++         + ++  L+ ++  
Sbjct: 470 FAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKD 529

Query: 440 GSEGV---VLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKD 490
             EG+   VL    S Y  + R+ NW+K+K +YL+  G++LDL ++      G+ +G   
Sbjct: 530 CCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYG 589

Query: 491 SFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEF 550
            F+LG      Q+TG+ +                            + C I  G S E  
Sbjct: 590 GFLLGCY---NQDTGEFE----------------------------TCCKIGTGFSDEML 618

Query: 551 KEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT---ETNM 607
           + +  K       T    P    +   S  P  W+EP  S++ E+ +  L  +   +   
Sbjct: 619 QNLYEK----LSPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGG 672

Query: 608 QKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643
             Y    +L      RIR DK   D T    + E YE++
Sbjct: 673 SSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQ 711

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 105/418 (25%), Positives = 175/418 (41%), Gaps = 64/418 (15%)

Query: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302
           ++  S++ G    P LAK      E         F  E K DGER QVH MN G S++ +
Sbjct: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393

Query: 303 SRRGIDYTYLY-GVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSA 361
           SR G + T  Y  +N     ++ ++K  +  K  ++D E V +D   K ILPF ++    
Sbjct: 394 SRNGENMTERYPEIN-----VTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRK 448

Query: 362 KEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYS 421
           ++ +   DI           FD+L  N   L    L +R+E L S+           +  
Sbjct: 449 RKDVDIKDIK---VRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKEL 505

Query: 422 RCYDAESVKKSLEVAISLGSEGV---VLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLD 478
              + + ++  L+ ++    EG+   VL    S Y  + R+ NW+K+K +YL+  G++LD
Sbjct: 506 STNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLD 565

Query: 479 LIII------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRV 532
           L ++      G+ +G    F+LG      Q+TG+ +                        
Sbjct: 566 LCVLGAFYGRGKRTGTYGGFLLGCY---NQDTGEFE------------------------ 598

Query: 533 RKVLSFCSIANGISQEEFKEI-DRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESI 591
               + C I  G S E  + + DR      K T+   P  + +   S  P  W EP  ++
Sbjct: 599 ----TACKIGTGFSDEVLQSLYDR-----LKSTTIDGPKATYIYDSSAQPDVWFEP--TL 647

Query: 592 VLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLD---ELYENR 643
           + E+ +  L  +   +     Y+   +L      R+R DK   E  + +   ELYEN+
Sbjct: 648 LFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQ 705

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 106/463 (22%), Positives = 188/463 (40%), Gaps = 58/463 (12%)

Query: 196 LLKNRVIGGQE--HKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFA 253
           LL N    G+E   +L+       +D    V +  +V +   D  I   +    ++ G  
Sbjct: 282 LLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIP 341

Query: 254 FAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLY 313
             P LAK      E +       F  E K DGER QVH +  G +++ +SR G + T  Y
Sbjct: 342 LKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 400

Query: 314 GVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNN 373
                  +I  ++   +  K  +LD E V +D +++ ILPF ++    ++ +   D+   
Sbjct: 401 P----EISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK-- 454

Query: 374 DFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSL 433
                   FD++  NG       L +R+E L+ +  P     +          E ++K L
Sbjct: 455 -VRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFL 513

Query: 434 EVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDLIII------GR 484
           + ++    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL ++      G+
Sbjct: 514 DQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGK 573

Query: 485 DSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANG 544
            +G    F+LG      Q++G+ +                            + C I  G
Sbjct: 574 RTGTYGGFLLGCY---NQDSGEFE----------------------------TCCKIGTG 602

Query: 545 ISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT- 603
            S E  +++  +    + KT+   P  + +   S  P  W EP+    +     SL    
Sbjct: 603 FSDEMLQQLYER----FSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVY 658

Query: 604 ETNMQKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643
           +     Y    +L      R+R DK   D T    + ELY+++
Sbjct: 659 KAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQ 701

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 132/305 (43%), Gaps = 17/305 (5%)

Query: 208 KLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYE 267
           +L++      +D    V + ++V     +  I   +    +  G    P LAK      E
Sbjct: 314 ELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISE 373

Query: 268 KICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLK 327
            +       F  E K DGER QVH +  G S++ +SR G + T  Y        IS ++ 
Sbjct: 374 VLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYP----EIRISDFIA 428

