Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1786.14ON47647624610.0
Skud_15.1646.14ON48247819700.0
YOR003W (YSP3)6.14ON47847818910.0
Smik_15.1726.14ON47847818870.0
YEL060C (PRB1)6.14ON63541513311e-179
Skud_5.296.14ON60842413281e-179
Kwal_56.223876.14ON54349613111e-177
Smik_5.276.14ON60841513171e-177
Suva_5.76.14ON66441513221e-177
SAKL0E01012g6.14ON54442112871e-173
KLTH0C11396g6.14ON55042812761e-172
KLLA0D00979g6.14ON56142312511e-168
TBLA0A073006.14ON57341312481e-167
TDEL0G045506.14ON56441412401e-166
NCAS0F002206.14ON69541312501e-166
NDAI0K028806.14ON70441712031e-158
ZYRO0C07942g6.14ON54849411701e-156
KAFR0L003606.14ON50248211621e-155
CAGL0B03619g6.14ON46841511541e-154
ACR012C6.14ON54142111591e-154
Kpol_1032.56.14ON68041811631e-153
Ecym_30186.14ON57542011271e-149
KNAG0E009206.14ON53141311231e-149
Kpol_1045.756.14ON47742111071e-147
KAFR0B065506.14ON45640810181e-134
TPHA0M002306.14ON58541710291e-134
CAGL0E02651g6.14ON48541310131e-133
NCAS0D026306.14ON4514239971e-131
NDAI0I022806.14ON4824218951e-115
KNAG0F02970singletonON4203228871e-115
CAGL0L13266gsingletonON5794166762e-81
SAKL0A02002g6.313ON4793945401e-62
Suva_3.846.313ON5274145273e-60
YCR045C (RRT12)6.313ON4914185096e-58
Smik_3.1496.313ON4914125096e-58
ZYRO0D08822g6.313ON4903895052e-57
Kpol_1028.616.313ON5183164922e-55
KLTH0A06094g6.313ON4963144903e-55
NCAS0D043906.313ON4923814904e-55
KNAG0I024706.313ON4754024868e-55
Skud_3.1246.313ON5404184863e-54
Kpol_1018.56.313ON4653804813e-54
NDAI0I005606.313ON4834334791e-53
CAGL0L10802g6.313ON5173414757e-53
KAFR0J024506.313ON4783804737e-53
TDEL0A072806.313ON4364174691e-52
AAR069W6.313ON7683224813e-52
Ecym_21056.313ON6103194674e-51
Kwal_23.61836.313ON4933224553e-50
TBLA0F039706.313ON7343144621e-49
KLLA0F06028g6.313ON5083224521e-49
TPHA0D037606.313ON6073114211e-44
Kwal_33.133721.78ON3772933662e-38
TBLA0A067006.313ON4972543661e-37
KLTH0F02288g1.78ON3802963433e-35
ZYRO0F16764g1.78ON3863333213e-32
TPHA0B045201.78ON3883563065e-30
Kpol_2000.691.78ON3863103021e-29
TBLA0A054101.78ON3823062572e-23
TDEL0C062301.78ON3643482376e-21
Smik_14.972.6ON814259950.006
Suva_14.1062.6ON809299930.011
YNL238W (KEX2)2.6ON814342910.017
Kwal_56.248002.6ON803252910.018
KAFR0A080402.6ON766342900.023
NDAI0F038902.6ON833253890.031
SAKL0G00440g2.6ON836249880.043
KLTH0H00418g2.6ON811257850.089
Skud_14.1012.6ON819257810.25
TBLA0B001302.6ON842276790.53
NCAS0A008802.6ON833311770.82
KNAG0F007702.6ON826302761.1
ZYRO0F15598g2.6ON79085761.1
KLLA0D19811g2.6ON756246761.1
Ecym_64862.6ON781100751.6
TPHA0P017902.6ON799247723.0
TBLA0D022408.140ON156353723.1
TPHA0G025702.380ON34668713.7
TPHA0G020302.380ON34768713.8
CAGL0J10318g2.216ON38664704.7
Kpol_1015.82.6ON843185697.7
Smik_3.741.412ON38656688.1
KNAG0H022102.260ON44490689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.178
         (476 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   952   0.0  
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   763   0.0  
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   733   0.0  
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   731   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   517   e-179
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   516   e-179
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   509   e-177
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   511   e-177
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   513   e-177
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   500   e-173
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   496   e-172
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   486   e-168
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   485   e-167
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   482   e-166
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   486   e-166
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   468   e-158
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   455   e-156
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   452   e-155
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   449   e-154
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   451   e-154
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   452   e-153
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   438   e-149
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   437   e-149
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   431   e-147
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   396   e-134
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   400   e-134
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   394   e-133
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     388   e-131
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   349   e-115
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              346   e-115
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   265   2e-81
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   212   1e-62
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   207   3e-60
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   200   6e-58
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   200   6e-58
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   199   2e-57
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   194   2e-55
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   193   3e-55
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   193   4e-55
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   191   8e-55
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   191   3e-54
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   189   3e-54
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    189   1e-53
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   187   7e-53
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   186   7e-53
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   185   1e-52
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   189   3e-52
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   184   4e-51
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   179   3e-50
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   182   1e-49
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   178   1e-49
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   166   1e-44
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   145   2e-38
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   145   1e-37
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   136   3e-35
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   128   3e-32
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   122   5e-30
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   120   1e-29
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...   103   2e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    96   6e-21
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    41   0.006
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    40   0.011
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    40   0.017
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    40   0.018
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    39   0.023
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    39   0.031
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    39   0.043
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    37   0.089
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    36   0.25 
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    35   0.53 
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    34   0.82 
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    34   1.1  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    34   1.1  
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    34   1.1  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    33   1.6  
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    32   3.0  
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    32   3.1  
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    32   3.7  
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    32   3.8  
CAGL0J10318g Chr10 complement(1008835..1009995) [1161 bp, 386 aa...    32   4.7  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    31   7.7  
Smik_3.74 Chr3 complement(104188..105348) [1161 bp, 386 aa] {ON}...    31   8.1  
KNAG0H02210 Chr8 complement(397385..398719) [1335 bp, 444 aa] {O...    31   9.1  

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  952 bits (2461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/476 (97%), Positives = 464/476 (97%)

Query: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60
           MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV
Sbjct: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60

Query: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF 120
           VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF
Sbjct: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF 120

Query: 121 GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHR 180
           GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHR
Sbjct: 121 GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHR 180

Query: 181 ISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDL 240
           ISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDL
Sbjct: 181 ISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDL 240

Query: 241 NGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXX 300
           NGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHID      
Sbjct: 241 NGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGG 300

Query: 301 XXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVG 360
                 TANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVG
Sbjct: 301 PKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVG 360

Query: 361 ASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLS 420
           ASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLS
Sbjct: 361 ASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLS 420

Query: 421 LQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           LQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW
Sbjct: 421 LQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/478 (76%), Positives = 410/478 (85%), Gaps = 2/478 (0%)

Query: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60
           MKL  +LL LCAG  +CMIIP L+EI Y +E+ E+FRNAK Q+GLGQQ   N HL   KV
Sbjct: 3   MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 62

Query: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF--VSTSAPSDL 118
           +  ++SLPYRYII F+ED + R IESH +MIQ+ Q  SVSK+ +DD+F   VS SA  + 
Sbjct: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122

Query: 119 QFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGL 178
           QFGGID  FDINGLFRGYTGYFT+EVI+ V QDP++KFIE ESTV+++NS+ QE+APWGL
Sbjct: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182

Query: 179 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238
           HRISHRE+AKYGQDLEYLYEDAAG GVTSYVLDTGID  HEDFEGRA WGAVIP+NDEAS
Sbjct: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242

Query: 239 DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXX 298
           DLNGHGTHCAGIIGSRHFGV KNTN++AVKVLRSNGEGTVSDVIKGIEYV K+HI     
Sbjct: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKK 302

Query: 299 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358
                   TANLSLGSSKSPAMEMAVNAAV+ GVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 303 RGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362

Query: 359 VGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418
           VGASTFSDDRAFFS+WGTCVDVFAPG+NI+STYIGSRNA+LSLSGTSMAAPHVAGILSY 
Sbjct: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 422

Query: 419 LSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           LSLQP+ DSEFF  TVSPQQLKEKI+ FST+GVLGDV E+TPNRL+YNGGG+KLD FW
Sbjct: 423 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/478 (73%), Positives = 406/478 (84%), Gaps = 2/478 (0%)

Query: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60
           MK  T+L  L A C +CMIIP  D IV   E+I+  R+ +  EGLGQ + GNFH +   V
Sbjct: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60

Query: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF--VSTSAPSDL 118
            +K E LPYRY+I F+ED S++ I+SH +++Q+  + SV KL ++DAF+  +S+S  S  
Sbjct: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKS 120

Query: 119 QFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGL 178
           QFGGID+FFDINGLFRGYTGYFT+E+IK + QDPIIKF+EQE+TVK++NS+ QEEAPWGL
Sbjct: 121 QFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGL 180

Query: 179 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238
           HR+SHREK KYGQDLEYLYEDAAG+GVTSYVLDTGID  HEDFEGRA WGAVIP NDEAS
Sbjct: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240

Query: 239 DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXX 298
           DLNGHGTHCAGIIGS+HFGV KNT +VAVKVLRSNGEGTVSDVIKGIEYV K+HI+    
Sbjct: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300

Query: 299 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358
                   TANLSLGSSKS AMEMAVNAAV+SGVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360

Query: 359 VGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418
           VGASTFSDDRAFFS+WGTCVDVFAPG+NI+STYIGSRNA+LSLSGTSMA+PHVAGILSYF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420

Query: 419 LSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           LSLQP+ DSEFF+   SPQ+LKEK++ FSTQGVLGD+G+DTPN+LIYNGGG+KLD FW
Sbjct: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/478 (72%), Positives = 404/478 (84%), Gaps = 2/478 (0%)

Query: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60
           MK  T+L  L A C +CMIIP  DEIV  T+  +D RN K  + L QQ +G F +     
Sbjct: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60

Query: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF--VSTSAPSDL 118
            +K E +PYRYI+ F+ED S++SIESH++M+QE  + SVSKLA+DD F   VS+S   DL
Sbjct: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120

Query: 119 QFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGL 178
           Q GGIDS FDINGLFRGY GYFT+E++  V QDP+IKFIEQESTV+++N++ Q++APWGL
Sbjct: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180

Query: 179 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238
           HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGID  HEDFEGRAVWGAVIP NDEAS
Sbjct: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240

Query: 239 DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXX 298
           DLNGHGTHCAGIIGS+H+GV KNT LVAVKVLRSNGEGTVSDVIKGIEYV ++HI+    
Sbjct: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300

Query: 299 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358
                   TANLSLGSSKS AMEMAV+AAV+SGVHFAIAAGNE+EDACLSSPAGA+KSIT
Sbjct: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 359 VGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418
           VGASTFSDDRAFFS+WGTCVDVFAPG+NI+STYIGSRNA+LSLSGTSMAAPHVAG+LSYF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 419 LSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           LSLQP+ DSE+FD+ +SPQ+LKEK++ FST GVLGD+G++TPNRLIYNGGG+ LD+ W
Sbjct: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  517 bits (1331), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 245/415 (59%), Positives = 316/415 (76%), Gaps = 5/415 (1%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSDLQFGGID 124
           +P RYII F   +    I+ HK  +Q+ Q +SV  L+ +DAFF+ST  ++ S  + GGI 
Sbjct: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238

Query: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
             F+I+ LF GY GYFT+E++  + Q+P++ F+E++S V+ T    Q  APWGL RISHR
Sbjct: 239 DSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHR 298

Query: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244
           E+   G   +YLY+D AGRGVTSYV+DTG++INH+DFE RA+WG  IP NDE  D NGHG
Sbjct: 299 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 358

Query: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
           THCAG I S+H+GV KN N+VAVKVLRSNG GT+SDV+KG+EY  K H            
Sbjct: 359 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGFK 418

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364
             TAN+SLG  KSPA+++AVNAAVE G+HFA+AAGNE++DAC +SPA A+K+ITVGAST 
Sbjct: 419 GSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTL 478

Query: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
           SDDRA+FS+WG CVDVFAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 479 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPG 538

Query: 425 SDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           SDSEFF+    +++PQQLK+K+I++ST+ +L D+ EDTPN LIYNGGG+ L  FW
Sbjct: 539 SDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  516 bits (1328), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 244/424 (57%), Positives = 319/424 (75%), Gaps = 11/424 (2%)

Query: 58  PKVVYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAP 115
           PK++      P RYII F +     + + HK  + + Q +SV  L+ +DAFF+ST  S+ 
Sbjct: 149 PKII------PNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSL 202

Query: 116 SDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAP 175
           S  + GGI   F+I+ +F GY GYFT+E+I  + Q+P++ F+E++S V+ T+   Q  AP
Sbjct: 203 STSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAP 262

Query: 176 WGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDND 235
           WGL RISHRE+   G   +YLY+D AGRGVTSYV+DTG+++NH+DFE RA+WG  IP ND
Sbjct: 263 WGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLND 322

Query: 236 EASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDX 295
           E  D NGHGTHCAG I S+H+GV KN N+VAVKVLRSNG GT+SDV+KG+EY  + H   
Sbjct: 323 EDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQ 382

Query: 296 XXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEK 355
                      TAN+SLG  KSPA+++AVNAAVE+G+HFA+AAGNE++DAC +SPA A+K
Sbjct: 383 AQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK 442

Query: 356 SITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGIL 415
           +ITVGAST SDDRA+FS+WG CVD+FAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+L
Sbjct: 443 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLL 502

Query: 416 SYFLSLQPSSDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKL 472
           +YFLSLQP SDSEFF+    +++PQQLK K+I++ST+ +L DV EDTPN LIYNGGG+ L
Sbjct: 503 TYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDL 562

Query: 473 DNFW 476
             FW
Sbjct: 563 SAFW 566

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  509 bits (1311), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 252/496 (50%), Positives = 340/496 (68%), Gaps = 20/496 (4%)

Query: 1   MKLLTVL-LALCAGCGVCMIIPGLDEIVY-LTESIEDFRNAKGQEGLGQ---------QE 49
           MKL T L +A+ A     +++P ++E       ++E+   + G+  L            E
Sbjct: 1   MKLQTTLPVAMVAALASALVLPEVEEASKDALVAVEETAASLGESILSSFSKEVTKKAAE 60

