Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1796.15ON25925913760.0
Skud_15.1656.15ON25725910921e-152
Smik_15.1736.15ON25125210691e-148
YOR004W (UTP23)6.15ON25425410501e-145
NDAI0I022506.15ON2712258181e-110
KAFR0A050606.15ON2692348141e-109
KLLA0D01023g6.15ON2682177921e-106
KNAG0F028806.15ON2692697871e-105
NCAS0D026606.15ON2612337831e-105
Kpol_1045.746.15ON2572237761e-104
TDEL0G045406.15ON2452597641e-102
ZYRO0C07920g6.15ON2932167651e-101
CAGL0E02673g6.15ON2632497591e-101
SAKL0E01056g6.15ON2692157591e-101
ACR011C6.15ON2532327446e-99
KLTH0C11352g6.15ON2682307449e-99
Kwal_56.223996.15ON2742727422e-98
TPHA0J002806.15ON2712727343e-97
Ecym_30196.15ON2662286891e-90
TBLA0A072906.15ON2592616082e-78
KLTH0E02860g5.392ON1891451478e-11
Kwal_55.200895.392ON1891451461e-10
Kpol_1055.185.392ON1891451442e-10
CAGL0M01056g5.392ON1891451433e-10
ZYRO0A06754g5.392ON1891481424e-10
KLLA0A07018g5.392ON1891451416e-10
KAFR0D042805.392ON1891451407e-10
NDAI0C045505.392ON1891451408e-10
KNAG0C052705.392ON1891451391e-09
AEL102W5.392ON1891451381e-09
TDEL0E023305.392ON1891481381e-09
TBLA0H017505.392ON1891451372e-09
TPHA0D023105.392ON1891451372e-09
Ecym_74695.392ON1891451363e-09
NCAS0F030905.392ON1891451354e-09
SAKL0G07766g5.392ON1891451345e-09
Skud_4.6065.392ON1891451311e-08
Suva_2.5095.392ON1891451312e-08
YDR339C (FCF1)5.392ON1891451312e-08
Smik_4.5995.392ON1891451302e-08
KLLA0E06799g7.426ON51597770.31
ADL145C5.94ON875170730.95
ZYRO0D14014g5.587ON155963721.3
KNAG0C029104.108ON124470712.0
Kwal_47.16707singletonOFF194109655.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.179
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   534   0.0  
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   425   e-152
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   416   e-148
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   409   e-145
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   319   e-110
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   318   e-109
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   309   e-106
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   307   e-105
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   306   e-105
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   303   e-104
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   298   e-102
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   299   e-101
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   296   e-101
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   296   e-101
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   291   6e-99
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   291   9e-99
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   290   2e-98
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   287   3e-97
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   270   1e-90
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   238   2e-78
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    61   8e-11
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    61   1e-10
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    60   2e-10
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    60   3e-10
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    59   4e-10
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    59   6e-10
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    59   7e-10
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    59   8e-10
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    58   1e-09
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    58   1e-09
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    58   1e-09
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    57   2e-09
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    57   2e-09
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    57   3e-09
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    57   4e-09
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    56   5e-09
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    55   1e-08
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    55   2e-08
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    55   2e-08
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    55   2e-08
KLLA0E06799g Chr5 (618131..619678) [1548 bp, 515 aa] {ON} simila...    34   0.31 
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    33   0.95 
ZYRO0D14014g Chr4 (1181160..1185839) [4680 bp, 1559 aa] {ON} som...    32   1.3  
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    32   2.0  
Kwal_47.16707 s47 complement(73569..74153) [585 bp, 194 aa] {OFF...    30   5.2  

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/259 (100%), Positives = 259/259 (100%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180
           SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSN 240
           AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSN
Sbjct: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSN 240

