Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1796.15ON25925911791e-165
Skud_15.1656.15ON25725910151e-140
Smik_15.1736.15ON25121910011e-138
YOR004W (UTP23)6.15ON2542209981e-137
NCAS0D026606.15ON2612147951e-106
NDAI0I022506.15ON2712257871e-105
KAFR0A050606.15ON2692187851e-105
KLLA0D01023g6.15ON2682177641e-102
KNAG0F028806.15ON2692267571e-100
Kpol_1045.746.15ON2572227541e-100
CAGL0E02673g6.15ON2632227403e-98
ZYRO0C07920g6.15ON2932167424e-98
TDEL0G045406.15ON2452117375e-98
SAKL0E01056g6.15ON2692157335e-97
KLTH0C11352g6.15ON2682227274e-96
ACR011C6.15ON2532147003e-92
Kwal_56.223996.15ON2742206981e-91
TPHA0J002806.15ON2712176928e-91
Ecym_30196.15ON2662286901e-90
TBLA0A072906.15ON2592205981e-76
KLTH0E02860g5.392ON1891451391e-09
Kwal_55.200895.392ON1891451372e-09
AEL102W5.392ON1891411354e-09
Kpol_1055.185.392ON1891411354e-09
CAGL0M01056g5.392ON1891451354e-09
ZYRO0A06754g5.392ON1891481346e-09
KNAG0C052705.392ON1891411338e-09
KAFR0D042805.392ON1891451338e-09
KLLA0A07018g5.392ON1891451321e-08
NDAI0C045505.392ON1891451321e-08
SAKL0G07766g5.392ON1891411311e-08
TBLA0H017505.392ON1891451311e-08
TDEL0E023305.392ON1891481302e-08
Ecym_74695.392ON1891451293e-08
TPHA0D023105.392ON1891411293e-08
NCAS0F030905.392ON1891451284e-08
Suva_2.5095.392ON1891411259e-08
Skud_4.6065.392ON1891411259e-08
Smik_4.5995.392ON1891411259e-08
YDR339C (FCF1)5.392ON1891411259e-08
Kwal_56.22400singletonOFF51501072e-06
ADL145C5.94ON875124840.049
KLLA0B01826g5.577ON80372800.15
Smik_11.3585.702ON1878108800.16
CAGL0H06985g8.872ON878155740.83
KNAG0B066704.341aON124456731.1
TPHA0K002705.577ON613108721.4
Ecym_36121.527ON131553721.5
Kpol_1050.805.75ON150576721.5
KNAG0I025806.320ON40969711.7
Skud_14.3546.321ON139142681.9
ZYRO0B06314g3.100ON73450711.9
Kpol_2001.621.132ON37470702.2
AAL007C1.397ON485104693.1
Ecym_51574.365ON74073693.3
KNAG0C060104.128ON118433693.5
ZYRO0D14014g5.587ON155963693.6
TDEL0D010904.309ON64299684.3
NCAS0A113803.408ON105188684.6
Skud_13.4408.823ON19480664.8
KNAG0E020302.381ON6821615.7
ZYRO0F03740g8.64ON68367675.8
KAFR0B045802.162ON72958675.8
Suva_4.4736.111ON62674667.5
KLTH0B05280g2.148ON98643668.0
NCAS0C049001.397ON47554659.5
TPHA0I020008.527ON478101659.5
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Suva_15.179
         (780 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   458   e-165
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   395   e-140
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   390   e-138
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   389   e-137
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   310   e-106
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   307   e-105
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   306   e-105
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   298   e-102
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   296   e-100
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   295   e-100
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   289   3e-98
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   290   4e-98
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   288   5e-98
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   286   5e-97
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   284   4e-96
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   274   3e-92
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   273   1e-91
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   271   8e-91
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   270   1e-90
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   234   1e-76
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    58   1e-09
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    57   2e-09
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    57   4e-09
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    57   4e-09
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    57   4e-09
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    56   6e-09
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    56   8e-09
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    56   8e-09
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    55   1e-08
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    55   1e-08
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    55   1e-08
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    55   1e-08
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    55   2e-08
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    54   3e-08
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    54   3e-08
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    54   4e-08
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    53   9e-08
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    53   9e-08
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    53   9e-08
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    53   9e-08
Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OF...    46   2e-06
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    37   0.049
KLLA0B01826g Chr2 complement(155830..156444,156659..158455) [241...    35   0.15 
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    35   0.16 
CAGL0H06985g Chr8 (691854..694490) [2637 bp, 878 aa] {ON} simila...    33   0.83 
KNAG0B06670 Chr2 (1314289..1318023) [3735 bp, 1244 aa] {ON}            33   1.1  
TPHA0K00270 Chr11 (45204..47045) [1842 bp, 613 aa] {ON} Anc_5.57...    32   1.4  
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...    32   1.5  
Kpol_1050.80 s1050 complement(173056..177573) [4518 bp, 1505 aa]...    32   1.5  
KNAG0I02580 Chr9 complement(498227..499456) [1230 bp, 409 aa] {O...    32   1.7  
Skud_14.354 Chr14 complement(637861..638280) [420 bp, 139 aa] {O...    31   1.9  
ZYRO0B06314g Chr2 complement(507523..509727) [2205 bp, 734 aa] {...    32   1.9  
Kpol_2001.62 s2001 complement(170253..171377) [1125 bp, 374 aa] ...    32   2.2  
AAL007C Chr1 complement(328643..330100) [1458 bp, 485 aa] {ON} S...    31   3.1  
Ecym_5157 Chr5 complement(332619..334841) [2223 bp, 740 aa] {ON}...    31   3.3  
KNAG0C06010 Chr3 (1169041..1172595) [3555 bp, 1184 aa] {ON} Anc_...    31   3.5  
ZYRO0D14014g Chr4 (1181160..1185839) [4680 bp, 1559 aa] {ON} som...    31   3.6  
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    31   4.3  
NCAS0A11380 Chr1 (2255650..2258805) [3156 bp, 1051 aa] {ON} Anc_...    31   4.6  
Skud_13.440 Chr13 (778331..778915) [585 bp, 194 aa] {ON} YMR269W...    30   4.8  
KNAG0E02030 Chr5 complement(418026..418232) [207 bp, 68 aa] {ON}...    28   5.7  
ZYRO0F03740g Chr6 complement(311378..313429) [2052 bp, 683 aa] {...    30   5.8  
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    30   5.8  
Suva_4.473 Chr4 (823595..823607,823691..825558) [1881 bp, 626 aa...    30   7.5  
KLTH0B05280g Chr2 (435558..438518) [2961 bp, 986 aa] {ON} simila...    30   8.0  
NCAS0C04900 Chr3 complement(999764..1001191) [1428 bp, 475 aa] {...    30   9.5  
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    30   9.5  