Query: 50  TGNFHLQEPKVVYKA--ESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDA 107
           +G      P V  +   +++P+RYI+ F +      ++ H  ++ E   +SV KL  +DA
Sbjct: 61  SGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDA 120

Query: 108 FFVST-----SAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQEST 162
           FF +T        +  + GGI   FD+NG+ RGY GYFT+E++  +  +P++ F+EQ+S 
Sbjct: 121 FFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSM 180

Query: 163 VKVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFE 222
           V       Q  APWGL RISHREK   G   +YLY+DAAG+GVTSYV+DTGI+I+H+DFE
Sbjct: 181 VYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFE 240

Query: 223 GRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVI 282
           GRA WG  +P ND   D NGHGTHCAG I S+H+GV KN N+VAVKVLRSNG G++SDV+
Sbjct: 241 GRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVV 300

Query: 283 KGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNED 342
           KG+E+  K H D            TAN+SLG  KSPA++MAVNAAV++G+HFA+AAGNE+
Sbjct: 301 KGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNEN 360

Query: 343 EDACLSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLS 402
           +DAC SSPA AE +ITVGAST +DDRA+FS+WG CVD+FAPG+N+LSTYIGS  A+ +LS
Sbjct: 361 QDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420

Query: 403 GTSMAAPHVAGILSYFLSLQPSSDSEFFDST--VSPQQLKEKIINFSTQGVLGDVGEDTP 460
           GTSMA+PHVAG+L+YFLSLQP SDSE+F +   ++P QLK+K+I +ST+  LGD+ EDT 
Sbjct: 421 GTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480

Query: 461 NRLIYNGGGRKLDNFW 476
           N LIYNGGG+ LD+FW
Sbjct: 481 NYLIYNGGGQDLDDFW 496

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  511 bits (1317), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/415 (58%), Positives = 312/415 (75%), Gaps = 5/415 (1%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSDLQFGGID 124
           +P RYI+ F +      +  HK  + + Q +SV  L+ +DAFF ST  +  S  + GGI 
Sbjct: 152 IPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQ 211

Query: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
             F+I+ +F GY GYFT+E+I  + Q+P++ F+E++S V+ T    Q  APWGL RISHR
Sbjct: 212 DSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHR 271

Query: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244
           E+   G   +YLY+D AGRGVTSYV+DTG++INH+DFE RA+WG  IP NDE  D NGHG
Sbjct: 272 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 331

Query: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
           THCAG I S+H+GV KN N+VAVKVLRSNG GT+SDV+KG+EY  K H            
Sbjct: 332 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKKGFK 391

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364
             TAN+SLG  KSPA+++AVNAAVE+G+HFA+AAGNE++DAC +SPA A+K+ITVGAST 
Sbjct: 392 GSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTL 451

Query: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
           SDDRA+FS+WG CVDVFAPG+NILSTYIGS  A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 452 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPG 511

Query: 425 SDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           SDSEFF+    +++PQQLK+K+I++ST+ +L D+ EDTPN LIYNGGG+ L  FW
Sbjct: 512 SDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  513 bits (1322), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/415 (58%), Positives = 316/415 (76%), Gaps = 5/415 (1%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSDLQFGGID 124
           +P RYII F +D        H+  +Q+ Q +SV  LA +DAFF+ST  +A S  + GGI 
Sbjct: 207 IPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQ 266

Query: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
             F+I+ LF GY GYFT+E++  + Q+P++ F+E++S V+ T+   Q  APWGL R+SHR
Sbjct: 267 DSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHR 326

Query: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244
           E+   G   +YLY+D AGRGVTSYV+DTG+++NH+DFE RA+WG  IP NDE  D NGHG
Sbjct: 327 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHG 386

Query: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
           THCAG I S+H+GV KN N+VAVKVLRSNG GT+SDV+KG+EY  K H            
Sbjct: 387 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGFK 446

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364
             TAN+SLG  KSPA+++AVNAAVE+G+HFA+AAGNE++DAC +SPA A+K+ITVGAST 
Sbjct: 447 GSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTL 506

Query: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
           SDDRA+FS++G CVDVFAPG+NILSTYIGS  A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 507 SDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPG 566

Query: 425 SDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           SDSEFF+    +++PQQLK+K+I++ST+ +L D+ +DTPN LIYNGGG+ L  FW
Sbjct: 567 SDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  500 bits (1287), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 236/421 (56%), Positives = 309/421 (73%), Gaps = 8/421 (1%)

Query: 64  AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSD------ 117
           A  +P+RYII F +D++   I  HK +I E   ESV+KL   D+FF +T   +D      
Sbjct: 75  ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAA 134

Query: 118 -LQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPW 176
               GGI   FDI  +  GY GYFT+EV+  +  +  ++FIE++S V  +    Q  APW
Sbjct: 135 KSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPW 194

Query: 177 GLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDE 236
           GL RISHRE+   G   +YLY+D AG+GVTSYV+DTGI++NH+DF GRAVWG  +P NDE
Sbjct: 195 GLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDE 254

Query: 237 ASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXX 296
            +D NGHGTHCAG I S H+GV KN  +VA+KVLRSNG GT+SDV+KG+E+  + H +  
Sbjct: 255 DADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEAS 314

Query: 297 XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356
                     TAN+SLG  KSPA+++AVNAAV++G+HFA+AAGNE++DAC +SPA AE +
Sbjct: 315 KKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENA 374

Query: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILS 416
           ITVGAST SDDRA+FS+WG CVD+FAPG+N+LSTYIGS  A+ +LSGTSMA+PHVAG+L+
Sbjct: 375 ITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLT 434

Query: 417 YFLSLQPSSDSEFFDST-VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475
           YFLSLQP SDSEFF ++ ++P QLK+K+I +ST+ VL ++ EDTPN LIYNGGG+ L +F
Sbjct: 435 YFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDF 494

Query: 476 W 476
           W
Sbjct: 495 W 495

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  496 bits (1276), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/428 (54%), Positives = 310/428 (72%), Gaps = 17/428 (3%)

Query: 66  SLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST------------- 112
           ++P+RYI+ F ++ S   ++ HK+++ E   +SV+KL     FF ST             
Sbjct: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137

Query: 113 --SAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTF 170
             S  +  + GGI   FD++GL  GY GYFT+E++  +  +P++ F+EQ+S V       
Sbjct: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197

Query: 171 QEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAV 230
           Q  APWGL RISHREK   G   +YLY+D AG+GVTSYV+DTG++++H+DFEGRA WG  
Sbjct: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257

Query: 231 IPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVK 290
           IP ND   D NGHGTHCAG I S+H+GV KN N+VAVKVLRSNG G++SDV+KG+E+  K
Sbjct: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAK 317

Query: 291 DHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSP 350
            H D            TAN+SLG  KSPA++MAVNAAV++G+HFA+AAGNE++DAC SSP
Sbjct: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377

Query: 351 AGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPH 410
           A AE ++TVGAST +DDRA+FS+WG CVD+FAPG+N+LSTYIGS  A+ +LSGTSMA+PH
Sbjct: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437

Query: 411 VAGILSYFLSLQPSSDSEFFDST--VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGG 468
           VAG+L+YFLSLQP SDSE+F +   ++P QLK+K+I +ST+ VLGD+ +DT N LI+NGG
Sbjct: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497

Query: 469 GRKLDNFW 476
           G  LD+FW
Sbjct: 498 GEGLDDFW 505

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  486 bits (1251), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 233/423 (55%), Positives = 307/423 (72%), Gaps = 11/423 (2%)

Query: 64  AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFG-- 121
           A  +P RYII F +D+S   ++ H+ ++     +++  LA +D FF +TS     +FG  
Sbjct: 94  ANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHS-EFGVK 152

Query: 122 ------GIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAP 175
                 GI   FDI G   GY GYFT+EVI  + + P+++F+E++S V   +   Q  AP
Sbjct: 153 AHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAP 212

Query: 176 WGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDND 235
           WGL RISHREK   G   +YLY+D AG+GVT+YV+DTG+++NH+DF+GRAVWG  IP +D
Sbjct: 213 WGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDD 272

Query: 236 EASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDX 295
              D NGHGTHCAG IGS H+GV KN ++VAVKVLRSNG GT+SDV+KG+EYV + H   
Sbjct: 273 PDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKA 332

Query: 296 XXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEK 355
                      TAN+SLG  KSPA+++AVNAAV++GVHFA+AAGNE++DAC +SPA AE 
Sbjct: 333 VEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAEN 392

Query: 356 SITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGIL 415
           +ITVGAST SD+RA+FS+WG CVD+F PG+NILSTYIGS  A+ +LSGTSMA PHV G+L
Sbjct: 393 AITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLL 452

Query: 416 SYFLSLQPSSDSEFFDST--VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLD 473
           +YFLSLQP +DSE+F +   ++P QLK+K+I+FST+ VL D+ EDT N LIYNGGG+ LD
Sbjct: 453 TYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLD 512

Query: 474 NFW 476
           + W
Sbjct: 513 DLW 515

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  485 bits (1248), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 308/413 (74%), Gaps = 5/413 (1%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSF 126
           +P+RYII F +D +   I+ H++ I E+Q +S+++L  D  +F S     DLQ   IDSF
Sbjct: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEG-LDLQQPIIDSF 183

Query: 127 FDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREK 186
            +IN L +GY GYFT++VI  +  +P+++F+EQ+STV +     Q  APWGL RISHRE+
Sbjct: 184 -NINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHRER 242

Query: 187 AKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTH 246
              G   +YL++D AG GVT+YV+DTG+++ H DFEGRA WG  IP+NDE  D NGHGTH
Sbjct: 243 LNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTH 302

Query: 247 CAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXX 306
           CAG I S+H+GV KN N+VAVKVLRSNG G++SDV+KG+EY    H+             
Sbjct: 303 CAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGS 362

Query: 307 TANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 366
           TAN+SLG  KSP++++AVNAAV++G+HFA+AAGNE++DAC +SPA A+ +ITVGAST SD
Sbjct: 363 TANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSD 422

Query: 367 DRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSD 426
           DRA+FS+WG CVDVFAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+LSYFLSLQP  D
Sbjct: 423 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPEQD 482

Query: 427 SEFFDST---VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           SEF  S    ++P QLK+++I++ T+ +L D+ E TPN L++NG G+ L +FW
Sbjct: 483 SEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  482 bits (1240), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 232/414 (56%), Positives = 304/414 (73%), Gaps = 7/414 (1%)

Query: 66  SLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDS 125
           + P+RYI+   + SS   I  H   I + Q +SV +LA+DD FF   SA      GGI  
Sbjct: 110 AFPHRYIVVL-KHSSPEEIALHMEAITQSQLQSVGELAQDDPFF---SAQGVRTTGGIQD 165

Query: 126 FFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHRE 185
            FD+ GL  GY GYFT+ V++ + + P++ F+E +S V  +    Q  APWGL RISHRE
Sbjct: 166 SFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRE 225

Query: 186 KAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGT 245
           +   G   +YL++D AG+GVTSYV+DTGI++ H+DFEGRA WG  IP NDE  D NGHGT
Sbjct: 226 RLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGT 285

Query: 246 HCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXX 305
           HCAG I S+H+GV K  ++VAVKVLRSNG G++SDVIKG+E+  + H             
Sbjct: 286 HCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKG 345

Query: 306 XTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFS 365
            TAN+SLG  KSPA+++AVNAAV++G+HFA+AAGNE++DAC +SPA AE+++TVGAST S
Sbjct: 346 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS 405

Query: 366 DDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSS 425
           DDRA+FS++G CVD+FAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+L+YFLSLQP S
Sbjct: 406 DDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDS 465

Query: 426 DSEFFDS---TVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           DS+FFD+    V+P+QLK+K+I +ST+ +L D+ EDTPN LIYNGGG  L  FW
Sbjct: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  486 bits (1250), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 232/413 (56%), Positives = 307/413 (74%), Gaps = 4/413 (0%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSD--LQFGGID 124
           +P RYI+ F +      ++ HK +I ++Q ES +KL KDD FF S SA  D  +  GGI 
Sbjct: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF-SASAIEDESINQGGIL 157

Query: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
           + F+I+ L  GY GYFT+EV++ +  +P+++++E++S V+ T    Q  APWGL RISHR
Sbjct: 158 TTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHR 217

Query: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244
           E+   G   +YLY+D AG+GVT YV+DTGI+  H DF  RAVWG  IP ND+  D NGHG
Sbjct: 218 ERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHG 277

Query: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
           THCAG I S H+GV KN  +VAVKVLRSNG G++SDVIKG+E+  + HI           
Sbjct: 278 THCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFK 337

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364
             TAN+SLG  KSP +++AVNAAV++G+HFA+AAGNE++DAC +SPA AE++ITVGAST 
Sbjct: 338 GSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTL 397

Query: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
           SDDRA+FS+WG CVD+FAPG+NILSTYIG  +A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 398 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPG 457

Query: 425 SDSEFFDST-VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           SDSEFFD T ++P Q+K+K+IN+S++ VL D+ E TPN+LI+NG G  LD+ W
Sbjct: 458 SDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  468 bits (1203), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 228/417 (54%), Positives = 301/417 (72%), Gaps = 8/417 (1%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF--GGID 124
           LP +YII F +  ++  I  HK +I E+Q +S S+L     FF STS   +  F  GGI 
Sbjct: 239 LPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGGII 298

Query: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
           S F+IN +  GY+GYFT+EVI  +  +P++K++E++S V+ T    Q  APWGL RISHR
Sbjct: 299 SSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHR 358

Query: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244
           E+   G   +YLY+D AG+GVT +V+DTGI++NH DF  RA+WG  IP ND+  D NGHG
Sbjct: 359 ERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHG 418

Query: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
           THCAG I S H+GV KN  +VAVKVLRSNG G++SDVIKG+E+  + H++          
Sbjct: 419 THCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLN-NEKNKKDYK 477

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364
             TAN+SLG  KSP +++AVNAAVE+G+HF++AAGNE++DAC SSPA AE +ITVGAST 
Sbjct: 478 GSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTL 537

Query: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRN-ASLSLSGTSMAAPHVAGILSYFLSLQP 423
           SDDRA+FS+WG CVDVFAPG+NILSTY+G  N  + +LSGTSMA+PHVAG+L+YFLSLQP
Sbjct: 538 SDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQP 597

Query: 424 SSDSEFF----DSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
            S S FF    D  ++P+QLK+K+I +ST  +L D+ + TPN+LIYNG G  + + W
Sbjct: 598 DSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  455 bits (1170), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 238/494 (48%), Positives = 321/494 (64%), Gaps = 23/494 (4%)