Query: 241 ADDSIASGTSVAQGQASSD 259
           ADDSIASGTSVAQGQASSD
Sbjct: 241 ADDSIASGTSVAQGQASSD 259

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  425 bits (1092), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 234/259 (90%), Gaps = 2/259 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVV+VNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180
           SQDI LRRKLRTVPGVPLIHLTRSVMIMEPLSTASAK S+ TEEQKL+KGLNDPN+EK E
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSN 240
            +S  S KES PKKRK GPKAPNPLS+KKKK + PS +E K +DDA K+KKRRR+  KS+
Sbjct: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPS-NETKGEDDAFKEKKRRRKH-KSS 238

Query: 241 ADDSIASGTSVAQGQASSD 259
            + S  +GT+V Q Q SSD
Sbjct: 239 TNKSAINGTTVLQVQPSSD 257

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  416 bits (1069), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/252 (82%), Positives = 230/252 (91%), Gaps = 1/252 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+GSNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPA+CIESVV++NGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180
           SQDI LRRKLR VPGVPLIHLTRSVM+MEPLSTASAKAS+MTEE+KLYKGLNDPN++K +
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSN 240
            IS+GS KES  KKRK GPKAPNPLS+KKKKK   + DE + K+D SK+KKRRRR+H S+
Sbjct: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKEKKRRRRKHGSH 240

Query: 241 ADDSIASGTSVA 252
             +SI + T+ A
Sbjct: 241 T-NSITNRTTAA 251

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  409 bits (1050), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 231/254 (90%), Gaps = 1/254 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+ SNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPAECIESVVN++GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180
           SQDIDLRRKLRTVPGVPLIHLTRSVM+MEPLSTASAKAS++TEEQKLYKGLNDPNIEK +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDAS-KDKKRRRRRHKS 239
               GS KES  KKRK GPKAPNPLS+KKKKK     DEVKDK+D S + KKRRRR+HKS
Sbjct: 181 ESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKEDTSKEKKKRRRRKHKS 240

Query: 240 NADDSIASGTSVAQ 253
           N +  +++GT+ AQ
Sbjct: 241 NTNVPVSNGTTAAQ 254

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  319 bits (818), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 157/225 (69%), Positives = 182/225 (80%), Gaps = 6/225 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+V +CS SN+DL  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  ECIESVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180
           SQD+  RRKLR VPGVPLIH++R+VMIMEPLS  SA+ SR  E +KLYKGLNDP     +
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 -AISKGS--EKEST---PKKRKAGPKAPNPLSMKKKKKTGPSDDE 219
            A+ K +  EKEST    KKRK GPK PNPLSMKKKK    S +E
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNE 225

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  318 bits (814), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/234 (66%), Positives = 184/234 (78%), Gaps = 6/234 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V+  S SNFDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P EC+ SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP-----N 175
           SQDID+RR+LR VPGVPL+H++RSVMIMEPLS  SAK S   E++KLYKGLNDP      
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 176 IEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKD 229
           +++ EA       E T KK++ GPK PNPLS++KK KT     +    DD  ++
Sbjct: 181 LDEEEATETQGSGEKTAKKKR-GPKGPNPLSVRKKVKTLNEPKQTDKNDDVQEE 233

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  309 bits (792), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 178/217 (82%), Gaps = 5/217 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLV E   S+FD   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177
           +QD+++RR+LR +PGVPL+++ RSVM+MEPLS AS K SR  EEQKLYKGLNDP    I 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 178 KAEAISKGSE-KESTPKKRKAGPKAPNPLSMKKKKKT 213
           + E    G+E +E+ PKKRK GPK PNPLSMKKKK T
Sbjct: 181 RDENDEAGAENQENKPKKRK-GPKEPNPLSMKKKKTT 216

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  307 bits (787), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 166/269 (61%), Positives = 207/269 (76%), Gaps = 11/269 (4%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQV++D+++V + + S FDL   L+RT+QA+VK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALY T N  AID+AK++ERRRCNH  KDPKSP ECIESVV++ G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLND---PNIE 177
            Q+IDLRRKLR VPGVPLIH++R+VMIMEPLS ASA+ S+  E+QKL+ GLND     I+
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 178 KAE---AISKGSEK-ESTPKKRKAGPKAPNPLSMKKKKKTGPSDDE----VKDKDDASKD 229
            AE      KG E  E+ PKKRK GPK PNPLSMKKKKK G S+ +     KD +D S D
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKDGNSEQKNVGTKKDNEDDSTD 240