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  458 bits (1179), Expect = e-165
 Identities = 236/259 (91%), Positives = 236/259 (91%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 541 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVXXXXXXXXXXXXXXXXXXXX 720
           AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV                    
Sbjct: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSN 240

Query: 721 XXXSIASGTSVAQGQASSD 777
              SIASGTSVAQGQASSD
Sbjct: 241 ADDSIASGTSVAQGQASSD 259

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  395 bits (1015), Expect = e-140
 Identities = 205/259 (79%), Positives = 217/259 (83%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVV+VNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           SQDI LRRKLRTVPGVPLIHLTRSVMIMEPLSTASAK S+ TEEQKL+KGLNDPN+EK E
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 541 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVXXXXXXXXXXXXXXXXXXXX 720
            +S  S KES PKKRK GPKAPNPLS+KKKK + PS++                      
Sbjct: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNE--TKGEDDAFKEKKRRRKHKSS 238

Query: 721 XXXSIASGTSVAQGQASSD 777
              S  +GT+V Q Q SSD
Sbjct: 239 TNKSAINGTTVLQVQPSSD 257

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  390 bits (1001), Expect = e-138
 Identities = 192/219 (87%), Positives = 206/219 (94%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+GSNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPA+CIESVV++NGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           SQDI LRRKLR VPGVPLIHLTRSVM+MEPLSTASAKAS+MTEE+KLYKGLNDPN++K +
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 541 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDE 657
            IS+GS KES  KKRK GPKAPNPLS+KKKKK   + DE
Sbjct: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDE 219

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  389 bits (998), Expect = e-137
 Identities = 193/220 (87%), Positives = 204/220 (92%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+ SNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPAECIESVVN++GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           SQDIDLRRKLRTVPGVPLIHLTRSVM+MEPLSTASAKAS++TEEQKLYKGLNDPNIEK +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 541 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV 660
               GS KES  KKRK GPKAPNPLS+KKKKK     DEV
Sbjct: 181 ESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEV 220

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  310 bits (795), Expect = e-106
 Identities = 150/214 (70%), Positives = 180/214 (84%), Gaps = 2/214 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V++CS SN+DL  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P ECIESVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIE--K 534
           +QD+ +RRKLR VPGVPL+H++R+VMIMEPLS ASAK S+  E +KLYKGLNDP     K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 535 AEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKK 636
             A     + +  PKK K GPK+PNPLSMKKKK+
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQ 214

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  307 bits (787), Expect = e-105
 Identities = 157/225 (69%), Positives = 182/225 (80%), Gaps = 6/225 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+V +CS SN+DL  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  ECIESVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           SQD+  RRKLR VPGVPLIH++R+VMIMEPLS  SA+ SR  E +KLYKGLNDP     +
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 541 -AISKGS--EKEST---PKKRKAGPKAPNPLSMKKKKKTGPSDDE 657
            A+ K +  EKEST    KKRK GPK PNPLSMKKKK    S +E
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNE 225

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  306 bits (785), Expect = e-105
 Identities = 155/218 (71%), Positives = 178/218 (81%), Gaps = 5/218 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V+  S SNFDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P EC+ SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP-----N 525
           SQDID+RR+LR VPGVPL+H++RSVMIMEPLS  SAK S   E++KLYKGLNDP      
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 526 IEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKT 639
           +++ EA       E T KK K GPK PNPLS++KK KT
Sbjct: 181 LDEEEATETQGSGEKTAKK-KRGPKGPNPLSVRKKVKT 217