Query: 6   VLLALCAGCGVCMIIP---GLDEIVYLTESIEDFRNAKG------QEGLGQQETGNFH-- 54
           + +A  AG G  +IIP   G +E     E  +D  N +       ++G  + E   F   
Sbjct: 8   IPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDELAVFASK 67

Query: 55  -LQEPKVVYKAESLP--------YRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKD 105
             QE +  +    +P         RYII F +  + + I  H+ +I++V  + VS+L ++
Sbjct: 68  LTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEE 127

Query: 106 DAFF--VSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTV 163
            +FF  +      D   GGID  FDING+  GY+GYF  +V+  +   P+I+ +EQ+S V
Sbjct: 128 HSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVV 187

Query: 164 KVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEG 223
               +  +  APWGL RISHRE+   G   +YLY++  G GVTSYV+DTG++++H  F G
Sbjct: 188 YTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247

Query: 224 RAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIK 283
           RA WG  IP  D   D NGHGTHCAG IGS  +GV K  ++VAVKVLRSNG G++SDV+K
Sbjct: 248 RAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLK 307

Query: 284 GIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDE 343
           G+E+  +DH +            TAN+SLG  KSP+++ AVNAAV +G++FA+AAGNED+
Sbjct: 308 GVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQ 367

Query: 344 DACLSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSG 403
           DAC +SPA A   ITVGAST SDDRA+FS++G CVDVFAPG+NILSTYIGS +++ +LSG
Sbjct: 368 DACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSG 427

Query: 404 TSMAAPHVAGILSYFLSLQPSSDSEF-FDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNR 462
           TSMA+PHVAG+L+YFLSLQP SDSEF   S++SP QLK+K++ FST+ VL D+   TPN 
Sbjct: 428 TSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNL 487

Query: 463 LIYNGGGRKLDNFW 476
           LIYNGGG  L  FW
Sbjct: 488 LIYNGGGGDLSGFW 501

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  452 bits (1162), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 229/482 (47%), Positives = 322/482 (66%), Gaps = 17/482 (3%)

Query: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60
           M+LL  LL +C+     ++IP L       +SI+ F +    +  G  ++  F    P  
Sbjct: 1   MQLLIHLLLVCSTLVNALVIPSL------KDSIDKFSD----DIHGLLDSAKFSSLAPVH 50

Query: 61  VYKAESL-PYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSD 117
              AE++ P+RYII F +  S   I+ HK +I  +  +  S  + D   ++ T  + P  
Sbjct: 51  NADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPES 110

Query: 118 LQ--FGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAP 175
           ++   GGI S FDI+ L  GY  Y ++E++  +  +P+I FIE ++ V  T+   Q  AP
Sbjct: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170

Query: 176 WGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDND 235
           WGL RISHRE        +YLY+D AG+ V +YV+DTG+D+NH +F  RA WG  IP ND
Sbjct: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230

Query: 236 EASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDX 295
           +  D NGHGTH AG IGS+H+GV K+ N++AVKVLRSNG G++SDV+KG+E+ V  H++ 
Sbjct: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE- 289

Query: 296 XXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEK 355
                       AN+SLG  KSPA+++AVNAAV++G+HFA+AAGNE+++AC SSPA AE+
Sbjct: 290 RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349

Query: 356 SITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSR-NASLSLSGTSMAAPHVAGI 414
           ++TVGAST SD+RA+FS+WG CVD+FAPG+NILSTYIG+  + + +LSGTSMA+PHVAG+
Sbjct: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409

Query: 415 LSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDN 474
           L+Y+LSLQP   SEF    +S  QLK+K+I ++T+ VL D+ E TPN LIYNGGG+ L +
Sbjct: 410 LAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSD 469

Query: 475 FW 476
           FW
Sbjct: 470 FW 471

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  449 bits (1154), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 221/415 (53%), Positives = 295/415 (71%), Gaps = 7/415 (1%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSF 126
           +P++YI+   +  S  ++ +    +      ++  L K+  FF   +A   L  GGI   
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEG-LPRGGIKDL 60

Query: 127 FDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREK 186
           F+IN LF+G  GYF E V+K + +  I++F+E++S V  +N   Q  APWGL RISHR++
Sbjct: 61  FNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDR 120

Query: 187 AKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTH 246
              G   +YLY++A G GVT+YV+DTGI++ H +F+GRA WG  IP ND   D NGHGTH
Sbjct: 121 LNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTH 180

Query: 247 CAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXX 306
           CAG I S+H+G+ K  N+VAVKVL+S+G GT+SDVIKG+EY  + H+             
Sbjct: 181 CAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHL-KESKNNKKFKGS 239

Query: 307 TANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 366
           TAN+SLG  KSPA++MAVNAAV +G+HFA+AAGNE++DAC +SPA AEK+ITVGAST SD
Sbjct: 240 TANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSD 299

Query: 367 DRAFFSDWGTCVDVFAPGVNILSTYIGSRN-ASLSLSGTSMAAPHVAGILSYFLSLQPSS 425
           DRA+FS+WG CVD+FAPG+NILSTYIG  N  + SLSGTSMA+PHVAG+L+YFLSLQP S
Sbjct: 300 DRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDS 359

Query: 426 DSEFFDST---VSPQQLKEKIINFSTQGVLGDVGE-DTPNRLIYNGGGRKLDNFW 476
           DSEF+D++   V+P QLK+K+I +ST+ VL D+ + D+PN LIYNG G  L  FW
Sbjct: 360 DSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  451 bits (1159), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 297/421 (70%), Gaps = 10/421 (2%)

Query: 65  ESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFG--- 121
            ++P++YI+ F E  S      H  +++    ESV++L +  AFF ST   ++ +FG   
Sbjct: 69  RAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENN-EFGIAA 127

Query: 122 -----GIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPW 176
                GI+  F +    RGY GYFTE+++  +  +P + F+E++S V  ++ T Q  APW
Sbjct: 128 TRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPW 187

Query: 177 GLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDE 236
           GL R+SHREK   G   +YLY+D +G GVTSYV+DTGI+I+H DFE RA+WG  IP+ND 
Sbjct: 188 GLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA 247

Query: 237 ASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXX 296
             D NGHGTHCAG I S+ +GV K  N+VAVKVLRSNG G++SDV++G+EY VK H    
Sbjct: 248 DYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAA 307

Query: 297 XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356
                     TAN+SLG  +S A+++AV+AAV++G+HFA+AAGNE++DAC +SPA ++K+
Sbjct: 308 EKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKA 367

Query: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILS 416
           ITVGAST +DDRA+FS+WG CVD+FAPG+NILSTYIGS  A  +LSGTSMA+PHVAG+L+
Sbjct: 368 ITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLT 427

Query: 417 YFLSLQPSSDSEFFDS-TVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475
           YFLSLQP  DSEF +  T+SP+ LK+K+I+F T+  L  +   T N LIYNGGG  L +F
Sbjct: 428 YFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487

Query: 476 W 476
           W
Sbjct: 488 W 488

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  452 bits (1163), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 221/418 (52%), Positives = 294/418 (70%), Gaps = 14/418 (3%)

Query: 62  YKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFG 121
           Y+   +P +YII F +D SV+ ++ HK +I   Q +  S         VS    S +  G
Sbjct: 227 YENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYAS---------VSDETSSSI-LG 276

Query: 122 GIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRI 181
           GI+  F++  LF GY G+F E++++ +   PI+ F+EQ+S V       Q  APWGL RI
Sbjct: 277 GIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARI 336

Query: 182 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLN 241
           SHR+    G   +YLY+D AG GVT+YV+DTGI+I H++F GRAVWG  IP+ND+  D N
Sbjct: 337 SHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGN 396

Query: 242 GHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXX 301
           GHGTHCAG I S+++GV KN  +VAVKVLRS+G GT+SDV+KG+EY    H         
Sbjct: 397 GHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKK 456

Query: 302 XXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 361
                TAN+SLG  KS ++++AV+AAV+SG+HFA+AAGNE++DAC SSPA +E +ITVGA
Sbjct: 457 GFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGA 516

Query: 362 STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421
           ST SDDRA+FS+WG CVDVFAPG+NILSTYIGS  A+ +LSGTSMA+PHVAG+LSYFLS+
Sbjct: 517 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSM 576

Query: 422 QPSSDSEFFDS---TVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           QP +DSEFF S   ++SP QLK+K+I +ST+ +  D+ E TPN L+YN  G  + +FW
Sbjct: 577 QPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  438 bits (1127), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/420 (50%), Positives = 296/420 (70%), Gaps = 9/420 (2%)

Query: 64  AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF--- 120
           + ++P+RYI+ F +  +   +  H+ ++     E++++L    +FF +T           
Sbjct: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165

Query: 121 ---GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWG 177
              GGI+  F+I G  RGY GYFT+ ++  + +  ++K IEQ+S V  ++   Q  APWG
Sbjct: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225

Query: 178 LHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEA 237
           L R+SHRE+   G   +YLY+D AG+GVT+YV+DTGI+I+H +FEGRA WG  IP ND  
Sbjct: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285

Query: 238 SDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXX 297
            D NGHGTHCAG I S+ +GV KN  +VAVKVLR+NG GT+SDV++G+EYVV +H     
Sbjct: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH--RKA 343

Query: 298 XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSI 357
                    TAN+SLG  KS A+E+AV+AAV +G+HFA+AAGNE++DAC +SPA ++K I
Sbjct: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 358 TVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSY 417
           TV AST SDDRA+FS+WG+CVD+FAPG+NILSTYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 418 FLSLQPSSDSEFFD-STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           FLSLQP S SE++  S++SP+ LK+KI+ + ++ +L +V   T N LI+NGGG  LD+FW
Sbjct: 464 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  437 bits (1123), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/413 (51%), Positives = 287/413 (69%), Gaps = 24/413 (5%)

Query: 70  RYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGI-----D 124
           +YII F E  +   I +HK+++Q+V  E+                 SD+   GI     D
Sbjct: 97  KYIILFKEGVTAEQISAHKQLLQQVLLET-----------------SDVSAQGIVADVLD 139

Query: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
           SF D+ G+  GY    +  V++ V + P ++ +EQ+S V       Q  APWGL RISHR
Sbjct: 140 SF-DLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHR 198

Query: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244
           +    G   +YLY+DAAG GV SY++DTGI++ H++FEGRA WG  IPDND   D NGHG
Sbjct: 199 DPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHG 258

Query: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
           THCAG I S+H+GV K  N++AVKVLRSNG G++SDVI G+E+  K H            
Sbjct: 259 THCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFK 318

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364
             TAN+SLG  KSP+++  V+AAV+ G+HF++AAGNE++DAC +SPA +E++ITVGAST 
Sbjct: 319 GSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTL 378

Query: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
           SDDRA+FS+WG+CVD+FAPG+NILSTY GS +A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 379 SDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPE 438

Query: 425 SDSEFFDST-VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
             S+F  S  ++P+QLK+K++++ST+GVL D+ EDTPN LIYNGGG  L +FW
Sbjct: 439 KSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFW 491

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  431 bits (1107), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 289/421 (68%), Gaps = 9/421 (2%)

Query: 63  KAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF-VSTSAP--SDLQ 119
            +E +PY YI+ F+E  +   I  H   + ++Q +SV+ L  D  FF +STS+   S+  
Sbjct: 31  NSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGL 90

Query: 120 FGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLH 179
            GG+   F I     GYTG FT+EV++ +   P++KFIE++S V  T +T Q  APWGL 
Sbjct: 91  LGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLA 150

Query: 180 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASD 239
           RISHR +       +YLY+D  G+GV +YV+DTGI+I + DF GRA WG  IP  +   D
Sbjct: 151 RISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVD 210

Query: 240 LNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXX 299
            NGHGTH AG I S H+GV K   + AVKVLRSNG G++SDV+KG+EYVV  H       
Sbjct: 211 GNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAH--QRDVG 268

Query: 300 XXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITV 359
                   AN+SLG  KS ++++AVNAAV +GVHFA+AAGNE++DAC +SPA AE++ITV
Sbjct: 269 TAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITV 328

Query: 360 GASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFL 419
           GAST SD RA+FS+WG CV +FAPG+NILSTYIGS +A+ +LSGTSMA+PH+AG+++YFL
Sbjct: 329 GASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFL 388

Query: 420 SLQPSSDSEFFD----STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475
           SLQP+  S+F+     + ++P QLK+KI+ F T+  L D+  +TPN + YNG G+ L++F
Sbjct: 389 SLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDF 448

Query: 476 W 476
           W
Sbjct: 449 W 449

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  396 bits (1018), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 205/408 (50%), Positives = 267/408 (65%), Gaps = 18/408 (4%)

Query: 70  RYIIAFHEDSSVRSIESH-KRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSFFD 128
           +YI+ F   + +   E H K++   ++  S     KDD         S+L      + F 
Sbjct: 63  QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDH-------KSNL------NIFK 109

Query: 129 INGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAK 188
           I     GY      E ++ + QDPI++ IE +S V       QE+ PWGL RIS R + +
Sbjct: 110 IGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVR 169

Query: 189 YGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTHCA 248
            GQD  Y Y+DA    VT+YVLDTGI I+HE F GRA WG  I  ND   D +GHGTH A
Sbjct: 170 IGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVA 229

Query: 249 GIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTA 308
           GII S  FGV K   +VAVKVLRSNGEG +SDV+KGIE+VV DH                
Sbjct: 230 GIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH----SKNKNYSKGSVV 285

Query: 309 NLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR 368
           NLSLG+SKSPA+ +A++AA+   +HFA+AAGNE+ DAC +SPA A ++ITVGAS FSD+R
Sbjct: 286 NLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDER 345

Query: 369 AFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSE 428
           AFFS+WG CVDVFAPG+N++STYIGS NA+LSLSGTS AAP+ AG+++Y+LSLQP  DS 
Sbjct: 346 AFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSG 405

Query: 429 FFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           +F   ++P +LKEKI+ F ++ VL ++ E+TPN +IYNG GR L +FW
Sbjct: 406 YFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  400 bits (1029), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 209/417 (50%), Positives = 285/417 (68%), Gaps = 17/417 (4%)

Query: 70  RYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDD--AFFVSTSAPSDLQFGGIDSFF 127
           RYII F +      ++ H +M+  +      +L+++   A     SA  D  F  +   F
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQRPAAAPGASALRD-GFDRVMDTF 189