Query: 230 KKRRRRRHKSNADDSIASGTSVAQGQASS 258
           KK+R+RRHK+  + S + G S  Q ++ +
Sbjct: 241 KKKRKRRHKAKKEPSDSHGESQKQDESDA 269

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  306 bits (783), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 192/233 (82%), Gaps = 7/233 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V++CS SN+DL  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P ECIESVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIE--K 178
           +QD+ +RRKLR VPGVPL+H++R+VMIMEPLS ASAK S+  E +KLYKGLNDP     K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 179 AEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKK 231
             A     + +  PKK K GPK+PNPLSMKKKK+     +  ++++D+++D++
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQ-----EPKRNREDSTEDQE 228

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  303 bits (776), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 181/223 (81%), Gaps = 4/223 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S FD+  GLKRTLQA+VKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+V++ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKA- 179
           SQD+D+RRKLR +PGVP++H++R+VMI+EPLS AS K S   E+ KLYKGLND       
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 -EAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVK 221
            E  S+ SEK S  KK K GPK PNPLSM KK+K+ P+ +EV+
Sbjct: 181 DEPKSEKSEKTSESKKNK-GPKQPNPLSM-KKRKSKPASNEVE 221

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  298 bits (764), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 191/259 (73%), Gaps = 16/259 (6%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+V +C GSNFDL  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P EC+ES+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180
           SQDID RR LR  PGVPL+H  RSVM+MEPLS ASAK S   E +KL+KGLNDP      
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPR----N 176

Query: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDE-VKDKDDASKDKKRRRRRHKS 239
           A  K    +++ KKR    K PNPLS+KK+K     + +  +D +  + + K+RRR+HKS
Sbjct: 177 AGIKTENPQTSIKKRT---KQPNPLSVKKRKTESKGEPKAAQDTEPVASNTKKRRRKHKS 233

Query: 240 NADDSIASGTSVAQGQASS 258
           +        T+  QGQ  S
Sbjct: 234 S--------TTEPQGQEES 244

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  299 bits (765), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 177/216 (81%), Gaps = 4/216 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLVS+C  S++DL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P ECI+SVVNVNG+NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177
           SQD+ LRRKLR VPGVPLIH++RSVM+MEPLS AS++ + M+E +KL KGLNDP    ++
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 178 KAEAISKGSEKEST-PKKRKAGPKAPNPLSMKKKKK 212
              ++    E ES  P K++ GPK PNPLS++KK+K
Sbjct: 181 TTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQK 216

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 189/249 (75%), Gaps = 5/249 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V + + S +DL   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP ECI +VV+V G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177
            QD+++RR LR VPGVPL+H++RSVMIMEPLS ASAK SRM EE KL++GLNDP    ++
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 178 KAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDK--DDASKDKKRRRR 235
                 + S++++  KKRK GPK PNPLSMKKKKK     ++  +   D +   K+RR R
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSADQSQPTKRRRSR 240

Query: 236 RHKSNADDS 244
           +HK  + +S
Sbjct: 241 KHKHGSKNS 249

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 175/215 (81%), Gaps = 4/215 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V     S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  ECIESVVN NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177
           +QDID+RRKLR VPGVPLI++ RSVM+MEPLS AS + S++ EE+KL+KGLNDP    + 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 178 KAEAIS-KGSEKESTPKKRKAGPKAPNPLSMKKKK 211
             E++    S K+  P K+K GPK PNPLS+K+K+
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKR 215

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  291 bits (744), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 141/232 (60%), Positives = 178/232 (76%), Gaps = 6/232 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+V E + S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P EC++SVV VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177
           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + SR  E+QKL+KGLNDP    I 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 178 KAEAISKGSEKESTPKKRKAGPKAPNPLSMKKK--KKTGPSDDEVKDKDDAS 227
           +  A +     E  P  ++ GPKAPNPLSMKK+  K+  P+ D  + K DAS
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADAS 231