Query: 328 FSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYL 387
                   +LD E V +D  +  ILPF ++    ++ ++  D+           FD+L  
Sbjct: 429 DPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK---VRVCLFAFDILCY 485

Query: 388 NGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGV--- 444
           N   L   PL +R+  L   L+P    +++         + ++  L+ A+    EG+   
Sbjct: 486 NDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVK 545

Query: 445 VLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLV 498
           +L+   S Y  + R+ NW+K+K +YL+  G++LDL ++      G+ +G    F+LG   
Sbjct: 546 ILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYN 605

Query: 499 VDEQE 503
            D  E
Sbjct: 606 QDSGE 610

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 107/434 (24%), Positives = 182/434 (41%), Gaps = 65/434 (14%)

Query: 229 VVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERI 288
           ++ S L D  + L N+   ++ G    P LAK      E +      +F  E K DGER 
Sbjct: 334 IIQSCLNDGIMELDNN-CKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392

Query: 289 QVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMR 348
           QVH ++ G+ ++ +SR G + T  Y    +   + +    +D     +LD E+V +D  +
Sbjct: 393 QVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQ 451

Query: 349 KVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSIL 408
             ILPF ++    ++ +   D+           FD+LY NG  L    L +R++ L  + 
Sbjct: 452 NKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLITKTLRERRKILHEV- 507

Query: 409 IPSKSVVEIVRYSRCY---DAESVKKSLEVAISLGSEGVVLK---HYSSSYNVASRNNNW 462
             +K V    +Y+      + + ++K L+ AI    EG+++K      S Y  + R+ NW
Sbjct: 508 --TKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNW 565

Query: 463 IKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEIL 516
           +K+K +YL   G++LDL ++      G+ +G    F+LG      Q++G+ +        
Sbjct: 566 LKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCY---NQDSGEYE-------- 614

Query: 517 NDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEF 576
                               + C I  G S E   ++    R        +  P S   F
Sbjct: 615 --------------------TCCKIGTGFSDEMLTKLYELFREEE-----IEVPKSFYNF 649

Query: 577 GSKL-PAEWIEPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDK---D 629
            S   P  W EP   ++ E+ +  L  +   +     Y    +L      RIR DK   D
Sbjct: 650 DSSAEPDIWFEP--KVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVED 707

Query: 630 WTECYTLDELYENR 643
            T    + E+YEN+
Sbjct: 708 ATSSDQIIEMYENQ 721

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 99/413 (23%), Positives = 167/413 (40%), Gaps = 62/413 (15%)

Query: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           S++      P LAK      E         F  E K DGER QVH +  G +++ +SR G
Sbjct: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414

Query: 307 IDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALS 366
            + T  Y        I  ++      K  +LD E V +D  +  ILPF ++    ++ + 
Sbjct: 415 ENMTERYP----EIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDV- 469

Query: 367 FNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDA 426
             DIN          FD+L  N   L    L +R++ L SI        +        + 
Sbjct: 470 --DINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNL 527

Query: 427 ESVKKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII- 482
           E ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G++LDL ++ 
Sbjct: 528 EELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587

Query: 483 -----GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLS 537
                G+ +G    F+LG      Q+TG+ +                            +
Sbjct: 588 AYFGRGKRTGNYGGFLLGCY---NQDTGEFE----------------------------T 616

Query: 538 FCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFG-SKLPAEWIEPSESIVLEIK 596
            C I  G S E  +++  +      K++ +  P +   F  S  P  W EP  +++ E+ 
Sbjct: 617 ACKIGTGFSDEVLQQLHERL-----KSTVIDLPKATYVFDPSAEPDVWFEP--TLLFEVL 669

Query: 597 SRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643
           +  L  +   +     Y    +L      R+R DK   D T    + E+YEN+
Sbjct: 670 TADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQ 722

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 107/413 (25%), Positives = 178/413 (43%), Gaps = 62/413 (15%)

Query: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEE-KMDGERIQVHYMNYGKSIKFFSRR 305
           S++ G    P LAK    +  +I    + + F  E K DGER QVH ++ G +++ +SR 
Sbjct: 383 SLRPGIPLKPMLAKPTK-AINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRN 440