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  298 bits (764), Expect = e-102
 Identities = 150/217 (69%), Positives = 178/217 (82%), Gaps = 4/217 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLV E   S+FD   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 531
           +QD+++RR+LR +PGVPL+++ RSVM+MEPLS AS K SR  EEQKLYKGLNDP    I 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 532 KAEAISKGSE-KESTPKKRKAGPKAPNPLSMKKKKKT 639
           + E    G+E +E+ PKKRK GPK PNPLSMKKKK T
Sbjct: 181 RDENDEAGAENQENKPKKRK-GPKEPNPLSMKKKKTT 216

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  296 bits (757), Expect = e-100
 Identities = 148/226 (65%), Positives = 180/226 (79%), Gaps = 7/226 (3%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTF+FREPYQV++D+++V + + S FDL   L+RT+QA+VK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALY T N  AID+AK++ERRRCNH  KDPKSP ECIESVV++ G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPN----- 525
            Q+IDLRRKLR VPGVPLIH++R+VMIMEPLS ASA+ S+  E+QKL+ GLND       
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 526 -IEKAEAISKGSE-KESTPKKRKAGPKAPNPLSMKKKKKTGPSDDE 657
             E  +   KG E  E+ PKKRK GPK PNPLSMKKKKK G S+ +
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKDGNSEQK 226

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  295 bits (754), Expect = e-100
 Identities = 148/222 (66%), Positives = 180/222 (81%), Gaps = 2/222 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S FD+  GLKRTLQA+VKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+V++ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKA- 537
           SQD+D+RRKLR +PGVP++H++R+VMI+EPLS AS K S   E+ KLYKGLND       
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 538 -EAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV 660
            E  S+ SEK S  KK K GPK PNPLSM KK+K+ P+ +EV
Sbjct: 181 DEPKSEKSEKTSESKKNK-GPKQPNPLSM-KKRKSKPASNEV 220

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  289 bits (740), Expect = 3e-98
 Identities = 148/222 (66%), Positives = 173/222 (77%), Gaps = 3/222 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V + + S +DL   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP ECI +VV+V G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIE--K 534
            QD+++RR LR VPGVPL+H++RSVMIMEPLS ASAK SRM EE KL++GLNDP     K
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 535 AEAISKGSEKEST-PKKRKAGPKAPNPLSMKKKKKTGPSDDE 657
            E   +   KE T  KKRK GPK PNPLSMKKKKK     ++
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQ 222

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  290 bits (742), Expect = 4e-98
 Identities = 141/216 (65%), Positives = 177/216 (81%), Gaps = 4/216 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLVS+C  S++DL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P ECI+SVVNVNG+NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 531
           SQD+ LRRKLR VPGVPLIH++RSVM+MEPLS AS++ + M+E +KL KGLNDP    ++
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 532 KAEAISKGSEKES-TPKKRKAGPKAPNPLSMKKKKK 636
              ++    E ES  P K++ GPK PNPLS++KK+K
Sbjct: 181 TTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQK 216

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  288 bits (737), Expect = 5e-98
 Identities = 144/211 (68%), Positives = 166/211 (78%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+V +C GSNFDL  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P EC+ES+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           SQDID RR LR  PGVPL+H  RSVM+MEPLS ASAK S   E +KL+KGLNDP      
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPR----- 175

Query: 541 AISKGSEKESTPKKRKAGPKAPNPLSMKKKK 633
             + G + E+     K   K PNPLS+KK+K
Sbjct: 176 --NAGIKTENPQTSIKKRTKQPNPLSVKKRK 204

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  286 bits (733), Expect = 5e-97
 Identities = 142/215 (66%), Positives = 175/215 (81%), Gaps = 4/215 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V     S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  ECIESVVN NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 531
           +QDID+RRKLR VPGVPLI++ RSVM+MEPLS AS + S++ EE+KL+KGLNDP    + 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 532 KAEAIS-KGSEKESTPKKRKAGPKAPNPLSMKKKK 633
             E++    S K+  P K+K GPK PNPLS+K+K+
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKR 215

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  284 bits (727), Expect = 4e-96
 Identities = 141/222 (63%), Positives = 173/222 (77%), Gaps = 3/222 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   ++FDL  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P EC++SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           SQD  +R+KLR VPGVPLI++ RSVM+MEPLS AS   SR  E++KL+KGLNDP      
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 541 AISKGSEKES---TPKKRKAGPKAPNPLSMKKKKKTGPSDDE 657
           A  +G + ++     K ++ GPK PNPLS+KKKK    S DE
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDE 222

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  274 bits (700), Expect = 3e-92
 Identities = 135/214 (63%), Positives = 169/214 (78%), Gaps = 3/214 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+V E + S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P EC++SVV VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 531
           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + SR  E+QKL+KGLNDP    I 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 532 KAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKK 633
           +  A +     E  P  ++ GPKAPNPLSMKK+K
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRK 213