Query: 128 DINGLFRGYTGYF-TEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREK 186
           ++ G F GY     + +++  +  +P++ ++E++S V   + T Q  APWGL RISHRE 
Sbjct: 190 EVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDET-QNNAPWGLARISHREG 248

Query: 187 AKYGQDLEYLY-EDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGT 245
              G   +YLY  ++AG+GVT+YV+DTGI ++H +F  RA WG  IP ND   D NGHGT
Sbjct: 249 LNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGT 308

Query: 246 HCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHI----DXXXXXXX 301
           HCAG IGS H+GV K  NLVAVKVLRS+G GT+SDV+KG+E+V  +H     +       
Sbjct: 309 HCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNS 368

Query: 302 XXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 361
                TAN+SLG  KSPA++ AVNAAV++GVHFA+AAGNE++DAC SSPA AE +ITVGA
Sbjct: 369 NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA 428

Query: 362 STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421
           ST SDDRA+FS++G CVD+FAPG+NILSTYIG+ +A+ +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 429 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488

Query: 422 QPSSDSEFF--DSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           QP   SEF+  +S ++P Q+K+KII+++T+  L D+  DTPN+LIYNGG    D FW
Sbjct: 489 QPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FW 544

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  394 bits (1013), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/413 (48%), Positives = 273/413 (66%), Gaps = 6/413 (1%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFG-GIDS 125
           +P RYI+ F +  + + I+SH   I+E+ + S+    +D  F  +T        G G+  
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGIGLQH 131

Query: 126 FFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHRE 185
            F I     GY GYFTE   K +   P+++ +E +S V++ N   QE  PWGL RIS RE
Sbjct: 132 EFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQRE 191

Query: 186 KAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGT 245
           K        Y Y+D  G+   ++V+DTGI ++HEDFEGRA WG  I +ND   DLNGHGT
Sbjct: 192 KLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGT 251

Query: 246 HCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXX 305
           HCAG I S+H+G+ K   ++AVKVLRS+G G++SDVI+G+EY V+ + D           
Sbjct: 252 HCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKTKSNLKG 310

Query: 306 XTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFS 365
              N+SLG+ KS A+  A++AA  +G+ FA+AAGNE +DAC SSPA A   ITVG ST S
Sbjct: 311 AAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGSTLS 370

Query: 366 DDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSS 425
           DD AFFS++G CVD+FAPGVNI+STYIGS+NA+ SLSGTSM++PHVAG+L+Y+LSLQP  
Sbjct: 371 DDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDH 430

Query: 426 DSEFF--DSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
            S+F+   S +SP+ LK+K++N++T G L  +  +T N L+YNGGG+ L  FW
Sbjct: 431 KSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  388 bits (997), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 276/423 (65%), Gaps = 25/423 (5%)

Query: 60  VVYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQ 119
           + + A  +P +YI+ F  D++    E+H              LA  +++ ++T    D Q
Sbjct: 46  IHHAASPIPNQYIVLFKSDTTDIQRETH--------------LATLNSWLLNT----DPQ 87

Query: 120 FGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLH 179
           +  + SF   + L +GYT    E++I+ +  DPII+ IEQ+S V       Q ++PWGL 
Sbjct: 88  YTILHSFQLAHDL-QGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLA 146

Query: 180 RISHREKAKYGQDLEYLYEDA-AGRGVTSYVLDTGIDINHEDFEGRAVWGAVI-PDNDEA 237
           RIS RE+ K  QD  Y Y+D+ A      Y+LDTGI+ NH +F+GRA WGAV  P     
Sbjct: 147 RISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQ 206

Query: 238 SDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDH-IDXX 296
            D NGHGTHCAG+IGS  +GV KNT L+AVKVL + G+G +S VI+GIEYV + H  D  
Sbjct: 207 EDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMK 266

Query: 297 XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356
                       NLSLG+ KSPA+   + AAV+ GVHFA+AAGNED+DAC +SPA +  +
Sbjct: 267 KQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHA 326

Query: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSR-NASLSLSGTSMAAPHVAGIL 415
           +TVGAS+FSDDR FFS+WG CVDVFAPG+NI+STYIG   N + SLSGTSM+AP V G++
Sbjct: 327 LTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLI 386

Query: 416 SYFLSLQPSSDSEFFDSTVSPQ--QLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLD 473
           +YFLSLQP + S+F+    SP   QLK KII+FST+GVL ++ E TPNR++YNGGG  L 
Sbjct: 387 AYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLK 446

Query: 474 NFW 476
           +FW
Sbjct: 447 DFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  349 bits (895), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/421 (46%), Positives = 268/421 (63%), Gaps = 19/421 (4%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSF 126
           +P +YI+ F  D++   I   ++ +  +  E   K   +D +   +   S  Q       
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY---SKVLSRFQISN---- 115

Query: 127 FDINGLF-RGYTGYFTEEVIKRVLQ-DPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
            D  G+  R     F E+V   +     IIK IE++S V +   T Q ++ WGL RIS R
Sbjct: 116 -DTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQR 174

Query: 185 EKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEA-SDLNG 242
              K  QD  Y Y+D  +G+GV  Y+LDTGI+ NH +FEGRA WG  +P  + +  D NG
Sbjct: 175 NHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNG 234

Query: 243 HGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDH------IDXX 296
           HGTHCAGIIGS+ +GV K TNL+AVKVL   G+G++SDVI G+E+V   H      I   
Sbjct: 235 HGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSS 294

Query: 297 XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356
                       NLSLG+ KSP++++A+ +A + G+H  +AAGNEDEDAC++SPA +   
Sbjct: 295 SSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAV 354

Query: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIG-SRNASLSLSGTSMAAPHVAGIL 415
           ITVGAS+FSDDRAFFS+WG CVDVFAPG+NI STYIG + N +LSLSG+SM++P V+G+ 
Sbjct: 355 ITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLT 414

Query: 416 SYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475
           +Y+LSLQP   S+F DS ++P QLK KII+FST G+L ++  DT N+L+YNGGG+ L  F
Sbjct: 415 AYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGF 474

Query: 476 W 476
           W
Sbjct: 475 W 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  346 bits (887), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 228/322 (70%), Gaps = 5/322 (1%)

Query: 148 VLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYED-AAGRGVT 206
           +LQ P ++ +E  S V   N T QE+ PWGL R+S R++ + G +  Y Y+   + + V 
Sbjct: 99  LLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVN 158

Query: 207 SYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVA 266
            Y+LDTGI ++HE+FEGRA WG  I  ND   D NGHGTHCAGI+G   +GV K  NL+A
Sbjct: 159 VYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIA 218

Query: 267 VKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNA 326
           VKVL + G+G +SDVI+GIE+ V +H+               NLSLG+ +SPA++  V A
Sbjct: 219 VKVLHATGDGEMSDVIRGIEFAVNEHL---TRNQDEVRGSIINLSLGAGESPALQRVVTA 275

Query: 327 AVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVN 386
           A+  GVHFA+AAGNED++AC SSPA  +  +TVG STFSDDRAFFS+WG C+DVFAPGVN
Sbjct: 276 ALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVN 335

Query: 387 ILSTYIG-SRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIIN 445
           + S+Y+G ++N +LSLSGTS +APHVAG+++Y LSL+P + S+F  +  +P QLK+K+++
Sbjct: 336 VKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQLKQKLVS 395

Query: 446 FSTQGVLGDVGEDTPNRLIYNG 467
            +T+G L +V +DT N +I+NG
Sbjct: 396 LATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  265 bits (676), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 146/416 (35%), Positives = 232/416 (55%), Gaps = 9/416 (2%)

Query: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAP--SDLQFGGID 124
           +PYRYI+ F   +    I+ H + + ++Q      LA +D FF  T     S  + GG+ 
Sbjct: 69  VPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFSTEELGGVL 128

Query: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184
             FDI   F GY GYFT+EV++ + +  I+ ++E +S + + +      + W L RISHR
Sbjct: 129 YTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLARISHR 188

Query: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244
            K       EY ++   G+ + +Y+LDTG+   H  +  R + G VI  N++  D+NGHG
Sbjct: 189 PKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDMNGHG 248

Query: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
           T  AG++G R  GV +   L+ VKVL   G GTVS++IKG+ +V  +H            
Sbjct: 249 TEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFV--NHHHPQRIEKNGVL 306

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364
                 S+  +KS ++  A +  V SG+H  + AG +  +AC SSPA + K ITV   + 
Sbjct: 307 GAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVAGMSI 366

Query: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIG-SRNA---SLSLSGTSMAAPHVAGILSYFLS 420
           +D+     +WG+CVD++ PG  + +TY    RN     +S++G+S AA  VAG+L+YF S
Sbjct: 367 TDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLAYFAS 426

Query: 421 LQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476
           LQP   +      ++P++LKE++I+F T+G L ++   +PN + +NG G  LD+F+
Sbjct: 427 LQPGLGTPDV-IPLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDSFF 481

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  212 bits (540), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 145/394 (36%), Positives = 203/394 (51%), Gaps = 59/394 (14%)

Query: 109 FVSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNS 168
           FVST       FG           F G+T  F ++ ++++ ++P++  +   S   V + 
Sbjct: 47  FVSTRISKTFSFGK----------FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQ 96

Query: 169 T------------FQEEAPWGLHRISHREKAKYG------QDLEYLYEDA-AGRGVTSYV 209
                         QE+AP  L R+S R    Y       Q+  Y Y+    G  V +Y+
Sbjct: 97  KEQIAEEYSRRYKVQEDAPRHLARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYI 156

Query: 210 LDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKV 269
           +DTGI   H+D  GRA +GA +   +   D NGHGTH AGI+GSR FGV K  NLV VK 
Sbjct: 157 IDTGIYKQHKDLGGRAYFGADMV-GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKA 215

Query: 270 LRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVE 329
           L + G+G ++ VI  IE+ V +H               ANLSLGS ++  +  AV AAVE
Sbjct: 216 LNAKGQGNLTSVISSIEFSV-NHCK------KSGMLCVANLSLGSLRNTVLNQAVEAAVE 268

Query: 330 SGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGV 385
           SG+   +AAGN + +AC +SPA A  +ITVGA    DDR    A FS+WG CVDVFA GV
Sbjct: 269 SGLVVVVAAGNSNVNACWNSPASAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGV 325

Query: 386 NILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIIN 445
            ++S         ++ SGTSMA+P VAG+ +  L           DS + P  +K+KII+
Sbjct: 326 KVMSLSNMPPFKPVAYSGTSMASPSVAGLAAVLL-----------DSGIDPPDIKQKIID 374

Query: 446 FSTQGVLGD----VGEDTPNRLIYNGGGRKLDNF 475
            +T+ V           TPNR+ +NG  ++ D F
Sbjct: 375 LATENVFQKRTLVFKPGTPNRIAFNGVRKEDDIF 408

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  207 bits (527), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 150/414 (36%), Positives = 210/414 (50%), Gaps = 59/414 (14%)

Query: 97  ESVSKLAKDDAF--FVSTSAPSDLQF--GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDP 152
           E + +     AF  F STS  S  QF    I+  F I G FRG T   ++ ++ ++ + P
Sbjct: 59  EYLVRFKNPTAFQQFTSTSNRSWRQFIDHRIEKKFSI-GSFRGVTMNLSKNLVNKLKKSP 117

Query: 153 II-------KFIEQESTVKVT------------------NSTFQEEAPWGLHRISHR--- 184
           +I       KF   ++  +++                  N T+Q +AP  L RIS     
Sbjct: 118 LIADIVPNFKFEAFDTDAELSYMFNTTAKYAYQDIDEAQNVTYQPDAPRHLARISRHHQL 177

Query: 185 -----EKAKYGQDLEYLYEDA-AGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238
                +K +Y     Y YED   G+GV +Y++DTGI   H +FE R + G  +   +   
Sbjct: 178 PFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEFEDRVIQGVDL-TKEGFG 236

Query: 239 DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXX 298
           D NGHGTH AG++GSR FG  K  +LV VKVL  +G G  S+V+ G+E++V+        
Sbjct: 237 DENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNVLSGLEFIVE---HCTKV 293

Query: 299 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358
                    ANLSLGS +SP + MAV  A+E G+ F  AAGN + DA  +SPA AE  IT
Sbjct: 294 SRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVIT 353

Query: 359 VGA-STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSY 417
           VGA     D  A FS+WG CV++FAPGV I S    + N SL LSGTSM+ P V G+ + 
Sbjct: 354 VGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDNESLVLSGTSMSTPIVTGVAAV 413

Query: 418 FLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD----VGEDTPNRLIYNG 467
            LS             + P+ + ++I   ST+ V           TPN+++YNG
Sbjct: 414 LLS-----------KGIEPELIAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNG 456

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  200 bits (509), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 147/418 (35%), Positives = 206/418 (49%), Gaps = 63/418 (15%)

Query: 97  ESVSKLAKDDAF--FVSTSAPSDLQF--GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDP 152
           E + +     AF  F S S  S  QF    I+  F I G FRG T   ++ ++ ++ + P
Sbjct: 19  EYLVRFKNPTAFQQFTSNSNRSWRQFIDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSP 77

Query: 153 IIKFI-----------------EQESTVKVT------------NSTFQEEAPWGLHRISH 183
           ++  I                 E   T   T            N T+Q +AP  L RIS 
Sbjct: 78  LVADIVPNFRFEAFEGDSVNSAESSYTFNATAKYSYEDVEEEQNITYQPDAPRHLARISR 137

Query: 184 R--------EKAKYGQDLEYLYE-DAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDN 234
                    +K +Y     Y YE D  G+ V +Y++DTGI  +H +FE R + G  +   
Sbjct: 138 HYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEFEDRVIQGIDL-TK 196

Query: 235 DEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHID 294
           +   D NGHGTH AG++GS+ +G  K  NLV VKVL  +G G  S+V+ G+E++V+    
Sbjct: 197 EGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNVLSGLEFIVE---H 253

Query: 295 XXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAE 354
                        ANLSLGS +SP + MAV  A+E G+ F  AAGN + DA  +SPA AE
Sbjct: 254 CTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAE 313

Query: 355 KSITVGA-STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAG 413
             ITVGA     D  A FS+WG CV++FAPGV I S    + N +L LSGTSM+ P V G
Sbjct: 314 NVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLILSGTSMSTPIVTG 373

Query: 414 ILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD----VGEDTPNRLIYNG 467
           + +  LS             + P+ + ++I   ST+ V           TPN+++YNG
Sbjct: 374 VAAILLS-----------KGIEPEMIAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNG 420