Query: 306 GIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL 365
           G + T  Y    +   I+  L  S      +LD E V +D  +  ILPF ++    ++ +
Sbjct: 441 GENMTERYPEIHIRDFIADPLVTST----LILDCEAVAWDNEQNKILPFQVLSTRKRKDV 496

Query: 366 SFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR--- 422
              D+           FD+L  N   L    L +R++ L  +   +KSV    +Y+    
Sbjct: 497 DLKDVK---VKVCLFAFDILCHNDEKLINKSLRERRQILQEV---TKSVTGEFQYATEMT 550

Query: 423 CYDAESVKKSLEVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDL 479
             + + ++K L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 551 SSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDL 610

Query: 480 IIIGRDSGK-KDSFMLG--LLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVL 536
            +IG   G+ K + M G  LL    Q+TG+ +                            
Sbjct: 611 CVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFE---------------------------- 642

Query: 537 SFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIK 596
           + C I  G S E  +++   TR       G  P  + +   S  P  W EP  +++ E+ 
Sbjct: 643 TCCKIGTGFSDEMLQQL--YTRLTPTVLDG--PKATFVYDSSAEPDVWFEP--TLLFEVL 696

Query: 597 SRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643
           +  L  +   +     Y    +L      R R DK   D T    + ELYEN+
Sbjct: 697 TADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQ 749

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 103/441 (23%), Positives = 180/441 (40%), Gaps = 65/441 (14%)

Query: 218 QDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDF 277
           +D    V +  +V +   +  I   +    +  G    P LAK      E +    +   
Sbjct: 333 RDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITE-VLDRFQGQL 391

Query: 278 FVEE-KMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECV 336
           FV E K DGER Q+H +  G +++ +SR G + T  Y        I  +L    S +  +
Sbjct: 392 FVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMTERYP----EIDIRDFLS-DPSTESLI 445

Query: 337 LDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLP 396
           LD E V +D  +  ILPF ++    ++ +   D+           FDLL  NG  L    
Sbjct: 446 LDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVK---VRVCLFAFDLLCHNGEPLINKS 502

Query: 397 LYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGVVLKHYS---SSY 453
           L +R++ L  +  P              + E ++  L+ ++    EG+++K      S Y
Sbjct: 503 LRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHY 562

Query: 454 NVASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVVDEQETGKT 507
             + R+ NW+K+K +YL   G++LDL ++      G+ +G    F+LG      Q+TG+ 
Sbjct: 563 EPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCY---NQDTGEY 619

Query: 508 DQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEI-DRKTRGHWKKTSG 566
           +                            + C I  G S+E  +++ DR      K T+ 
Sbjct: 620 E----------------------------TCCKIGTGFSEELLQQLYDR-----LKPTAM 646

Query: 567 LSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRR 623
            +P    +   ++ P  W EP  +++ E+ +  L  +   +    +Y    +L      R
Sbjct: 647 EAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLR 704

Query: 624 IRYDKDWTECYTLDE---LYE 641
           IR DK   E  + ++   LYE
Sbjct: 705 IRDDKSVEEATSSEQVVDLYE 725

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 52/101 (51%), Gaps = 9/101 (8%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           YIN  T  +  R +L+++IV HGGK +H++  K+       ++   L  + R      Y 
Sbjct: 173 YINGYT--KPGRLQLHEMIVLHGGKFLHHLSAKKRV---THIVASNLPLKKRIEF-ANYK 226

Query: 758 ILHPRWIMDCTAYNKLLPIEPSYCFSVSGKLRAVARRRVDC 798
           +++P WI DC    +LLP +    +S++ KL    ++  +C
Sbjct: 227 VVNPDWITDCIKERRLLPWQN---YSLTAKLDEQQKKLDNC 264

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 691 FFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRA 750
            F  L+ YIN  T  R +R +L+++IV +GGK +H++  KR       +I   LT + + 
Sbjct: 109 LFKDLTVYINGYT--RPSRFQLHEMIVLNGGKFLHHLSAKRSV---THIIASTLTLK-KK 162

Query: 751 LIDRGYDILHPRWIMDCTAYNKLLP 775
           +    Y ++ P W++D     KLLP
Sbjct: 163 IEFANYKVVKPEWLVDSIKVKKLLP 187

>CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346w REV1
           DNA repair protein
          Length = 887