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  273 bits (698), Expect = 1e-91
 Identities = 137/220 (62%), Positives = 165/220 (75%), Gaps = 9/220 (4%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   + FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P EC++SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNI---- 528
           +Q+ ++R  LR VPGVPL+ + RSVM+MEPLS AS   SR+ E +KL+KGLNDP      
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 529 -----EKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKK 633
                  A A +   E    P K++ GPK PNPLS+KKKK
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKK 220

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  271 bits (692), Expect = 8e-91
 Identities = 134/217 (61%), Positives = 170/217 (78%), Gaps = 5/217 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQAD-VKV 177
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN++L   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 178 MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVV 357
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+VN++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 358 ASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKA 537
           A+Q+++LRRKLR VPGVP++HL+RSVMIMEP+S +S + +R  E+ KLYKGLNDP    A
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 538 EAISKGS-EKEST---PKKRKAGPKAPNPLSMKKKKK 636
               +G+ + E T     K++ G K PNPLS KKK K
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVK 217

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  270 bits (690), Expect = 1e-90
 Identities = 140/228 (61%), Positives = 173/228 (75%), Gaps = 10/228 (4%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 180
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLV E + S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 360
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P+ECI SVV++NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 361 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP------ 522
           +QDI++RR LR VPGVPLI++ RSVM+MEPLS+ S + S+  E +KL KGLNDP      
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 523 -NIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKK---KKKTGPSDD 654
            N E A    K  +     +K K GPK PNPLS+KK    K   PS+D
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIK-GPKEPNPLSIKKPRVNKAQLPSED 226

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  234 bits (598), Expect = 1e-76
 Identities = 118/220 (53%), Positives = 157/220 (71%), Gaps = 2/220 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQAD--VK 174
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + ++L  GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 175 VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYV 354
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP+EC+ S+V+VNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 355 VASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEK 534
           VA+QD++LRRKLR +PGVPLIH  RSVM+MEPLS AS + +   E +KL  GLN      
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLN-----S 175

Query: 535 AEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDD 654
            +A  +G ++    KK+    K  NPLSMKKK  +  + +
Sbjct: 176 TKASVEGGQENGIKKKK---VKGVNPLSMKKKSNSNSNSN 212

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 58.2 bits (139), Expect = 1e-09
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       D+  G+  TL A    MIT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       DL  G+  TL A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 56.6 bits (135), Expect = 4e-09
 Identities = 40/141 (28%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R N S K   +  +C+     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD-DCL-----VNRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 56.6 bits (135), Expect = 4e-09
 Identities = 39/141 (27%), Positives = 71/141 (50%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R + S K   +  +CI     VN   +H+ Y+VA+ D+ L++++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-DCI-----VNRVLQHKCYIVATNDVGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 56.6 bits (135), Expect = 4e-09
 Identities = 40/145 (27%), Positives = 72/145 (49%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 56.2 bits (134), Expect = 6e-09
 Identities = 40/148 (27%), Positives = 73/148 (49%), Gaps = 7/148 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    R PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD-----DCL-----VNRVMQHKCYIVATNDAPL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 462
           ++++R +PG+PL+ +     ++E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 55.8 bits (133), Expect = 8e-09
 Identities = 38/141 (26%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VNRVLQHKCYIVATNDAGLKQRV 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 55.8 bits (133), Expect = 8e-09
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 55.5 bits (132), Expect = 1e-08
 Identities = 39/145 (26%), Positives = 74/145 (51%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       D+  G+   L A   ++IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +CI     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VHRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRVRKVPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 55.5 bits (132), Expect = 1e-08
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 55.1 bits (131), Expect = 1e-08
 Identities = 39/141 (27%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R N S K   +  +C+     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD-DCL-----VNRVLQHKCYIVATNDAALKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 55.1 bits (131), Expect = 1e-08
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVVEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08
 Identities = 41/148 (27%), Positives = 72/148 (48%), Gaps = 7/148 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 462
           ++++R +PG+PL+ +      +E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYAIEKLPDA 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLLSVGGHSYVIEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L +      R PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R + S K   +  +CI     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-DCI-----VNRVLQHKCYIVATNDQGLKQRV 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 53.9 bits (128), Expect = 4e-08
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 378
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ ++VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCFIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 52.8 bits (125), Expect = 9e-08
 Identities = 36/141 (25%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 52.8 bits (125), Expect = 9e-08
 Identities = 36/141 (25%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 52.8 bits (125), Expect = 9e-08
 Identities = 36/141 (25%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 52.8 bits (125), Expect = 9e-08
 Identities = 36/141 (25%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OFF}
           [contig 185] FULL
          Length = 51

 Score = 45.8 bits (107), Expect = 2e-06
 Identities = 26/50 (52%), Positives = 29/50 (58%)
 Frame = -2

Query: 203 ACMQHCVIITFTSACKVLFSPLGRSKFEPLHSETS*LSTRT*YGSRNLNV 54
           A MQHCVI+  TSAC+V   P  RS      S T   STRT YGS NL +
Sbjct: 2   AWMQHCVIMGLTSACRVRLRPFTRSNAALCVSHTIWSSTRTWYGSLNLKL 51