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  200 bits (509), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 144/412 (34%), Positives = 206/412 (50%), Gaps = 61/412 (14%)

Query: 109 FVSTSAPSDLQF--GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPII------------ 154
           F S S  S  QF    I+  F I G FRG T   ++ ++ ++ + P++            
Sbjct: 33  FTSNSNRSWRQFIDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAF 91

Query: 155 -----KFIEQESTVKVT------------NSTFQEEAPWGLHRISHR--------EKAKY 189
                + +E   T   T            N T+Q +AP  L RIS          +K +Y
Sbjct: 92  ENDSARDVEYNYTFNATAKYSYENLDEEQNITYQSDAPRHLARISRHYQLPFDIEDKERY 151

Query: 190 GQDLEYLYED-AAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTHCA 248
                Y YED   G+ V +Y++DTGI  +H +FE R + G  +   +   D NGHGTH A
Sbjct: 152 KSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEFEDRVIQGIDLT-KEGFGDQNGHGTHVA 210

Query: 249 GIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTA 308
           G++GS+ +G  K  NLV VKVL  +G G  S+V+ G+E++V +H               A
Sbjct: 211 GLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHC--TRVSRPQGKKCVA 267

Query: 309 NLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDD 367
           NLSLGS +SP + MAV  A+E G+ F  AAGN + DA  +SPA AE  ITVGA     D 
Sbjct: 268 NLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDT 327

Query: 368 RAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDS 427
            A FS+WG CV++FAPGV I S    + N +L LSGTSM+ P V G+ +  LS       
Sbjct: 328 IAKFSNWGPCVNIFAPGVEIESLSHLNFNDTLVLSGTSMSTPIVTGVAAVLLS------- 380

Query: 428 EFFDSTVSPQQLKEKIINFSTQGVLGD----VGEDTPNRLIYNGGGRKLDNF 475
                 + P+ + +++   ST+ V           TPN+++YNG  +  D +
Sbjct: 381 ----KGIEPEMIAQELEYLSTRNVFHRRTLFFKPSTPNQILYNGVDKLDDRY 428

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  199 bits (505), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/389 (33%), Positives = 198/389 (50%), Gaps = 65/389 (16%)

Query: 131 GLFRGYTGYFTEEVIKRVLQDPI-------IKF--------------------IEQESTV 163
           G FRG T   +++V++++  +P+       I+F                    ++ E   
Sbjct: 59  GSFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGF 118

Query: 164 KVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDA---------AGRGVTSYVLDTGI 214
                  Q EAP  L R+S R    Y  D E  YE++          GR + +Y++DTGI
Sbjct: 119 NPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGI 178

Query: 215 DINHEDFEGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNG 274
              H+DF GRA++G      +   D NGHGTH AGI+GS +FGV K  NL+ VK L + G
Sbjct: 179 YKEHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRG 237

Query: 275 EGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHF 334
           +G ++ VI  +E+ V +H               ANLSLG+ ++  +  A+ AA E+G+  
Sbjct: 238 QGNLTTVISAVEFAV-NHC-----KSSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLII 291

Query: 335 AIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILST 390
            +AAGN + +AC +SPA A ++ITVGA    DDR    A FS+WG CVD+FA GV + S 
Sbjct: 292 VVAAGNSNINACWNSPASAPEAITVGA---FDDRTDTIAKFSNWGPCVDIFASGVKVKSL 348

Query: 391 YIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQG 450
                +  ++ SGTSMA+P V G+++  L           D  V P+ +K K++  +T  
Sbjct: 349 SAFPPHKPIAFSGTSMASPSVTGLVAILL-----------DKGVEPENIKAKLVELATHD 397

Query: 451 VLGD----VGEDTPNRLIYNGGGRKLDNF 475
           +L          TPNR+ +NG  R+ D +
Sbjct: 398 LLQRRTLFFKPGTPNRIAFNGMEREDDEY 426

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  194 bits (492), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 176/316 (55%), Gaps = 37/316 (11%)

Query: 171 QEEAPWGLHRISHR--------EKAKYGQDLEYLYEDA-AGRGVTSYVLDTGIDINHEDF 221
           Q  AP  L RIS R         + ++ + + Y YED   G  + +Y+LDTGI   H DF
Sbjct: 154 QYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDF 213

Query: 222 EGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDV 281
           E R + GA +   +   D NGHGTH AGI+GS+ FGV KN  LV VKVL   G G ++ V
Sbjct: 214 ENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTTV 272

Query: 282 IKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNE 341
           + GI++ V DH               AN+SLG+ ++  +  A++ A ++G+   +AAGN 
Sbjct: 273 LSGIQFAV-DHC--RLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNS 329

Query: 342 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNI--LSTYIGSR 395
           +  AC +SPA A+ +ITVGA    DDR    A+FS+WG CVD+FAPGV I  LS    S 
Sbjct: 330 NVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESH 386

Query: 396 NASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDV 455
           +  ++ SGTSMA+P VAG+ +  L           D  V P  +K+K+++ ST+ V   +
Sbjct: 387 HKHVTHSGTSMASPVVAGLAAILL-----------DKGVEPFDVKDKLLHLSTKDVFNKL 435

Query: 456 ----GEDTPNRLIYNG 467
                  TPN++ YNG
Sbjct: 436 TLFFKYGTPNKIAYNG 451

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  193 bits (490), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/314 (39%), Positives = 172/314 (54%), Gaps = 39/314 (12%)

Query: 171 QEEAPWGLHRISHREKAKY--------GQDLEYLYEDA-AGRGVTSYVLDTGIDINHEDF 221
           Q++AP  L RIS R    Y          +  Y Y+D  +G  V +YV+DTGI   H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 222 EGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDV 281
           EGRA +GA +   +   D NGHGTH AG+IGSR FGV K+ +L+ VK L + G+G ++ V
Sbjct: 195 EGRAKFGADLV-GEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 282 IKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNE 341
           I  IE+ V +H               ANLSLGS ++  +  AV AA+E+GV   +AAGN 
Sbjct: 254 ISAIEFTV-NHC------RKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 342 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNA 397
           + +AC SSPA +  +ITVGA    DDR    A FS+WG CVD+FAPGV I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 398 SLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD--- 454
            ++ SGTSMA+P V+G+++  L           DS + P  +K ++I+ +T  V      
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL-----------DSGIHPFDIKTELIDLATDSVFHKRTL 412

Query: 455 -VGEDTPNRLIYNG 467
                TPNR+ + G
Sbjct: 413 LFKPGTPNRVAFTG 426

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  193 bits (490), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 128/381 (33%), Positives = 196/381 (51%), Gaps = 61/381 (16%)

Query: 131 GLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEE----------------- 173
           G F+G+T   T+++++ + ++P++  +     V        EE                 
Sbjct: 65  GSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKC 124

Query: 174 -------APWGLHRISHR--------EKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDIN 217
                  AP  L R+S R        +K  Y   L+Y Y+  + G  V +Y++D+GI + 
Sbjct: 125 SVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLE 184

Query: 218 HEDFEGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGT 277
           HE+F GRA+ G  +   + + D NGHGTH AGI+GS+ +GV K   L+ +KVL   G+G+
Sbjct: 185 HEEFNGRAIPGIDLT-GEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGS 243

Query: 278 VSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIA 337
           ++ V+ GIE+ VK                 ANLSLGS ++  +  A+ AA+++G+   +A
Sbjct: 244 LAMVLGGIEFAVK-----HCQETSKKGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVA 298

Query: 338 AGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIG 393
           AGN + +AC  SPA A ++ITVGA    DDR    A FS+WG C+D+FAPGV I S  I 
Sbjct: 299 AGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIF 355

Query: 394 SRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLG 453
                ++ SGTSMA+P VAG+ +  L           D  VS +++K+ I+   T  V  
Sbjct: 356 KDKEDVTYSGTSMASPTVAGLAALTL-----------DQGVSAEEVKDYILEMGTDNVFH 404

Query: 454 D----VGEDTPNRLIYNGGGR 470
                    TPN++ +NG  R
Sbjct: 405 RRSLLFKPGTPNKICFNGVKR 425

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  191 bits (486), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 134/402 (33%), Positives = 200/402 (49%), Gaps = 60/402 (14%)

Query: 109 FVSTSAPSDLQF---GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVK- 164
           F+++    DL++   G I+  F I G  +G T   + +V+ ++ + P +K +     VK 
Sbjct: 35  FMNSVLSKDLKWFMGGKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKA 93

Query: 165 -----------VTNSTFQEEAPWGLHRISHR--------EKAKYGQDLEYLYED-AAGRG 204
                      +     Q  AP  L RIS R         K +Y     Y Y+  A G  
Sbjct: 94  FEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGAT 153

Query: 205 VTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNL 264
             +Y+LDTG+  +H++FE R  +G       E  DLNGHGTH AG++GS+ FGV K+  L
Sbjct: 154 TRAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVGSKTFGVAKHVQL 212

Query: 265 VAVKVLRSNGEGTVSDVIKGIEYVVKD---HIDXXXXXXXXXXXXTANLSLGSSKSPAME 321
           V VK L + G GT+  ++  +E+ V+D   H D              N+SLGS KS  + 
Sbjct: 213 VDVKCLDALGAGTLVSILSALEFAVQDCQEHED---------SQCVLNMSLGSVKSNILN 263

Query: 322 MAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTC 377
            A+N   + G+   +AAGN + +AC +SP+ A  +ITVGA    DDR    A FS+WG C
Sbjct: 264 QAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPC 320

Query: 378 VDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQ 437
           VD+FAPGVN+ S       + +  SGTSMA+P V G+++  L           D  V P+
Sbjct: 321 VDIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLL-----------DDGVPPE 369

Query: 438 QLKEKIINFSTQGVLGD----VGEDTPNRLIYNGGGRKLDNF 475
            +++ +   +T GV           TPN ++YNG  +  D +
Sbjct: 370 DIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNGNKKHDDEY 411

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  191 bits (486), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 145/418 (34%), Positives = 203/418 (48%), Gaps = 63/418 (15%)

Query: 97  ESVSKLAKDDAF--FVSTSAPSDLQF--GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDP 152
           E + +     AF  F S S  S  QF    I+  F I G FRG T   ++ ++ ++ + P
Sbjct: 68  EYLVRFKNPTAFQQFTSNSNRSWRQFIDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSP 126

Query: 153 IIKFI-----------------EQESTVKVT------------NSTFQEEAPWGLHRISH 183
           ++  I                 E   T   T            N T+Q +AP  L RIS 
Sbjct: 127 LVADIVPNFRFEAFENDGTNDAELNYTFNATAKYLYEDIDEAQNITYQSDAPRHLARISR 186

Query: 184 R--------EKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDN 234
                    +K +Y     Y YED   G+ V +Y++DTGI  +H +FE R + G  +   
Sbjct: 187 HYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHPEFEDRVIQGIDL-TK 245

Query: 235 DEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHID 294
           +   D NGHGTH AG++GS+ +G  K  NLV VKVL  +G G  S+V+ G+E++V+    
Sbjct: 246 EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNVLSGLEFIVE---H 302

Query: 295 XXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAE 354
                        ANLSLGS +SP + MAV  A+E G+ F  AAGN + DA  +SPA AE
Sbjct: 303 CTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAE 362

Query: 355 KSITVGA-STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAG 413
             ITVGA     D  A FS+WG CV++FAPGV I S    +   +L LSGTSM+ P V G
Sbjct: 363 NVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYEDTLILSGTSMSTPIVTG 422

Query: 414 ILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD----VGEDTPNRLIYNG 467
           + +  LS             + P  + ++I   ST+ V           T N+++YNG
Sbjct: 423 VAAVLLS-----------KGIEPALIAQEIEYLSTRNVFHRRTLFFKPSTANQILYNG 469

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  189 bits (481), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/380 (34%), Positives = 199/380 (52%), Gaps = 60/380 (15%)

Query: 131 GLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKV--TNSTF------------QEEAPW 176
           G FR        ++I+++ ++P I  I     V     +ST+            Q EAP 
Sbjct: 61  GAFRALVIDLPNDMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPR 120

Query: 177 GLHRISHREKA--------KYGQDLEYLYEDAA--GRGVTSYVLDTGIDINHEDFEGRAV 226
            L R+S R +         +Y    +Y Y DA   G  V +Y++DTGI   H +FEGR  
Sbjct: 121 HLSRLSRRGQLPYDINNIDRYDNAFDY-YFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVK 179

Query: 227 WGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIE 286
           + A+    +   D NGHGTH AGI+GS+ FGV K  N++ VK L   G+G +S ++K +E
Sbjct: 180 F-AIDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILKALE 238

Query: 287 YVV---KDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDE 343
           + +   K+ +D             ANLS G+ ++  ++ A+  A  +G+   +AAGN + 
Sbjct: 239 FTIRHCKESVD---------KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNI 289

Query: 344 DACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNASL 399
           DAC +SPA ++  ITVGA    DDR    A FS+WG+CVDVFAPGV + S    + +  L
Sbjct: 290 DACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSDVL 346

Query: 400 SLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD----V 455
            LSGTSMA+P V+GI +  L           D  ++P+ +K KII  ST+ +       +
Sbjct: 347 LLSGTSMASPSVSGIAAILL-----------DKGLNPKFVKSKIIESSTKNIFHQGTIMI 395

Query: 456 GEDTPNRLIYNGGGRKLDNF 475
             +TPN +++NG  +  D+F
Sbjct: 396 KPNTPNLIVFNGIEKMDDSF 415

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  189 bits (479), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 148/433 (34%), Positives = 210/433 (48%), Gaps = 67/433 (15%)

Query: 86  SHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVI 145
           +H+ ++    ++S+      D+ +       D   G I   F   G FRG T   T++V+
Sbjct: 21  AHEYLVSLKNSDSIQSFM--DSTYAHGQLMKDYLHGKISKTFSF-GSFRGLTVNLTKDVV 77

Query: 146 KRVLQDPII-----------------------KFIEQESTVKVTNSTF---QEEAPWGLH 179
             + ++P++                         I+Q   +   NS     Q  AP  L 
Sbjct: 78  SAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKNSYLVKVQNGAPRHLA 137

Query: 180 RISHR--------EKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDINHEDFEGRAVWGAV 230
           R+S R        +K  Y   L Y Y     G  V +Y++D+GIDIN E+FEGRA  G  
Sbjct: 138 RLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQEEFEGRATHGLD 197

Query: 231 IPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVK 290
           +   +   D NGHGTH AG++GS+ +GV KN  LV VK L   G G++  VI  +E+VV 
Sbjct: 198 LT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSLITVISALEFVV- 255