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 42/90 (46%), Gaps = 11/90 (12%)

Query: 686 VFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLT 745
           +F GL  Y     IN  T     R EL+ +IV HGGK +H++  KR       +I   L 
Sbjct: 84  IFQGLVLY-----INGFTTP--GRFELHQMIVVHGGKFLHHMSAKRSV---THIIASNLP 133

Query: 746 RECRALIDRGYDILHPRWIMDCTAYNKLLP 775
            + R      Y ++ P WI+D     KLLP
Sbjct: 134 LKKRIEF-ANYKVVKPNWIVDSIQQKKLLP 162

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 689 GLFFYVLSDYINSVTGVRIT-RSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRE 747
           GL   +  D I  + G  I  R +L++ IV HGGK IH++  K+       +I   LT +
Sbjct: 174 GLPPQIFKDCIIYINGYTIPGRLQLHESIVLHGGKFIHHLSAKKKI---THIIASNLTLK 230

Query: 748 CRALIDRGYDILHPRWIMDCTAYNKLLP 775
            +   ++ Y ++ P WI+      KLLP
Sbjct: 231 KKLEFEK-YKVVKPDWIVKSIESKKLLP 257

>KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}
           Anc_7.46 YOR346W
          Length = 817

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 24/130 (18%)

Query: 684 SGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCK 743
            G+FAGL  YV     N  T     R +L+  IVKHGG+  H +  KR       +I   
Sbjct: 39  GGIFAGLVVYV-----NGYTRP-WDRLKLHAEIVKHGGEFCHYMSGKRQV---THIIASN 89

Query: 744 LTRECRALID-RGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSGK--------LRAV-AR 793
           LT   +  ++ R Y ++  +W++D     +LLP +    + V G+        L+A+ A 
Sbjct: 90  LT--LKKFVEFRNYKVVSAQWVVDSIQRGRLLPWQD---YRVEGQGDDQQKLDLKALRAT 144

Query: 794 RRVDCFGDSF 803
              DC G  F
Sbjct: 145 STTDCNGPDF 154

>Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii AFR095C
          Length = 767

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 692 FYVLSDYINSVTGVRITRSELNDVI-VKHGGKLIHNVILKR-HCIGD-VRLIGCKLTREC 748
           FY+   +I  ++   ++  EL  +  + H  + + N  +K   C    V +  C      
Sbjct: 112 FYM---FIGRISAPEVSTGELQQLCEIGHSYRCLTNHFIKDIECSAQSVFITDCATGARA 168

Query: 749 RALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSGK-LRAVARRRVDCFGD 801
           +A  + G  I+HP+W+MDCT    +L +E       +GK    + R    C+ +
Sbjct: 169 KAAREEGVPIVHPKWVMDCTKRGAVLEMEYYLLEHCAGKPWHEIGREACSCWDE 222

>NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.46
           YOR346W
          Length = 897

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           YIN  T     R +L+++IV HGGK +H++  K+       +I   L  + R L  + Y 
Sbjct: 139 YINGYTVP--GRLQLHEMIVLHGGKFLHHLSAKKKV---THIIASNLPLKKR-LEFQNYK 192

Query: 758 ILHPRWIMDCTAYNKLLP 775
           ++ P WI+   A  KLLP
Sbjct: 193 VVKPDWIVQSIAQGKLLP 210

>Skud_10.124 Chr10 complement(230827..233124) [2298 bp, 765 aa] {ON}
           YJL090C (REAL)
          Length = 765

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 750 ALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSGKLR--AVARRRVDCF 799
           A ID+   I+H +WI+DC   N LLP +P Y       L   ++     DC+
Sbjct: 188 AAIDQNLPIIHFKWILDCQKRNALLPYDPHYLLPKVKDLAYDSIGLNSCDCW 239

>TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {ON}
           Anc_1.276 YJL090C
          Length = 603

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 749 RALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFS---VSGKLRAVARRRVDCFGD 801
           +A I++G  I+H +WI+DC   N  L  +P Y  S    +     + R   +C+GD
Sbjct: 177 QAAIEQGIPIVHYKWILDCQRRNATLEYDPYYLVSNIPENTPFEKIGRESCECWGD 232