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 37.0 bits (84), Expect = 0.049
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 4/124 (3%)
 Frame = +1

Query: 292 SPAECIE-SVVNVNGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASA 468
           SP + +   +V  N       VV++ DIDL+    +     ++H    VM  + L+   +
Sbjct: 451 SPRKAVSPDIVMHNSQTDVALVVSTTDIDLKDNNESTNDTSVVHEPGKVMNSDDLTAVHS 510

Query: 469 KASRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKA---PNPLSMKKKKKT 639
             +R  +  +++  L+       EA+SKG +K   PKK  A   A    N +S   K   
Sbjct: 511 TKTRQEDANEMFSALD-------EAVSKG-KKSCLPKKHIAASVAASTSNEISASAKSNK 562

Query: 640 GPSD 651
             SD
Sbjct: 563 DSSD 566

>KLLA0B01826g Chr2 complement(155830..156444,156659..158455) [2412
           bp, 803 aa] {ON} similar to uniprot|Q03707 Saccharomyces
           cerevisiae YML034W SRC1
          Length = 803

 Score = 35.4 bits (80), Expect = 0.15
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = +1

Query: 442 MEPLSTASAKASRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSM 621
           + PL   S K ++   E K  K     ++EK+   +K  +K ST K+         P+S 
Sbjct: 74  LSPLVIPSVKVTKKKRESKKRKSTTPESLEKSLTKAKAIKK-STIKEENEAKDGERPVSK 132

Query: 622 KKKKKTGPSDDE 657
           K+KK+T   D +
Sbjct: 133 KRKKRTKDEDGQ 144

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 35.4 bits (80), Expect = 0.16
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 7/108 (6%)
 Frame = +1

Query: 358  ASQDIDLRRKLRTVPGVPLIHLTRSVMIM--EPLSTASAKASRMTEEQKL----YKGLND 519
            +SQ +D +R+L T    P  HLT S  I     L ++S+  S  T +++L        +D
Sbjct: 1730 SSQKVDDQRELTTNKADPPTHLTPSFNIPAGRGLISSSSTLSTDTNDEELTGNEQNNSSD 1789

Query: 520  PNIEKAEAISKGSEKESTPKKRKA-GPKAPNPLSMKKKKKTGPSDDEV 660
             N +    I K  EKE   KK++  G    +   + + ++    DDEV
Sbjct: 1790 GNTQLEAGIEKAEEKEFAEKKKEVEGETTSHKRPIDEVRELKDDDDEV 1837

>CAGL0H06985g Chr8 (691854..694490) [2637 bp, 878 aa] {ON} similar
           to uniprot|Q04500 Saccharomyces cerevisiae YML093w YMJ3
          Length = 878

 Score = 33.1 bits (74), Expect = 0.83
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 1/155 (0%)
 Frame = +1

Query: 199 QALYETRNEGAIDLAKQFERRRCNHSFK-DPKSPAECIESVVNVNGANKHRYVVASQDID 375
           +A  +  N+  I+  ++FE+   +  F+ D + P   IE    V   NK R   A  D++
Sbjct: 522 EAREKAENKQFIEKLREFEKTGDDDLFESDDEKPV--IEGKDTVTSINKGRRTYAPGDLE 579

Query: 376 LRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAEAISKG 555
           +R +                  M+ +     K   + E + L   L   N    E I   
Sbjct: 580 MRHE------------------MKKIKEEVRKEKEIDESRTLVNRLKRRNENNEEEIIDV 621

Query: 556 SEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV 660
            E+   PK+ K  PK+            G  D++V
Sbjct: 622 VEEVVPPKEEKTAPKSKTKSESSNPWLDGSDDEDV 656

>KNAG0B06670 Chr2 (1314289..1318023) [3735 bp, 1244 aa] {ON} 
          Length = 1244

 Score = 32.7 bits (73), Expect = 1.1
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = +1

Query: 484 TEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSD 651
           TE++K  K   D +    E  SK  +  S+ +K+K   K  +P S +KKKK+   D
Sbjct: 91  TEKKK--KSKKDDSFSSTEKKSKKDDSPSSTEKKKKSKKDDSPSSTEKKKKSKKDD 144

 Score = 30.0 bits (66), Expect = 8.1
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +1

Query: 463 SAKASRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKT 639
           S K    +  +K  K  + P+  + +  SK  +  S+ +K+K   K  +P S +KKKK+
Sbjct: 97  SKKDDSFSSTEKKSKKDDSPSSTEKKKKSKKDDSPSSTEKKKKSKKDDSPSSTEKKKKS 155

>TPHA0K00270 Chr11 (45204..47045) [1842 bp, 613 aa] {ON} Anc_5.577
           YML034W
          Length = 613

 Score = 32.3 bits (72), Expect = 1.4
 Identities = 26/108 (24%), Positives = 47/108 (43%)
 Frame = +1