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  291 bits (744), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 175/230 (76%), Gaps = 3/230 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   ++FDL  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P EC++SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180
           SQD  +R+KLR VPGVPLI++ RSVM+MEPLS AS   SR  E++KL+KGLNDP      
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 AISKGSEKES---TPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDAS 227
           A  +G + ++     K ++ GPK PNPLS+KKKK    S DE    D  S
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDESPPSDKIS 230

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  290 bits (742), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 189/272 (69%), Gaps = 19/272 (6%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   + FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P EC++SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNI---- 176
           +Q+ ++R  LR VPGVPL+ + RSVM+MEPLS AS   SR+ E +KL+KGLNDP      
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 177 ---EKAEAISKGSEKE--STPKKRKAGPKAPNPLSMKKKKKT-------GPSDD---EVK 221
              + A A +   +KE    P K++ GPK PNPLS+KKKK +        P+++    + 
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKEPVNPAENTSATLT 240

Query: 222 DKDDASKDKKRRRRRHKSNADDSIASGTSVAQ 253
           + D+  +  +RR+R HK     +    TS  Q
Sbjct: 241 ENDNKEQPSRRRKRSHKKTTPQTAEETTSEQQ 272

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  287 bits (734), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 149/272 (54%), Positives = 191/272 (70%), Gaps = 16/272 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQAD-VKV 59
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN++L   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVV 119
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+VN++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKA 179
           A+Q+++LRRKLR VPGVP++HL+RSVMIMEP+S +S + +R  E+ KLYKGLNDP    A
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 EAISKGS-EKEST---PKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRR 235
               +G+ + E T     K++ G K PNPLS KKK K           D A+   K+RRR
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVKVEIPKPAATTTDAAN---KKRRR 237

Query: 236 RHKSN--------ADDSIASGTSVAQGQASSD 259
           +H+SN         +D   +G S  Q   S D
Sbjct: 238 KHRSNKNSENGNEGEDPKETGNSEEQVPESQD 269

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  270 bits (689), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 173/228 (75%), Gaps = 12/228 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLV E + S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P+ECI SVV++NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP------ 174
           +QDI++RR LR VPGVPLI++ RSVM+MEPLS+ S + S+  E +KL KGLNDP      
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 175 -NIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKK---KKKTGPSDD 218
            N E A    K  +     +K K GPK PNPLS+KK    K   PS+D
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIK-GPKEPNPLSIKKPRVNKAQLPSED 226

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  238 bits (608), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 175/261 (67%), Gaps = 27/261 (10%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQAD--VK 58
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + ++L  GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYV 118
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP+EC+ S+V+VNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEK 178
           VA+QD++LRRKLR +PGVPLIH  RSVM+MEPLS AS + +   E +KL  GLN      
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNS----- 175

Query: 179 AEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV---------------KDK 223
            +A  +G ++    KK+  G    NPLSMKKK  +  + +                 +D 
Sbjct: 176 TKASVEGGQENGIKKKKVKG---VNPLSMKKKSNSNSNSNSNSNSNSKPKPKPIKHERDN 232

Query: 224 DDASKD--KKRRRRRHKSNAD 242
           ++A+    KKRR+R+H SNA+
Sbjct: 233 ENATDQPAKKRRKRKHTSNAN 253

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+  TL A    MIT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       DL  G+  TL A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D+ L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDVGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    R PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD-----DCL-----VNRVMQHKCYIVATNDAPL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 154
           ++++R +PG+PL+ +     ++E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A   ++IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRVRKVPGIPLMSVGGHSYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 58.5 bits (140), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 154
           ++++R +PG+PL+ +      +E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYAIEKLPDA 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVVEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L +      R PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDQGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLLSVGGHSYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       DL  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ ++VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCFIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       D+  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVNVNGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>KLLA0E06799g Chr5 (618131..619678) [1548 bp, 515 aa] {ON} similar
           to uniprot|P38682 Saccharomyces cerevisiae YER122C
          Length = 515

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 15/97 (15%)