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 8/96 (8%)

Query: 685 GVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVR---LIG 741
           G F G  FYV   +I  V G R++ +EL  +    G + +      R      R   +  
Sbjct: 109 GPFGG--FYV---FIGRVAGGRVSAAELQQLCESGGARRVVTSHFVRDTASSARSVFVTD 163

Query: 742 CKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIE 777
           C       A  ++G  ++HP+W+ DC     ++ +E
Sbjct: 164 CAEGARAAAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 18/118 (15%)

Query: 379 YMVFDLLYLNGTSLTPLPLYQRKEYLSS----------ILIPSKSV-----VEIVRYSRC 423
           Y++FD L +NG  LTP P   R  +L            ++ P + V     + +   S  
Sbjct: 144 YLMFDCLAINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKHMSFS 203

Query: 424 YDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLII 481
           YD   V  SLE    + S+G++     + Y V  +++  +K KPE  EE   +  LI+
Sbjct: 204 YDLLKVANSLEKLPHM-SDGLIFTPVKTPYFVGGKDSLLLKWKPE--EENSVDFKLIL 258

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 749 RALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSV---SGKLRAVARRRVDCF 799
           +A ++ G  I+HP+W++DC   N LL  +P Y          L  +     DC+
Sbjct: 166 KAAMELGIPIIHPKWVLDCHKRNALLEFDPYYLLETIEPGTTLDQIGINSCDCW 219

>Kpol_359.6 s359 complement(5679..7445) [1767 bp, 588 aa] {ON}
           complement(5679..7445) [1767 nt, 589 aa]
          Length = 588

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 675 QQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCI 734
           Q S+ + P+S +F+   FYV         G  +    L  +I+  GG +I    L +   
Sbjct: 337 QPSQYESPVSTLFSDFVFYV---------GREVPIDILEFLILSCGGSVISEAALDKLET 387

Query: 735 GDVRLIGCKLTRECRALIDR--------GYDILHPRWIMDCTAYNKLLP 775
            D+     K+T +   ++DR        G   + P+WI DC    KL+P
Sbjct: 388 KDIDF--SKVTHQ---IVDRPVLKNKVAGRTYIQPQWIFDCLNKAKLVP 431

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 9/101 (8%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           YIN  T  +  R +L+++IV HGGK +H +  K+       ++   L  + R      Y 
Sbjct: 172 YINGYT--KPGRLQLHEMIVLHGGKFLHYLSSKKTV---THIVASNLPLKKRIEF-ANYK 225

Query: 758 ILHPRWIMDCTAYNKLLPIEPSYCFSVSGKLRAVARRRVDC 798
           ++ P WI+D     +LLP +    +S++ KL    ++  +C
Sbjct: 226 VVSPDWIVDSVKEARLLPWQN---YSLTSKLDEQQKKLDNC 263

>Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON}
           complement(31451..34093) [2643 nt, 881 aa]
          Length = 880

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           YIN  T     R +L+++IV HGGK +H +  K        ++  KL  + + L    Y 
Sbjct: 101 YINGHTNP--DRLKLHELIVIHGGKFLHFLSAKGSA---THIVASKLPLK-KKLEYANYK 154

Query: 758 ILHPRWIMDCTAYNKLLP 775
           +++P WIM+     KLLP
Sbjct: 155 VVNPDWIMNSINAGKLLP 172

>Smik_10.152 Chr10 complement(254550..256841) [2292 bp, 763 aa] {ON}
           YJL090C (REAL)
          Length = 763

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 750 ALIDRGYDILHPRWIMDCTAYNKLLPIEPSY 780
           A +D+   I+H +WI+DC   N LLP +P Y
Sbjct: 188 AAVDQNLPIVHFKWILDCQRRNALLPYDPYY 218

>Skud_15.513 Chr15 (919666..922626) [2961 bp, 986 aa] {ON} YOR346W
           (REAL)
          Length = 986

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 9/101 (8%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           YIN  T  +  R +L+++IV HGGK +H +  K+       ++   L  + R      Y 
Sbjct: 172 YINGYT--KPGRLQLHEMIVLHGGKFLHYLSAKKTI---THIVASSLPLKKRIEF-ANYK 225