Query: 310 ESVVNVNGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTE 489
           E V  V   +  + +V S+  + + K R    + L  L +S ++ E  +  ++       
Sbjct: 130 EEVPKVEQRSNTKAIVESKLSETKPKTRRNIPLDLQKLQQSAIVKENKTEKTSDEKLDIT 189

Query: 490 EQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKK 633
           +++  K   +PN EK E I++  +KE   K      K  +P   KK K
Sbjct: 190 KKEQPKTKTNPNDEKEETINESLDKEEENKSLVEEQKNKSPKEYKKTK 237

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score = 32.3 bits (72), Expect = 1.5
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
 Frame = +2

Query: 11   RELSHIESNFLSTVTRLNFVSHIKF-WLIISWFQSVVVQISTYR--VG*RGLY 160
            R+L ++ S FLS VT L FVS I   W  +S ++  +V IST    +G  G+Y
Sbjct: 860  RDLRYLVSGFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIY 912

>Kpol_1050.80 s1050 complement(173056..177573) [4518 bp, 1505 aa] {ON}
            complement(173056..177573) [4518 nt, 1506 aa]
          Length = 1505

 Score = 32.3 bits (72), Expect = 1.5
 Identities = 23/76 (30%), Positives = 34/76 (44%)
 Frame = +2

Query: 125  ISTYRVG*RGLYKPM*KL*SHNVAYRRYMKLETKAQLIWQNNLKDVVVITLLRIQNHQQS 304
            IST  +G   LY+   +L        RY KLE      +Q   KD ++I+L+R  N    
Sbjct: 1340 ISTKNIGVMSLYRGQIRLLKRKFEKERYSKLEILTADQFQGRDKDCIIISLVRRNNELNG 1399

Query: 305  VSKVS*TLTARINIGM 352
             S +      R+N+ M
Sbjct: 1400 GSLLK--ELRRVNVAM 1413

>KNAG0I02580 Chr9 complement(498227..499456) [1230 bp, 409 aa] {ON}
           Anc_6.320 YNR021W
          Length = 409

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 20/69 (28%), Positives = 32/69 (46%)
 Frame = +1

Query: 430 SVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPN 609
           S + + P      KA+R  E  K+ K       EKA    K +EKE   + +K+G    +
Sbjct: 329 STVFITPDMLKKTKATRQQELSKIVKNAKKIAAEKALEDKKEAEKEKRRELKKSGNLEKS 388

Query: 610 PLSMKKKKK 636
              MK+K++
Sbjct: 389 DQKMKEKRE 397

>Skud_14.354 Chr14 complement(637861..638280) [420 bp, 139 aa] {ON}
           YNR022C (REAL)
          Length = 139

 Score = 30.8 bits (68), Expect = 1.9
 Identities = 32/142 (22%), Positives = 55/142 (38%), Gaps = 5/142 (3%)
 Frame = +1

Query: 184 TQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVAS 363
           TQ C+ AL +  +   I + K F R +          P+     + N NGA   +Y++  
Sbjct: 5   TQVCLSALTKRTHRVKIQVLKDFPRFQLFKGQVTKAKPSLMRNYLHNFNGA---KYILDE 61

Query: 364 Q-DIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 540
           + D+D                      ME L +  A+  ++ E+++L     +   +K  
Sbjct: 62  ERDVD----------------------MELLRSYQARELKLAEDRQLLSKYQEMEAQKRI 99

Query: 541 AISK----GSEKESTPKKRKAG 594
              K    G EK+  PK+ K G
Sbjct: 100 KSQKQSVFGDEKQDNPKEEKKG 121

>ZYRO0B06314g Chr2 complement(507523..509727) [2205 bp, 734 aa] {ON}
           similar to uniprot|Q03388 Saccharomyces cerevisiae
           YDR485C VPS72 Protein of unknown function component of
           the Swr1p complex that incorporates Htz1p into chromatin
           required for vacuolar protein sorting
          Length = 734

 Score = 32.0 bits (71), Expect = 1.9
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +1

Query: 511 LNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV 660
           LN+ N E A    +GS+ +STP+   +     +  +M+++KKT  + DE+
Sbjct: 411 LNESNSENASGEQRGSDTQSTPEDGSSLKLEEDIQAMREEKKTELTADEI 460

>Kpol_2001.62 s2001 complement(170253..171377) [1125 bp, 374 aa]
           {ON} complement(170253..171377) [1125 nt, 375 aa]
          Length = 374

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +1

Query: 442 MEPLSTASAKASRMTEEQK----LYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPN 609
           ++P+   S K  ++T + K    ++  +   NIEK E  +K SE + + +K K   KA  
Sbjct: 236 VKPIDLNSLKIKQLTNKNKVITSIFTDVEIINIEKNEESTKRSEGKKSKRKMKI--KAAG 293

Query: 610 PLSMKKKKKT 639
              +KK+K+T
Sbjct: 294 ETRLKKQKQT 303

>AAL007C Chr1 complement(328643..330100) [1458 bp, 485 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR175W
           (CBF5)
          Length = 485