Query: 291 DHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSP 350
           +H               ANLSLG+   P +  A+ A V+SGV   +AAGN + DAC  SP
Sbjct: 256 NHC-----GKSKSKKCVANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGNGNIDACWCSP 310

Query: 351 AGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSM 406
           A  + +ITVGA    DDR    A FS+WG+CVD+FAPGV I S  I     S+  SGTSM
Sbjct: 311 ASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKDNQKSVEFSGTSM 367

Query: 407 AAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD----VGEDTPNR 462
           A+P VAGI+S  L           D  V  + +++ +   +T  V           TPNR
Sbjct: 368 ASPQVAGIVSILL-----------DQGVENEDIRDYLFELATDDVFQKRTLLFKPRTPNR 416

Query: 463 LIYNGGGRKLDNF 475
           + +NG  +K ++F
Sbjct: 417 ITFNGISKKDEDF 429

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  187 bits (475), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 173/341 (50%), Gaps = 51/341 (14%)

Query: 171 QEEAPWGLHRISHREK--------AKYGQDLEYLYED-AAGRGVTSYVLDTGIDINHEDF 221
           Q EAP  L R+S R +         +Y  D  Y Y     GR V +YVLD+G+ I+H DF
Sbjct: 160 QSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCDF 219

Query: 222 EGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDV 281
           EGRA +GA    +  + D NGHGTH AG+IGS+ +GV+K  N++ VKVL S G GT+  V
Sbjct: 220 EGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDTV 279

Query: 282 IKGIEYVVKDHIDXXXXXX-------------------XXXXXXTANLSLGSSKSPAMEM 322
           + G+E+ V +H +                                 NLSLG+ +S  +  
Sbjct: 280 MSGLEF-VSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 323 AVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCV 378
           A+   ++ G+   +AAGN + +AC +SPA     ITVGA    DDR    A FS+WG CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 379 DVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQ 438
           D+FAPGV + S         +  +GTSMA P V G+++  L           DS + P Q
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL-----------DSGIKPTQ 444

Query: 439 LKEKIINFSTQGVLGD----VGEDTPNRLIYNGGGRKLDNF 475
           +K+++   +T  +           TPNR+ +NG  R  D++
Sbjct: 445 IKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDY 485

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  186 bits (473), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 131/380 (34%), Positives = 192/380 (50%), Gaps = 56/380 (14%)

Query: 131 GLFRGYTGYFT----EEVIKRVLQDPIIKFI--------------EQESTVKVTNSTFQE 172
           G F+G T        +++++++ Q+P++  I                E T +  +   Q 
Sbjct: 61  GKFKGITMNIAHNKKQKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQS 120

Query: 173 EAPWGLHRISHREK--------AKYGQDLEYLY-EDAAGRGVTSYVLDTGIDINHEDFEG 223
           EAP  L RIS R+K        + Y +   Y Y ++  G  V +Y+LD+G+  N  DFEG
Sbjct: 121 EAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEG 180

Query: 224 RAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIK 283
           R  +G     + E  D NGHGTH AG++GS+ +GV K   +V VK L   G GT+  V+ 
Sbjct: 181 RVEFGFDFTGDGEG-DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLS 239

Query: 284 GIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDE 343
            IE+ V D                ANLSLGS K+  +  A+ AA E GV   +AAGN + 
Sbjct: 240 AIEFAVND------CHEHPEKRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNI 293

Query: 344 DACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNASL 399
           +AC +SPA AE++ITVGA    DDR    A FS+WG CVD++APGV + S        ++
Sbjct: 294 NACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNI 350

Query: 400 SLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD----V 455
           S SGTSMA+P V G ++  L           D  +    +K  +I  +T  V        
Sbjct: 351 SYSGTSMASPIVCGQVAILL-----------DKGIPNDDIKSTLIKMATDDVFQKRTLLF 399

Query: 456 GEDTPNRLIYNGGGRKLDNF 475
             +TPNR+++NG  ++ D +
Sbjct: 400 KPNTPNRVLFNGIEKEDDQY 419

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 140/417 (33%), Positives = 207/417 (49%), Gaps = 60/417 (14%)

Query: 97  ESVSKLAKDDAFFVSTSAPSDLQFGGIDSFFDIN-------GLFRGYTGYFTEEVIKRVL 149
           E + +    DAF +  +  S  +   I SFFD         G FR  +     +++ R+ 
Sbjct: 21  EYLIRFKTPDAFKLFMNFKS-ARLQSIKSFFDCKVRRTFSFGSFRALSIDVPRDLVDRIR 79

Query: 150 QDPI-------IKFI---EQESTVKVTNSTF---QEEAPWGLHRISHREKAKYGQDLE-- 194
           + P+       I+F+   E +      NS F   Q  AP  L R+S R +  Y  + E  
Sbjct: 80  RSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDD 139

Query: 195 -------YLYEDA-AGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTH 246
                  Y Y++   G G+ +Y++DTGI   H +F GRAV+G  +   +   D NGHGTH
Sbjct: 140 NYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDGNGHGTH 198

Query: 247 CAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXX 306
            AGI+GS  +GV K+  LV VK L + G+G ++ VI  +E+ V +H              
Sbjct: 199 VAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAV-NHC-----RSSEGKGC 252

Query: 307 TANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 366
             NLSLG+ ++  +  AV AA E+G+   +AAGN + +ACL+SPA A ++ITVGA    D
Sbjct: 253 VINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGA---FD 309

Query: 367 DR----AFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQ 422
           DR    A FS+WG+CVD+FAPGV + S         +  SGTSMA+P + G+ +  L   
Sbjct: 310 DRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL--- 366

Query: 423 PSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD----VGEDTPNRLIYNGGGRKLDNF 475
                   D  V   ++K+ I+  +T  V           TPNR+ +NG  +  D F
Sbjct: 367 --------DEGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKNDDKF 415

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  189 bits (481), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 177/322 (54%), Gaps = 38/322 (11%)

Query: 170 FQEEAPWGLHRISHREKAKYGQ--DLEYLY-----EDAAGRGVTSYVLDTGIDINHEDFE 222
            Q +AP  L R   R    +    D EY +     E+  G GV  YVLD+GI  +H +F+
Sbjct: 427 IQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFD 486

Query: 223 GRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVI 282
           GRA +G +    +   DLNGHGTH AG++GSR FG+ K  N+  +KV+  +G G+ S++I
Sbjct: 487 GRAHFG-IDTTKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNII 545

Query: 283 KGIEYVVKDHIDXXXXXXXXXXXXTANLSLG--SSKSPAMEMAVNAAVESGVHFAIAAGN 340
            G+E+ VK H               AN+SLG  S    A++ AV AA+E G+ F +AAGN
Sbjct: 546 AGVEFAVK-HC------QQSGKRCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGN 598

Query: 341 EDEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRN 396
             E AC  SPA  + +ITVGA    DDR    A FS++G CVD+FAPGV + S      N
Sbjct: 599 SKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSN 655

Query: 397 ASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD-- 454
               L+GTSM+AP  AG+++  L           D  + P ++K+ +++ ST+G+     
Sbjct: 656 TMRVLNGTSMSAPITAGVVAVLL-----------DQGIEPHEVKDHLLSISTKGLFHKRR 704

Query: 455 -VGEDTPNRLIYNGGGRKLDNF 475
            V   TP+R ++ G  R+ D+F
Sbjct: 705 LVSSRTPDRALFTGVKREDDSF 726

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  184 bits (467), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/319 (38%), Positives = 174/319 (54%), Gaps = 32/319 (10%)

Query: 170 FQEEAPWGLHRISHREKAKY----GQDLEY-LYEDAA--GRGVTSYVLDTGIDINHEDFE 222
            Q  AP  L R   R    +     +D E+  Y DA   G  V  Y+LD+GI  +H +FE
Sbjct: 269 MQSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFE 328

Query: 223 GRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVI 282
           GRAV+G +   N+   DLNGHGTH AG++GS+ +G  K   +  VKV+  +G G+ S++I
Sbjct: 329 GRAVFG-IDTTNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNII 387

Query: 283 KGIEYVVKDHIDXXXXXXXXXXXXTANLSLG--SSKSPAMEMAVNAAVESGVHFAIAAGN 340
            G+E+ VK                 AN+SLG  S    A++ AV AA+E G+ F +AAGN
Sbjct: 388 AGVEFAVK-------HCQQSGKKCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGN 440

Query: 341 EDEDACLSSPAGAEKSITVGA-STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASL 399
             E AC  SPA  + +ITVGA    SD  A FS++G CVD+FAPGV + S      N   
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 400 SLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD---VG 456
            L+GTSM+AP  AG+++  L           D  V  + +KE++I+ ST+GV      V 
Sbjct: 501 VLNGTSMSAPITAGVVAVLL-----------DQGVKHEDVKERLIDLSTKGVFHRRRLVS 549

Query: 457 EDTPNRLIYNGGGRKLDNF 475
             TP+R ++NG  ++ D F
Sbjct: 550 SRTPDRTLFNGVPQEDDVF 568

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  179 bits (455), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 128/322 (39%), Positives = 178/322 (55%), Gaps = 39/322 (12%)

Query: 171 QEEAPWGLHRISHREKAKYG--------QDLEYLYEDA-AGRGVTSYVLDTGIDINHEDF 221
           Q+ AP  L RIS R    Y          +  Y Y+D+  G  V +YV+DTGI   H  F
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 222 EGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDV 281
           +GRA +GA +   +   DLNGHGTH AG+IGS+ +GV K+ +L+ VK L + G+G ++ V
Sbjct: 193 QGRAKFGADLV-GEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 282 IKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNE 341
           I  IE+ V +H               ANLSLGS ++  +  AV AA+E+GV   +AAGN 
Sbjct: 252 ISAIEFTV-NHC------RKSKRGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNS 304

Query: 342 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNA 397
           + +AC SSPA +  +I+VGA    DDR    A FS+WG CVD+FAPGV I S        
Sbjct: 305 NANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 398 SLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVG- 456
           S++ SGTSMA+P V G+++  L           DS + P  +KE++IN +T  V      
Sbjct: 362 SVAYSGTSMASPLVTGMVAVLL-----------DSGIHPFDIKEELINTATDSVFHKRAL 410

Query: 457 ---EDTPNRLIYNGGGRKLDNF 475
                TPNR+ + G  ++ D F
Sbjct: 411 LFKPGTPNRVAFTGVEKEDDIF 432

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 164/314 (52%), Gaps = 37/314 (11%)

Query: 171 QEEAPWGLHRISHREKA--------KYGQDLEYLYEDA-AGRGVTSYVLDTGIDINHEDF 221
           Q  AP  L RIS R+K         ++ + L Y Y+D   G GV +YV+DTGI   H+DF
Sbjct: 287 QRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKEHKDF 346

Query: 222 EGRAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDV 281
           E R  +G  +   + A DLNGHGTH AG+IGS+ +GV K   ++ VK +   G   +S +
Sbjct: 347 EDRVEFGTDLT-GEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQLSHI 405

Query: 282 IKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNE 341
           I+ IEY V D                 N+SLGS     +  AV +A+  GV F +AAGN 
Sbjct: 406 IEAIEYTVND-----CNSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAAGNN 460

Query: 342 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNA 397
           + DAC SSP  ++ +ITVGA    DDR    A FS+WG CVD+FA GV + S        
Sbjct: 461 NIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQVPYK 517

Query: 398 SLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD--- 454
            +  SGTSMA+P V G +S  LS             V P  ++E+++  ST+G       
Sbjct: 518 YIKYSGTSMASPIVCGFVSILLS-----------QGVKPNDVQEEMVKLSTKGDFTRRSL 566

Query: 455 -VGEDTPNRLIYNG 467
                T NR+++NG
Sbjct: 567 IFKPFTSNRILFNG 580

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  178 bits (452), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/322 (40%), Positives = 180/322 (55%), Gaps = 41/322 (12%)

Query: 171 QEEAPWGLHRISHR------EKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDINHEDFEG 223
           Q  AP  L RIS R      EK      L+Y Y E+  G GV  YVLD+G++ +H DFEG
Sbjct: 154 QSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEG 213

Query: 224 RAVWGAVIPDNDEAS-DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVI 282
           RA+ G  I    E S DL GHGTH AG+IGS+ +GV K  N+V VKVL S G+GTV+++I
Sbjct: 214 RAMKG--IDTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNII 271

Query: 283 KGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPA-MEMAVNAAVESGVHFAIAAGNE 341
           +G+EYVV   I               N+SLG+  + + ++ AV+A +E GV   +A GN 
Sbjct: 272 EGLEYVVNQCI-------GKKRKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNS 324

Query: 342 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNA 397
             +AC  SPA   K+ITV A    DDR    A FS+WG C+D++APGVN+ S     R  
Sbjct: 325 GLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKGR-G 380

Query: 398 SLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGD--- 454
           +  LSGTSMA+P VAG  + +L           D    P ++++ +   +T+GV      
Sbjct: 381 TFVLSGTSMASPIVAGAAAIYL-----------DQGADPAEVRKILSKTATRGVFKKRAI 429

Query: 455 -VGEDTPNRLIYNGGGRKLDNF 475
            V   TPN+++Y G  ++ D F
Sbjct: 430 AVRPRTPNKVLYTGNNQEDDEF 451

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  166 bits (421), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 111/311 (35%), Positives = 163/311 (52%), Gaps = 35/311 (11%)

Query: 174 APWGLHRISHREKAKYG-------QDLEYLYEDAAGRGVTS--YVLDTGIDINHEDFEGR 224
           AP  L ++S R +  Y        ++  + Y D   +G  S  Y++DTG+   H++F  R
Sbjct: 153 APRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEFGNR 212

Query: 225 AVWGAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKG 284
             +G      +   D NGHGTH AG+IGS+ FGV KN  L  VKVL   G G ++ V++G
Sbjct: 213 VHFGGDFI-GEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTSVLEG 271

Query: 285 IEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDED 344
           IE+ V    +              N+SLG+ ++P +  A+  A  SG+   +AAGN +  
Sbjct: 272 IEFAVN---NCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGNNNFS 328

Query: 345 ACLSSPAGAEKSITVGASTFSDDR----AFFSDWGTCVDVFAPGVNILSTYIGSRNASLS 400
           AC +SPA +  +ITVGA    DDR    A FS+WG CVD+FAPGV I S         + 
Sbjct: 329 ACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENGVI 385

Query: 401 LSGTSMAAPHVAGILSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDV----G 456
            SGTSMA+P VAG+++  +      D           ++K+K+I+ S++ +   +     
Sbjct: 386 HSGTSMASPIVAGLVAILMEKGYKCD-----------EIKQKLIDDSSKSIFSKLTLFFK 434

Query: 457 EDTPNRLIYNG 467
             TPNR+IYNG
Sbjct: 435 YGTPNRVIYNG 445

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  145 bits (366), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 148/293 (50%), Gaps = 12/293 (4%)

Query: 133 FRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQD 192
           FR   G F + +++ +  D  I  +  +  +       QE AP  L R+S +   + G D
Sbjct: 55  FRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSD 113

Query: 193 LEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEA-SDLNGHGTHCAGII 251
             Y+Y    G GV  Y+LDTGID  H + EGR    A +  N  +  D +GHGT  AG+I
Sbjct: 114 GTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVI 173

Query: 252 GSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLS 311
           GS  FG  K  NL  V+V  S G  T+  VI+ +E+  K                   + 
Sbjct: 174 GSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASK-------LASVTQRPSVVVIP 226

Query: 312 LGSSKSPAMEMAVNAAV-ESGVHFAIAAGNEDEDACLSSPAGAEKSITVGA--STFSDDR 368
               K+  +  A+ A + +  +   +A GN +++AC SSPA A  ++T+G+   T  D  
Sbjct: 227 FTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSL 286

Query: 369 AFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421
           A F+++G C+D FA GVNI S   G   ++   SGTS++A   +G+++Y++SL
Sbjct: 287 APFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  145 bits (366), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 133/254 (52%), Gaps = 11/254 (4%)

Query: 171 QEEAPWGLHRISHREKAKYGQDLEYLY---EDAAGRGVTSYVLDTGIDINHEDFEGRAVW 227
           Q  AP  L R S   K     +  Y Y    D  G  VT YVLD+GI ++H +FEGR + 
Sbjct: 145 QFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGRILE 204

Query: 228 GAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEY 287
                D+    D  GHGT  AGIIGS+ +GV KN NL+ +KVL + G+G V  +++G+++
Sbjct: 205 AYDFTDSG-VGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQGLQF 263

Query: 288 VVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACL 347
           + K H +              N SLG+     +  A      +G+    AAGN   +AC 
Sbjct: 264 ITK-HCE-----ENTNGNCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNACW 317

Query: 348 SSPAGAEKSITVGASTFSDDR-AFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSM 406
            +PAG++   TVG+    DD  A FS+WG CVD+ APGV + +    ++  S   SGTS+
Sbjct: 318 ITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGTSV 377

Query: 407 AAPHVAGILSYFLS 420
           + P V G+ +  LS
Sbjct: 378 STPIVTGLAAILLS 391

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  136 bits (343), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 93/296 (31%), Positives = 151/296 (51%), Gaps = 15/296 (5%)

Query: 133 FRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQD 192
           FR   G F +++++   +   I  +  +  + V     Q+ AP  L R+S +   + G  
Sbjct: 55  FRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNG 114

Query: 193 LE---YLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS-DLNGHGTHCA 248
            +   Y+Y   AG GV  Y+LDTGID  H  FEGR    A    +  A+ D +GHGT  A
Sbjct: 115 SDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVA 174

Query: 249 GIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTA 308
           G+IGS  FGV K  NL  V+V  S G  ++  V++ +E+  K                  
Sbjct: 175 GVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASK-------LAAVTKRPSLI 227

Query: 309 NLSLGSSKSPAMEMAVNAAVES-GVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFS-- 365
            + L   ++  +  AV A V    +   +AAGNE+  AC  SPAGA  ++T+G+   +  
Sbjct: 228 TIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARN 287

Query: 366 DDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421
           D  A F+++  CVD+F  GV++ +  +   ++   LSGTS++A   +G+++Y++S+
Sbjct: 288 DALAPFTNFAECVDLFTAGVDVATLGL-DHSSEHHLSGTSISAGVASGLVAYYMSI 342

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  128 bits (321), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/333 (30%), Positives = 162/333 (48%), Gaps = 30/333 (9%)

Query: 106 DAFFVSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKV 165
           +A   S +  SD Q   I   F++ G FR +TG F+  +++++  DP +  I ++ ++K+
Sbjct: 28  NAVLNSYALSSDQQGPEITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKL 86

Query: 166 TNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRA 225
                Q  AP  L  +S      +     ++Y    G GV  Y+LDTGIDI H +     
Sbjct: 87  QEIVLQNNAPSHLVGLSSISPLSHQ---PFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLN 143

Query: 226 VW------GAVIPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVS 279
           +        + +P   + +D  GHGT  AGII S  FGV K  NLV V+V  SNG+  +S
Sbjct: 144 ILRMADLTQSPVP---QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLS 200

Query: 280 DVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAG 339
            +++ +  + + HI+               L +    +P +  A+ A+ +  V   I AG
Sbjct: 201 TILQALT-LTQRHIEGTKRPSVVVIP----LEVEDGNNPILTEAI-ASFDQSVPIIIPAG 254

Query: 340 NEDEDACLSSPAGAEKS----ITVGASTFSDDRAFFSDWGTCVDVFAPGVNIL---STYI 392
           N  +DA   SPA         I VG+   +++   F+++G+ VDVF  G  I    ST +
Sbjct: 255 NNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDL 314

Query: 393 GSRNASLSL----SGTSMAAPHVAGILSYFLSL 421
            S+  S SL    SGTS ++   AG++ Y++SL
Sbjct: 315 DSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  122 bits (306), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 172/356 (48%), Gaps = 46/356 (12%)

Query: 88  KRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKR 147
           + +IQ V+N  V+   K     V  S    ++ G  +SF         ++G  ++E +  
Sbjct: 23  QYIIQLVENTQVNAFLKKHDIDVMDSNILPIEIG--NSFI-------AFSGDLSKEQVSS 73

Query: 148 VLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQ----DLEYLYEDAAGR 203
           V +D     I  E  +++     Q +AP  L R++ ++  K  Q    + +Y++ D +G 
Sbjct: 74  VFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGN 132

Query: 204 GVTSYVLDTGIDINHEDFEGRAVWGAV------IPDNDEASDLNGHGTHCAGIIGSRHFG 257
           GV  Y++DTGIDI H  +    +   +      IP    + D NGHGT  AGII S  FG
Sbjct: 133 GVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIP----SGDFNGHGTAMAGIINSDPFG 188

Query: 258 VTKNTNLVAVKVLRSNGE-GTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSK 316
           V K+ NLV V+V+ +N +  T+S V+  +  + K                   L   + K
Sbjct: 189 VLKSANLVDVRVVDANTKHATMSRVLSALSLIEKHE-------QKTMRPSIIVLPFQTEK 241

Query: 317 SPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEK---SITVGASTFSD-----DR 368
           +  +E A+   +   +   I AGN+ ++AC  SP G +K    + VG+  +S+     D 
Sbjct: 242 NTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDI 300

Query: 369 AFFSDWGTCVDVFAPGVNILSTYIGSRNASLSL----SGTSMAAPHVAGILSYFLS 420
           A FS++G+CVD++  GV+I ST   S N    L    +GTS +   VAG++ Y++S
Sbjct: 301 AKFSNYGSCVDIYTSGVDI-STLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  120 bits (302), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 96/310 (30%), Positives = 154/310 (49%), Gaps = 28/310 (9%)

Query: 133 FRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISH---REKAKY 189
           F G++G F +EV+  +  DP +  I  +  + +     Q +AP  L R+S+     +   
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 190 GQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAV-IPDND-EASDLNGHGTHC 247
             +  +++   AG GV  Y++D+GID  H  F  R +   + + DN     D +GHGT  
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHISKLIDLTDNPIPVGDPHGHGTAI 180

Query: 248 AGIIGSRHFGVTKNTNLVAVKVLRSNGEGT-VSDVIKGIEYVVKDHIDXXXXXXXXXXXX 306
           AG++ S  FGV K  NL  V+V+ +   G  +S ++K +E+ +++H              
Sbjct: 181 AGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENH------SRATMRPS 233

Query: 307 TANLSLGSSKSPAMEMAVNAAVES---GVHFAIAAGNEDEDACLSSPAGAEKS---ITVG 360
            A L    SK+  +    N+A+ES    +   + AGN+   AC  SPA A  S   ++VG
Sbjct: 234 VAVLPFSMSKNAIL----NSAIESMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVG 289

Query: 361 ASTF--SDDRAFFSDWGTCVDVFAPGVN---ILSTYIGSRNASLSLSGTSMAAPHVAGIL 415
           +  +  S + A FS++G CVDVF  GV    + +T     N    +SGTSM+    AG +
Sbjct: 290 SLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTV 349

Query: 416 SYFLSLQPSS 425
            Y++SL  SS
Sbjct: 350 GYYMSLGLSS 359

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 145/306 (47%), Gaps = 34/306 (11%)

Query: 133 FRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQD 192
           F+ ++    ++ ++ +  D  I  I  +  ++      Q++AP  L ++   E      D
Sbjct: 59  FQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAG----D 114

Query: 193 LEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVW------GAVIPDNDEASDLNGHGTH 246
            E++Y+  AG GV  Y+ DTGI  N        +       G  I D     ++  HGT 
Sbjct: 115 NEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMPGPPIRD----QEILEHGTA 170

Query: 247 CAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXX 306
            +G+IGS  FGV K  NL+ V V   NG+  +S V+KG+  +V+ H+             
Sbjct: 171 MSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLN-LVQQHVK------HTNRPS 223

Query: 307 TANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS---ITVGAST 363
             N S  + K+  +  A +      V  A+AAGN  +  C  SP G +++   +  G+  
Sbjct: 224 VINFSYCTLKNAILNSAFD-NFPRDVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLL 282

Query: 364 FSDD---RAFFSDWGTCVDVFAPGVNILSTYI------GSRNASLSLSGTSMAAPHVAGI 414
            +DD    + FS++G+CV  +APG  +L+  I       SR+  + +SGTS ++   AG+
Sbjct: 283 MNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGV 342

Query: 415 LSYFLS 420
           + Y+++
Sbjct: 343 IGYYMA 348

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 95.9 bits (237), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 86/348 (24%), Positives = 155/348 (44%), Gaps = 34/348 (9%)

Query: 83  SIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTE 142
           ++ + + ++Q   + S+ +L++D +F +                  +   F+   G F+ 
Sbjct: 10  TMAAERFVVQLASDTSLVELSRDCSFSIGVGK-------NFIEMITVGDQFKALAGEFSV 62

Query: 143 EVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDAAG 202
           E ++ +  D  +  I ++  +K+     Q  +P  L ++S            + ++  +G
Sbjct: 63  EDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSGG--------SFTFDPVSG 114

Query: 203 RGVTSYVLDTGIDINHEDFEG------RAVWGAVIPDNDEASDLNGHGTHCAGIIGSRHF 256
             V  YV DTGID  H   +            + +P     +D +GHGT  AG+I S  F
Sbjct: 115 NLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGLIASETF 171

Query: 257 GVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSK 316
           GV K+ +LV V+V   +GE  +S ++KGI   V                    +++G  K
Sbjct: 172 GVLKSCSLVDVRVADKDGEVKLSTLMKGISASV-----AHARFTKRPSVFVLPMTIG-KK 225

Query: 317 SPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSDWGT 376
           +  ++  +  A+   +   + AGN+  DAC  SP      + +G+    +  A FS++G 
Sbjct: 226 NHILDNFLQ-AIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNYGN 284

Query: 377 CVDVFAPGVNIL---STYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421
           CVDV+  G +IL   ST  G+     S +GTS +    AGI+ Y +S+
Sbjct: 285 CVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 95/259 (36%), Gaps = 38/259 (14%)

Query: 193 LEYLYEDAAGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHG 244
           L+  Y +  G GV + ++D G+D  +ED    F     W       +P      D   HG
Sbjct: 157 LDVWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY--HG 214

Query: 245 THCAGIIGSRH------FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXX 298
           T CAG I ++        GV  N  +  +++L  +GE T  D    + Y     +D    
Sbjct: 215 TRCAGEIAAKKGNNFCGIGVGYNAKISGIRIL--SGELTTEDEAASLIY----GLDTNDI 268

Query: 299 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVE----SGVHFAIAAGN--EDEDAC-LSSPA 351
                        L        +  V    E     G  +  A+GN     D C      
Sbjct: 269 YSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGAHGDNCNYDGYT 328

Query: 352 GAEKSITVGASTFSDDRAFFSDWGTCVDVFA------PGVNILSTYIGSRNASLSLSGTS 405
            +  SIT+GA    D    +S+   C  V A       G  I S+ I  R  S S  GTS
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGR-CSNSHGGTS 385

Query: 406 MAAPHVAGILSYFLSLQPS 424
            AAP  AG+ +  L   PS
Sbjct: 386 AAAPLAAGVYTLLLEANPS 404

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 111/299 (37%), Gaps = 42/299 (14%)

Query: 153 IIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDT 212
           ++   E E  + + +  F+ +  W  H I+          ++  Y +  G GV + ++D 
Sbjct: 121 LLPIKEAEDKLSINDPLFERQ--W--HLINPSFPGSDINVVDLWYNNITGAGVVAAIVDD 176

Query: 213 GIDINHED----FEGRAVW----GAVIPDNDEASDLNGHGTHCAGIIGSRH------FGV 258
           G+D  +ED    F     W       +P    + D   HGT CAG I ++        GV
Sbjct: 177 GLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGTRCAGEIAAKKGNDFCGVGV 234

Query: 259 TKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSP 318
             N  +  +++L  +GE T  D    + Y     +D                 L      
Sbjct: 235 GYNAKISGIRIL--SGEITTEDEAASLIY----GLDTNDIYSCSWGPADDGRHLQGPSDL 288

Query: 319 AMEMAVNAAVE----SGVHFAIAAGN---EDEDACLSSPAGAEKSITVGASTFSDDRAFF 371
             +  V    E     G  +  A+GN     ++        +  SIT+GA    D    +
Sbjct: 289 VKKALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYTNSIYSITIGAIDHKDLHPPY 348

Query: 372 SDWGTCVDVFA------PGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
           S+  +C  V A       G  I S+ I  +  S S  GTS AAP  AG+ +  L   PS
Sbjct: 349 SE--SCSAVMAVTYSSGSGEYIHSSDINGK-CSDSHGGTSAAAPLAAGVYTLLLEANPS 404

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 124/342 (36%), Gaps = 48/342 (14%)