Query: 758 ILHPRWIMDCTAYNKLLPIEPSYCFSVSGKLRAVARRRVDC 798
           ++ P WI D     +L+P +    +S++ KL    ++  +C
Sbjct: 226 VVSPDWITDSIREGRLMPWK---IYSLTAKLDEQQKKLDNC 263

>TBLA0A04520 Chr1 complement(1116582..1119521) [2940 bp, 979 aa]
           {ON} Anc_7.46 YOR346W
          Length = 979

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 12/113 (10%)

Query: 663 KKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGK 722
           K  K+AL SD  ++    K    +F  L  YV + Y N        RS L+D++V HGG 
Sbjct: 82  KAAKQAL-SDSVRREAYGKDKPQIFNNLIIYV-NGYTNP------DRSTLHDMVVLHGGH 133

Query: 723 LIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLP 775
             H +  K        ++   L+ + R      Y ++ P+W++      KLLP
Sbjct: 134 FSHYLTAKSKV---THIVAENLSLKKRIEF-ASYKVVLPKWLVSSVQAGKLLP 182

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 16/105 (15%)

Query: 379 YMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRC--------------- 423
           Y++FD L +NG SL   P   R  +L          +  V    C               
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 424 YDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPE 468
           YD   +  +L+  +   S+G++    ++SYNV  +++N +K KP+
Sbjct: 204 YDLVKIASTLD-KLPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>Suva_6.164 Chr6 (286935..289214) [2280 bp, 759 aa] {ON} YJL090C
           (REAL)
          Length = 759

 Score = 35.8 bits (81), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 750 ALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSGKLR--AVARRRVDCF 799
           A I +   I+H +WI+DC   N LLP +P Y      +L   ++     DC+
Sbjct: 188 AAIAQNLPIIHFKWILDCQRRNALLPYDPYYLLPKLKELAYDSIGLNSCDCW 239

>ZYRO0D04664g Chr4 (387336..389789) [2454 bp, 817 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346W REV1
           Deoxycytidyl transferase forms a complex with the
           subunits of DNA polymerase zeta Rev3p and Rev7p involved
           in repair of abasic sites in damaged DNA
          Length = 817

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 8/85 (9%)

Query: 692 FYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDV-RLIGCKLTRECRA 750
           F  +S Y+N  T  +  R +L+++++ +GGK  H +  K    G V  +I   L  + R 
Sbjct: 77  FSGVSIYVNGFT--KPGRMQLHEMVIANGGKFAHFLSSK----GQVSHIIASNLPLKKRV 130

Query: 751 LIDRGYDILHPRWIMDCTAYNKLLP 775
            +   Y I  P WI+D     KLLP
Sbjct: 131 EL-ANYKICRPEWIVDSLQRGKLLP 154

>TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 20/107 (18%)

Query: 379 YMVFDLLYLNGTSLTPLPLYQRKEYLSS-----------------ILIPSKSVVEIVRYS 421
           Y++FD L +NG  +TP P   R  +L                   +  P K  ++ + +S
Sbjct: 144 YLMFDCLAINGRCITPSPTSSRLAHLGKEFFKPYYDLRSLFAEQCVTFPFKLSMKHMNFS 203

Query: 422 RCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPE 468
             YD   V  SL  ++   S+G++       Y+V S+++  +K KPE
Sbjct: 204 --YDLLKVANSLS-SLPHESDGLIFTPVKLPYSVGSKDSYLLKWKPE 247

>TDEL0H04050 Chr8 (693662..696229) [2568 bp, 855 aa] {ON} Anc_7.46
           YOR346W
          Length = 855

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 11/90 (12%)

Query: 686 VFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLT 745
           +FAG   Y     IN  T  +  R +L+++ V +GG  +H +  KR       ++   L 
Sbjct: 88  IFAGCTIY-----INGYT--KPGRLQLHEMFVSYGGNFLHYLSGKRKI---THIVATNLP 137

Query: 746 RECRALIDRGYDILHPRWIMDCTAYNKLLP 775
            + R L  R Y ++ P WI +     KLLP
Sbjct: 138 LKKR-LEFRNYKVVRPEWITESIDQEKLLP 166

>YJL090C Chr10 complement(262757..265051) [2295 bp, 764 aa] {ON}
           DPB11Replication initiation protein that loads DNA pol
           epsilon onto pre-replication complexes at origins;
           checkpoint sensor recruited to stalled replication forks
           by the checkpoint clamp complex where it activates
           Mec1p; ortholog of human TopBP1
          Length = 764