 Score = 31.2 bits (69), Expect = 3.1
 Identities = 28/104 (26%), Positives = 38/104 (36%), Gaps = 4/104 (3%)
 Frame = +1

Query: 340 KHRYVVASQDIDLRRKLRTVPGVPLIHLTRS----VMIMEPLSTASAKASRMTEEQKLYK 507
           K  YV      D   ++  V   PLI           +  P         +  +++K  K
Sbjct: 382 KKTYVSHEPSADAAAEVAPVKSEPLIEEVSKKDAKTEVEVPAEKKQDDEEKKEKKEKKEK 441

Query: 508 GLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKT 639
                  EK E   K  +KE   KKRKA  +  N    KKKKK+
Sbjct: 442 SEKKEKKEKKEKSEKSEKKEKKEKKRKADDE--NASEEKKKKKS 483

>Ecym_5157 Chr5 complement(332619..334841) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ABL072C
          Length = 740

 Score = 31.2 bits (69), Expect = 3.3
 Identities = 19/73 (26%), Positives = 36/73 (49%)
 Frame = +1

Query: 442 MEPLSTASAKASRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSM 621
           ++ L++ S   +  +E  ++ +G   P++     I + S    T K  K GP  PN L+ 
Sbjct: 632 LDTLNSKSTSTTVNSESPEIIRG--KPSVITDLDIVERSTSHETSKVFKRGPSEPNDLAK 689

Query: 622 KKKKKTGPSDDEV 660
           ++ K+  P D+ V
Sbjct: 690 QEAKRPKPMDELV 702

>KNAG0C06010 Chr3 (1169041..1172595) [3555 bp, 1184 aa] {ON}
           Anc_4.128 YAL001C
          Length = 1184

 Score = 31.2 bits (69), Expect = 3.5
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%)
 Frame = +1

Query: 562 KESTPKKRKAG--PKAPNPLSMKKKKKTGPSDD 654
           K   PKKR AG  P+A +P + KKK +  PS D
Sbjct: 478 KRKHPKKRAAGVEPRAASPQAKKKKSQESPSAD 510

>ZYRO0D14014g Chr4 (1181160..1185839) [4680 bp, 1559 aa] {ON} some
            similarities with uniprot|P38904 Saccharomyces cerevisiae
            YDR464W SPP41 appears to control expression of
            spliceosome components PRP4 and PRP3 negative regulator
            of prp genes
          Length = 1559

 Score = 31.2 bits (69), Expect = 3.6
 Identities = 21/63 (33%), Positives = 31/63 (49%)
 Frame = +1

Query: 76   YQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYETRNEGAIDLAKQFE 255
            ++ +V  QLV  C G+N DLPS L   + A +  +        L +TR     +L  + E
Sbjct: 1209 FEDMVKQQLVQSC-GNNVDLPSNLSNIISATLANVFPD-----LNDTRKNEIQELPSRPE 1262

Query: 256  RRR 264
            RRR
Sbjct: 1263 RRR 1265

>TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {ON}
           Anc_4.309 YLR429W
          Length = 642

 Score = 30.8 bits (68), Expect = 4.3
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 9/99 (9%)
 Frame = +1

Query: 391 RTVPGVPLIHLTRSVMIMEPLSTASAKASR------MTEEQKLYKGLNDP---NIEKAEA 543
           ++V G  L+ +       EP    S K ++      + EE+K  + +  P   ++EK + 
Sbjct: 390 KSVDGPILVDMKNIYEGSEPTFKESKKENKPVSSTPLKEEKKAQEQIEKPVERSVEKPDE 449

Query: 544 ISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV 660
            S  +EKE+T ++R     +  P S+    K+  S D++
Sbjct: 450 KSTVTEKEATNEQRNVSTASQKPSSINTSLKSDDSVDKL 488

>NCAS0A11380 Chr1 (2255650..2258805) [3156 bp, 1051 aa] {ON} Anc_3.408
            YPR097W
          Length = 1051

 Score = 30.8 bits (68), Expect = 4.6
 Identities = 24/88 (27%), Positives = 39/88 (44%)
 Frame = +1

Query: 325  VNGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLY 504
            +N   + +Y    Q ID    L+   GV       + ++ + L T   K     E +KLY
Sbjct: 897  INFLQRSKYGSDEQRIDFNELLKKTDGVD------NKLLQDQLDTFIRKK---LEARKLY 947

Query: 505  KGLNDPNIEKAEAISKGSEKESTPKKRK 588
            K L D  ++  + ISK +  ++  KK K
Sbjct: 948  KKLVDAKVKHEDEISKKNTSKTMAKKWK 975

>Skud_13.440 Chr13 (778331..778915) [585 bp, 194 aa] {ON} YMR269W
           (REAL)
          Length = 194

 Score = 30.0 bits (66), Expect = 4.8
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 415 IHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAEA---ISKGSEKESTPKKR 585
           I  T++V++   +S +S+   R   + +  KG  D   EK E+   IS GS ++S  K+R
Sbjct: 73  IKFTQNVVVASAVSKSSSPLYRWFVKGEGLKGTIDNLCEKKESSPVISDGSLRKSKKKRR 132