Query: 166 KLYKGLNDPNIEKAEAISKGSEKESTPKKRKA--GPKAPNPLSMKKKKKTGPSDDEVKDK 223
           KL  G+   N EK        E+  T + R+A  GPK    ++ K  ++ G S D+V  +
Sbjct: 363 KLGFGMTSNNAEK--------EQNKTNESRRAASGPKYTGKIAQKFGEQKGISSDQVFSR 414

Query: 224 ----DDASKDKKRRRRRHKSNADDSIASGTSVAQGQA 256
               D+ASK+ + + R++ SNA  SI+S +   +GQ+
Sbjct: 415 GSYDDEASKEAQEKLRQNFSNA-TSISSASYFGEGQS 450

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 67/170 (39%), Gaps = 37/170 (21%)

Query: 106 VVNVNGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQ 165
           +V  N       VV++ DIDL+    +     ++H    VM  + L+   +  +R  +  
Sbjct: 460 IVMHNSQTDVALVVSTTDIDLKDNNESTNDTSVVHEPGKVMNSDDLTAVHSTKTRQEDAN 519

Query: 166 KLYKGLNDPNIEKAEAISKGSEKESTPKKRKAGPKAP---NPLSMKKK------------ 210
           +++  L+       EA+SKG +K   PKK  A   A    N +S   K            
Sbjct: 520 EMFSALD-------EAVSKG-KKSCLPKKHIAASVAASTSNEISASAKSNKDSSDVQATK 571

Query: 211 ----------KKTGPSDDEVKDKDDASKDKKRRRRRHKSNADDSIASGTS 250
                     ++T P        D AS  K  RR+    NADDS +S +S
Sbjct: 572 QLPATPTSNPRQTKPKSTSGTQNDTASSQKNTRRK----NADDSPSSESS 617

>ZYRO0D14014g Chr4 (1181160..1185839) [4680 bp, 1559 aa] {ON} some
            similarities with uniprot|P38904 Saccharomyces cerevisiae
            YDR464W SPP41 appears to control expression of
            spliceosome components PRP4 and PRP3 negative regulator
            of prp genes
          Length = 1559

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 26   YQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVMITQCCIQALYETRNEGAIDLAKQFE 85
            ++ +V  QLV  C G+N DLPS L   + A +           L +TR     +L  + E
Sbjct: 1209 FEDMVKQQLVQSC-GNNVDLPSNLSNIISATLA-----NVFPDLNDTRKNEIQELPSRPE 1262

Query: 86   RRR 88
            RRR
Sbjct: 1263 RRR 1265

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 32.0 bits (71), Expect = 2.0,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 8/70 (11%)

Query: 185 GSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSNADDS 244
           G ++E TP  +   P A +P S        P DD   D       + R R R   +ADD+
Sbjct: 193 GPDREETPPPKPTRPVAQDPAS--------PHDDRHGDSRAGDDLRARARNRMSYDADDA 244

Query: 245 IASGTSVAQG 254
            A G    +G
Sbjct: 245 DAGGYHDPRG 254

>Kwal_47.16707 s47 complement(73569..74153) [585 bp, 194 aa] {OFF}
           [contig 376] FULL
          Length = 194

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 24/109 (22%)

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPLSTA-----SAKASRMTEEQKLYKGLNDPNIEKAEA 181
           R ++R  P VPL+ L     ++ PL +      S  AS    +++           KA+A
Sbjct: 28  RIQIREEPAVPLLQLAEDSSLVAPLFSCPCLIRSCLASSSCIDKR-----------KAKA 76

Query: 182 ISKGSEKESTPKKRKAGP---KAPNPLSMKKKKKTGPSDDEVKDKDDAS 227
            S GS + STPK  K+ P   +AP P     K  + PS   + D    S
Sbjct: 77  -SSGSMEGSTPKSMKSSPPIAEAPTP----PKPGSAPSSSTMGDAATCS 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,214,346
Number of extensions: 1197730
Number of successful extensions: 10516
Number of sequences better than 10.0: 471
Number of HSP's gapped: 9494
Number of HSP's successfully gapped: 712
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)