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 744 LTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSGKL--RAVARRRVDCF 799
           L     A I++   I+H +WI+DC   + LLP +P Y       L   ++     DC+
Sbjct: 183 LGARVNAAIEQNIPIVHFKWILDCQKRSALLPYDPYYLLPNIKDLPYDSIGSNSCDCW 240

>NCAS0A09420 Chr1 (1869312..1871666) [2355 bp, 784 aa] {ON}
           Anc_1.276 YJL090C
          Length = 784

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 750 ALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSGKL--RAVARRRVDCFG 800
           A  D+G  I+H +WI+DC     +L  +P Y      KL    + R   +C+ 
Sbjct: 182 AARDQGIPIVHQKWIVDCQIRGAMLQFDPYYLTDNVAKLSFEEIGRGACNCWA 234

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 18/118 (15%)

Query: 379 YMVFDLLYLNGTSLTPLPLYQRKEYLSS----------ILIPSKSV-----VEIVRYSRC 423
           Y++FD L +NG +LT  P   R  +L             + P + +     + + + +  
Sbjct: 143 YLMFDCLTMNGRNLTHSPTSSRLAHLGKEFYKPYFDMRSIFPDRCINFPFKISMKQMNFS 202

Query: 424 YDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLII 481
           YD  +V K+L+    L S+G++    ++ Y V ++++  +K KPE  EE   +  LI+
Sbjct: 203 YDLVNVYKTLDKLPHL-SDGLIFTPVNTPYVVGAKDSYLLKWKPE--EENSVDFKLIL 257

>SAKL0B10912g Chr2 (943757..946984) [3228 bp, 1075 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346W REV1
           Deoxycytidyl transferase forms a complex with the
           subunits of DNA polymerase zeta Rev3p and Rev7p involved
           in repair of abasic sites in damaged DNA
          Length = 1075

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           YIN  T  +  R +L+  IV HGGK +H +  KR       ++   LT + R   +    
Sbjct: 274 YINGYT--KPDRLQLHRKIVLHGGKFLHYMGSKRSV---THIVASNLTAKKRIEFENS-K 327

Query: 758 ILHPRWIMDCTAYNKLL 774
           ++ P WI++     KLL
Sbjct: 328 VVTPEWIINSIEAGKLL 344

>TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {ON}
           Anc_6.228 YGL130W
          Length = 453

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 22/120 (18%)

Query: 379 YMVFDLLYLNGTSLTPLPLYQRKEYLSSIL-----------------IPSKSVVEIVRYS 421
           Y++FD L +NG  L P P   R  +L                      P K  ++ + +S
Sbjct: 144 YLMFDCLAINGRCLVPSPTSSRLAHLGKEFFKPYYDLRTYYPDHCGTFPFKLSMKHMNFS 203

Query: 422 RCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLII 481
             YD   V+ +L+  +   S+G++     +SY V  +++  +K KPE  EE   +  LI+
Sbjct: 204 --YDLVKVENTLD-KLPHKSDGLIFTPVKTSYYVGGKDSYLLKWKPE--EENSVDFKLIL 258

>Smik_12.429 Chr12 (748638..754274) [5637 bp, 1878 aa] {ON} YLR342W
            (REAL)
          Length = 1878

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%)

Query: 675  QQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRH 732
            +Q+R +K +   +  L+F VL+ ++  + G  I  S+  D I K    ++HN+   +H
Sbjct: 1790 KQTRLRKRMVKKYCSLYFLVLAIFVGCIIGPAIASSQYKDQIGKKLTGVVHNLFQPKH 1847

>KLLA0F23375g Chr6 (2181986..2184475) [2490 bp, 829 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346W REV1
           Deoxycytidyl transferase forms a complex with the
           subunits of DNA polymerase zeta Rev3p and Rev7p involved
           in repair of abasic sites in damaged DNA
          Length = 829

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 10/111 (9%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           Y+N  T    TR +L+ +I+ HGG   H +  K        ++  +L    ++     + 
Sbjct: 72  YVNGRTNP--TRFQLHKLIILHGGTFKHYLSGKTAV---THILATELNASKKSSF-ANFK 125