Query: 586 KAGPKAPNP-LSMKKKKKTG 642
           +    +      +KK KK G
Sbjct: 133 RGDDDSKTERKKLKKDKKKG 152

>KNAG0E02030 Chr5 complement(418026..418232) [207 bp, 68 aa] {ON}
           Anc_2.381 YDL085C-A
          Length = 68

 Score = 28.1 bits (61), Expect = 5.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +1

Query: 523 NIEKAEAISKGSEKESTPKKR 585
           N++K +  +KGS+KE  PKKR
Sbjct: 14  NLKKQQEANKGSKKEGDPKKR 34

>ZYRO0F03740g Chr6 complement(311378..313429) [2052 bp, 683 aa] {ON}
           similar to uniprot|P43579 Saccharomyces cerevisiae
           YFL013C IES1 Subunit of the INO80 chromatin remodeling
           complex
          Length = 683

 Score = 30.4 bits (67), Expect = 5.8
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 1/67 (1%)
 Frame = +1

Query: 451 LSTASAKASRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGP-KAPNPLSMKK 627
           L   +A       + +L +   DP+ E     +    K+ T K+RK  P K PN  S  K
Sbjct: 484 LPETAASTEVQDAQGELQEPTQDPSDENTAPNNTSDTKQDTTKRRKPRPRKRPNSASNVK 543

Query: 628 KKKTGPS 648
           K+   P+
Sbjct: 544 KESKAPA 550

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 30.4 bits (67), Expect = 5.8
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 4/58 (6%)
 Frame = +1

Query: 445 EPLSTASAKASRMTEEQKLYKGLND----PNIEKAEAISKGSEKESTPKKRKAGPKAP 606
           E +S  S      T+E  L + + D    P   K +  SKGSEK    K++K+  K+P
Sbjct: 335 EVISNPSLPKEESTDEPLLNEDIFDKRQTPKKTKTKRRSKGSEKTEAKKRKKSDEKSP 392

>Suva_4.473 Chr4 (823595..823607,823691..825558) [1881 bp, 626 aa]
           {ON} YBR215W (REAL)
          Length = 626

 Score = 30.0 bits (66), Expect = 7.5
 Identities = 18/74 (24%), Positives = 32/74 (43%)
 Frame = +1

Query: 430 SVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPN 609
           S ++ +P+S  S KAS    +    K +++      +     S K ST KK  + P +  
Sbjct: 337 SAILPKPVSKTSKKASSSNADSNKKKPISNKTASAIKKEPNTSSKLSTVKKENSVPSSTK 396

Query: 610 PLSMKKKKKTGPSD 651
               +K K +  +D
Sbjct: 397 ATEKEKDKNSNGTD 410

>KLTH0B05280g Chr2 (435558..438518) [2961 bp, 986 aa] {ON} similar
           to uniprot|P38827 Saccharomyces cerevisiae YHR119W SET1
           Histone methyltransferase subunit of the COMPASS complex
           which methylates histone H3 on lysine 4 and is required
           in transcriptional silencing near telomeres contains a
           SET domain
          Length = 986

 Score = 30.0 bits (66), Expect = 8.0
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +1

Query: 475 SRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKA 603
           +R    QK+  G    NI++A  I K  E++++ K+  +GP+A
Sbjct: 275 NRANYSQKIVDGFIQDNIKQAAKIKKEVERQNSQKQISSGPQA 317

>NCAS0C04900 Chr3 complement(999764..1001191) [1428 bp, 475 aa] {ON}
           Anc_1.397 YLR175W
          Length = 475

 Score = 29.6 bits (65), Expect = 9.5
 Identities = 18/54 (33%), Positives = 24/54 (44%)
 Frame = +1

Query: 475 SRMTEEQKLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKK 636
           ++  +E+K  K       EK E   K  +KE   KKRKA  +       KKK K
Sbjct: 421 TKKEDEEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKRKADDEGETEEKKKKKSK 474

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 29.6 bits (65), Expect = 9.5
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 12/101 (11%)
 Frame = +1

Query: 388 LRTVPGVPLIHLTRSVMIMEP--LSTASAKAS-RMTEEQKLYKG------LNDPNIEKA- 537
           +RT     L+H +R +++       T S   S R+  E+K  K       L D  + KA 
Sbjct: 6   IRTTRASTLVHASRPLVLRSSSIFGTRSLMYSHRLLAEEKDSKSKDAKSILTDDMLFKAG 65

Query: 538 -EAISKGSEKESTPKKRKAGPKA-PNPLSMKKKKKTGPSDD 654
            +  +K + KES  +   AG  A  +P+S KKKKK   S D
Sbjct: 66  VDLDAKDAGKESKEETTSAGETASSDPVSPKKKKKRQSSTD 106

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,798,017
Number of extensions: 1261737
Number of successful extensions: 4890
Number of sequences better than 10.0: 67
Number of HSP's gapped: 4751
Number of HSP's successfully gapped: 68
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 33 (17.3 bits)