Query: 758 ILHPRWIMDCTAYNKLLPIEPSYCFSVS---GKLRAVARRRVDCFGDSFEN 805
           ++ P W+ +  A  KLLP +      VS   GK+   A  R +C   +F N
Sbjct: 126 VVSPEWVTESIARGKLLPWQDFRIVQVSRLQGKITDFATVR-NCMDPNFIN 175

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 20/107 (18%)

Query: 379 YMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY--SRC------------- 423
           Y++FD L +NG SL   P   R  +L       K   ++  Y   RC             
Sbjct: 145 YLMFDCLAVNGRSLVQSPTSSRLAHLGKEFF--KPYYDLRSYFPDRCSTFPFKISMKHMN 202

Query: 424 --YDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPE 468
             YD   V K+L+ ++   S+G++     ++Y++  +++  +K KPE
Sbjct: 203 FSYDLAKVAKTLD-SLPHVSDGLIFTPVQAAYHIGGKDSYLLKWKPE 248

>Skud_7.402 Chr7 (679536..681341) [1806 bp, 601 aa] {ON}  (REAL)
          Length = 601

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 21/109 (19%)

Query: 675 QQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCI 734
           Q S+   P + +F+   FYV         G  +    L  +I+  GG +I    L R  I
Sbjct: 348 QPSKYDSPAASLFSNFSFYV---------GREVPIDILEFLILSCGGNIISEAALDR--I 396

Query: 735 GDVRLIGCKLTRECRALIDR--------GYDILHPRWIMDCTAYNKLLP 775
            + + I   +++    ++DR        G   + P+WI DC    +L+P
Sbjct: 397 ENKKDID--MSKITHQIVDRPALKNKVAGRTYIQPQWIFDCINKGELVP 443

>NCAS0G01610 Chr7 complement(285839..288361) [2523 bp, 840 aa] {ON}
           Anc_2.48 YNL201C
          Length = 840

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 10/99 (10%)

Query: 648 NPSHQVENLQLQLVPKKRKRALVSDPFQQSREQKPI--SGVFAGLF---FYVLSDY---I 699
           +P +Q++  QL+L  +K    L+    Q SR  +P+  S  F  L     ++  DY   I
Sbjct: 363 DPPNQLDQSQLEL--RKNGIKLIHQCIQVSRNLEPLDKSKFFKTLVRKGLFIALDYAFNI 420

Query: 700 NSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVR 738
            + + +RI  +++   I++H   LIHNV ++     DV 
Sbjct: 421 EADSNIRILATDMIITIIEHDILLIHNVQIENKIKPDVE 459

>TBLA0C01420 Chr3 (324857..327610) [2754 bp, 917 aa] {ON} Anc_2.618
           YKL073W
          Length = 917

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 314 GVNL---LSGTISQYLKFSDSVKECVLD-GEMVTFDAMRKVILPFGLVKGSAKEALSFND 369
           GVN    L+ TI +Y  F  + ++ +LD GEM T D++  V++  G+       AL+F  
Sbjct: 165 GVNTIDKLAITIPEY--FKQTKRQALLDIGEMTT-DSLDTVVINDGM-----SIALNFAL 216

Query: 370 INNNDFHPLYMVFDLLYLNGTSLT 393
            N NDF P  + + ++Y  G+S T
Sbjct: 217 KNQNDFTPGEIYYYIIYDMGSSST 240

>TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.46
           YOR346W
          Length = 923

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 698 YINSVTGVRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYD 757
           YIN  T     R  L+ +IV HGGK +H++  K        ++   L  + R    + Y 
Sbjct: 132 YINGYTDP--DRLVLHKLIVIHGGKFLHHMTSKGRV---THIVATNLPLKKRVEFAK-YK 185

Query: 758 ILHPRWIMDCTAYNKLLP 775
           ++ P WI+D      L P
Sbjct: 186 VITPEWILDSVKAEVLQP 203

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,726,167
Number of extensions: 4729257
Number of successful extensions: 13738
Number of sequences better than 10.0: 89
Number of HSP's gapped: 13868
Number of HSP's successfully gapped: 89
Length of query: 948
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 829
Effective length of database: 39,836,145
Effective search space: 33024164205
Effective search space used: 33024164205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)