Query: 113 SAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQE 172
           S+  +LQ    D    ++ LF     +    V    +   ++   E E  + + +  F+ 
Sbjct: 81  SSLEELQGDNNDHILSVHDLFPRNDLFKRLPVPAPPMDSSLLPVKEAEDKLSINDPLFER 140

Query: 173 EAPWGLHRISHREKAKYGQDLEYL---YEDAAGRGVTSYVLDTGIDINHED----FEGRA 225
           +  W L   S       G D+  L   Y +  G GV + ++D G+D  +ED    F    
Sbjct: 141 Q--WHLVNPSFP-----GSDINVLDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEG 193

Query: 226 VW----GAVIPDNDEASDLNGHGTHCAGIIGSRH------FGVTKNTNLVAVKVLRSNGE 275
            W       +P    + D   HGT CAG I ++        GV  N  +  +++L  +G+
Sbjct: 194 SWDFNDNTNLPKPRLSDDY--HGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGD 249

Query: 276 GTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVE----SG 331
            T  D    + Y     +D                 L        +  V    E     G
Sbjct: 250 ITTEDEAASLIY----GLDVNDIYSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKG 305

Query: 332 VHFAIAAGN---EDEDACLSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFA------ 382
             +  A+GN     ++        +  SIT+GA    D    +S+   C  V A      
Sbjct: 306 AIYVFASGNGGTRGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSG 363

Query: 383 PGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
            G  I S+ I  R  S S  GTS AAP  AG+ +  L   P+
Sbjct: 364 SGEYIHSSDINGR-CSNSHGGTSAAAPLAAGVYTLLLEANPN 404

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 94/252 (37%), Gaps = 33/252 (13%)

Query: 197 YEDAAGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHGTHCA 248
           YE+  G  V   V+D G+D   ED    F     W       +P    + D   HGT CA
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDY--HGTRCA 213

Query: 249 GII--GSRHF---GVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXX 303
           G I  G   F   GV  N  +  +++L  + E T  D    + +     +D         
Sbjct: 214 GEIAAGKNQFCGVGVAYNAKVAGLRIL--SAEVTSEDEAASLIHA----LDVNDIYSCSW 267

Query: 304 XXXTANLSLGSSKSPAMEMAVNAAV----ESGVHFAIAAGNE---DEDACLSSPAGAEKS 356
                  SL        +  V   +    E G  +  A+GN    D++        +  S
Sbjct: 268 GPSDDGRSLQGPDDLVKKALVTGVLKGRDEKGALYVFASGNGGMFDDNCNYDGYTNSIYS 327

Query: 357 ITVGASTFSDDRAFFSDWGTCVDVFA----PGVNILSTYIGSRNASLSLSGTSMAAPHVA 412
           ITVGA         +S+  + V V       G +I ST I  R  S +  GTS AAP  A
Sbjct: 328 ITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGR-CSDTHGGTSAAAPLAA 386

Query: 413 GILSYFLSLQPS 424
           G+ S  L   P+
Sbjct: 387 GVYSLVLEANPN 398

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 135/342 (39%), Gaps = 37/342 (10%)

Query: 109 FVSTSAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPI----IKFIEQESTVK 164
           +V + A S+LQ     S +D    F+   G  +  + KR+   P+    I   E E  + 
Sbjct: 65  YVFSVATSNLQKRQDYSLYDDVLSFQDLPGE-SNRLFKRMAVPPMDSSFIPIKEAEERLH 123

Query: 165 VTNSTFQEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHED---- 220
           + +  F+++  W L   + +      QD+   Y++  G+GV + V+D G+D  + D    
Sbjct: 124 IDDPLFEKQ--WHLINPAFKGNDVNVQDV--WYQNITGKGVVAAVVDDGLDYENPDIKDN 179

Query: 221 FEGRAVW----GAVIPDNDEASDLNGHGTHCAGIIGSRH------FGVTKNTNLVAVKVL 270
           F     W       +P    A D   HGT CAG I +         GV  +  +  +++L
Sbjct: 180 FCKEGSWDFNANTNLPKPTLADDY--HGTRCAGEIAAVKNNGICGIGVAYDAKVAGIRIL 237

Query: 271 RSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVES 330
             +GE T  D    +   + D  D            T           A+   VN   ++
Sbjct: 238 --SGEITAEDEAAALINAL-DINDIYSCSWGPQDDGTHLQGPSDLVKKALIKGVNDGRKN 294

Query: 331 -GVHFAIAAGNEDE--DAC-LSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFA---- 382
            G  +  A+GN     D C       +  SITVGA    D    +S+  + V V      
Sbjct: 295 KGAIYVFASGNGGSFGDNCNYDGYTNSIYSITVGAIDHKDLHPPYSESCSAVMVVTYSSG 354

Query: 383 PGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424
            G  I +T I ++  +    GTS AAP  AGI +  L   P+
Sbjct: 355 SGEYIHTTDINNK-CNDRHGGTSAAAPLAAGIYTLLLQANPN 395

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 98/253 (38%), Gaps = 34/253 (13%)

Query: 197 YEDAAGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHGTHCA 248
           YE+  G G+   ++D G+D  + D    F     W       +P    A D   HGT CA
Sbjct: 175 YENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY--HGTRCA 232

Query: 249 GIIGSRH------FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXX 302
           G I +         GV  N  +  +++L  +GE T  D    + + +   ++        
Sbjct: 233 GEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAEDEAASLVHALD--VNDIYSCSWG 288

Query: 303 XXXXTANLSLGSS--KSPAMEMAVNAAVESGVHFAIAAGNEDE--DAC-LSSPAGAEKSI 357
                 +L   +   K   +    +   + G  +  A+GN     D C       +  SI
Sbjct: 289 PKDDGTHLQGPTDLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGYTNSIYSI 348

Query: 358 TVGASTFSDDRAFFSDWGTCVDVFA------PGVNILSTYIGSRNASLSLSGTSMAAPHV 411
           T+GA         +S+  +C  V A       G  I ST IG++  S    GTS AAP  
Sbjct: 349 TIGALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIGNK-CSDHHGGTSAAAPLA 405

Query: 412 AGILSYFLSLQPS 424
           AGI S  L + P+
Sbjct: 406 AGIFSLVLQVNPN 418

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 95/249 (38%), Gaps = 29/249 (11%)

Query: 197 YEDAAGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHGTHCA 248
           YE+  G GV + ++D G+D  + D    F     W       +P      D   HGT CA
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDY--HGTRCA 242

Query: 249 GIIGSRH-----FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEY--VVKDHIDXXXXXXX 301
           G I +        GV  N  +  +++L  +GE T  D    + Y   V D          
Sbjct: 243 GEIAAVKNDACGVGVAYNAKVAGIRIL--SGEITSEDEAASLVYGLGVNDIYSCSWGPAD 300

Query: 302 XXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGN---EDEDACLSSPAGAEKSIT 358
                 A   L   K   ++  +    E G  +  A+GN    D++        +  SIT
Sbjct: 301 DGRQMQAPDEL--VKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNYDGYTNSIYSIT 358

Query: 359 VGASTFSDDRAFFSDWGTCVDVFA----PGVNILSTYIGSRNASLSLSGTSMAAPHVAGI 414
           VGA         +++  + V V       G +I ST + ++  S    GTS AAP  AGI
Sbjct: 359 VGAIDHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDVNNQ-CSHRHGGTSAAAPLAAGI 417

Query: 415 LSYFLSLQP 423
            S  L   P
Sbjct: 418 YSLVLEANP 426

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 95/257 (36%), Gaps = 43/257 (16%)

Query: 197 YEDAAGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHGTHCA 248
           YE+  G  V   V+D G+D   ED    F     W       +P    + D   HGT CA
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDY--HGTRCA 212

Query: 249 GIIGSRH-----FGVTKNTNLVAVKVLRS--NGEGTVSDVIKGIEYVVKD-------HID 294
           G I +        GV  N  +  +++L +    E   + +I  ++  V D        +D
Sbjct: 213 GEIAAVKNKACGIGVAYNAKVAGIRILSAEVTAEDEAASLIHALD--VNDIYSCSWGPLD 270

Query: 295 XXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGN---EDEDACLSSPA 351
                          L  G +K            E G  +  A+GN    D++       
Sbjct: 271 DGRVLQGPDDLVRKALVTGVTK---------GRNEKGALYVFASGNGGMYDDNCNYDGYT 321

Query: 352 GAEKSITVGASTFSDDRAFFSDWGTCVDVFA----PGVNILSTYIGSRNASLSLSGTSMA 407
            +  SITVGA         +S+  + V V       G +I ST I  +  S +  GTS A
Sbjct: 322 NSIYSITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGK-CSDTHGGTSAA 380

Query: 408 APHVAGILSYFLSLQPS 424
           AP  AG+ S  L   P+
Sbjct: 381 APLAAGVYSLVLEANPN 397

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 95/257 (36%), Gaps = 34/257 (13%)

Query: 193 LEYLYEDAAGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHG 244
           L+  Y +  G GV + ++D G+D  +ED    F     W       +P    + D   HG
Sbjct: 157 LKLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 245 THCAGIIGSRH------FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXX 298
           T CAG I ++        GV  N  +  +++L  +G+ T  D    + Y     +D    
Sbjct: 215 TRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIY----GLDTNDI 268

Query: 299 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVE----SGVHFAIAAGN---EDEDACLSSPA 351
                        L        +  V    +     G  +  A+GN     ++       
Sbjct: 269 YSCSWGPADDGRHLQGPNDLVKKALVKGVTQGRDSKGAIYVFASGNGGARGDNCNYDGYT 328

Query: 352 GAEKSITVGASTFSDDRAFFSDWGTCVDVFA----PGVNILSTYIGSRNASLSLSGTSMA 407
            +  SIT+GA    D    +S+  + V V       G  I S+ I     S +  GTS A
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSGSGEYIHSSDING-GCSNTHGGTSAA 387

Query: 408 APHVAGILSYFLSLQPS 424
           AP  AG+ +  L   PS
Sbjct: 388 APLAAGVYTLLLEANPS 404

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 107/276 (38%), Gaps = 29/276 (10%)

Query: 201 AGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDL------NGHGTHCAGIIGSR 254
            G+ VT  ++D G+D  +ED + +  +      ND  +        + HGT CAG I + 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 255 H-----FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTAN 309
                  GV  + ++  +++L  +GE TV D    + Y +K +                 
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGLKYNDIFSCSWGPPDDGQHLQ 283

Query: 310 LSLGSSKSPAMEMAVNAAVESGVHFAIAAGN---EDEDACLSSPAGAEKSITVGASTFSD 366
                 K   ++   +   E G  +  A+GN     ++        +  SIT+GA     
Sbjct: 284 GPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITIGAIDHRG 343

Query: 367 DRAFFSDWGTCVDVFA------PGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLS 420
               +S+  +C  V A       G  I +T I  +  S    GTS AAP  AG+ +  L 
Sbjct: 344 LHPAYSE--SCSAVMAVTYSSGSGKFIETTDINGK-CSTHHGGTSAAAPLAAGVYALLLE 400

Query: 421 LQPS---SDSEFFDSTVSPQQLKEKIINFSTQGVLG 453
             P     D ++  + +S + L E       +G LG
Sbjct: 401 ANPELTWRDVQYL-TILSSKTLDENTDGKWQEGALG 435

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 71/311 (22%), Positives = 123/311 (39%), Gaps = 42/311 (13%)

Query: 142 EEVIKR----VLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKYGQDL---E 194
           + ++KR    ++   +   ++ +  + +++ +F ++  W  H I+    A  G D+   +
Sbjct: 131 DHIVKRAPVPIIDSSMEPIVQAQKQLHISDPSFPKQ--W--HLIN---AAFPGNDVNVKQ 183

Query: 195 YLYEDAAGRGVTSYVLDTGIDINH----EDFEGRAVW----GAVIPDNDEASDLNGHGTH 246
             YE+  G G+ + ++D G+D ++    ++F     W       +P      D   HGT 
Sbjct: 184 LWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDY--HGTR 241

Query: 247 CAGIIGSRH------FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXX 300
           CAG I +         GV  +  +  +++L  +GE T  D    + + + D  D      
Sbjct: 242 CAGEIAASKNNGICGVGVAYDAKVAGIRIL--SGELTAEDEAASLVHAL-DVNDIYSCSW 298

Query: 301 XXXXXXTANLSLGSSKSPAMEMAVNAAV-ESGVHFAIAAGNEDE--DAC-LSSPAGAEKS 356
                 T           AM   V     + G  +  A+GN     D C       +  S
Sbjct: 299 GPRDDGTHLQGPTDLVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYDGYTNSIYS 358

Query: 357 ITVGASTFSDDRAFFSDWGTCVDVFA----PGVNILSTYIGSRNASLSLSGTSMAAPHVA 412
           ITVGA         +S+  + V V       G  I +T IG +  S +  GTS AAP  A
Sbjct: 359 ITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIGDK-CSNTHGGTSAAAPLAA 417

Query: 413 GILSYFLSLQP 423
           G+ +  L   P
Sbjct: 418 GVYTLVLQANP 428

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 109/302 (36%), Gaps = 50/302 (16%)

Query: 153 IIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAKY-GQDL---EYLYEDAAGRGVTSY 208
           +I   E E  +++ +  F+++  W      H   A Y G D+   +  Y +  G GV   
Sbjct: 125 MIPLKEAEEKLEINDPNFEKQ--W------HLINANYPGNDVNVKDVWYGNVTGSGVVVA 176

Query: 209 VLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHGTHCAGIIGSRH----- 255
           ++D G+D  + D    F     W       +P    A D   HGT CAG I +       
Sbjct: 177 IVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCAGEIAASKNNGFC 234

Query: 256 -FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXTANLSLGS 314
             GV  N+ +  +++L  +G  T  D    + Y     +D                 L  
Sbjct: 235 GIGVAYNSKVSGLRIL--SGPLTPEDEAASLMYA----LDVNDIFSCSWGPQDDGRHLQG 288

Query: 315 SKSPAMEMAVNAAVE----SGVHFAIAAGNEDE--DAC-LSSPAGAEKSITVGASTFSDD 367
                 +  +    E     G  +  A+GN     D C       +  SIT+GA      
Sbjct: 289 PSELVRKALIKGVTEGRQKKGSVYVFASGNGGHFGDNCNYDGYTNSIYSITIGAIDHKGL 348

Query: 368 RAFFSDWGTCVDVFA------PGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421
              +S+  +C  V A       G  I ST I  +  S    GTS AAP  AGI +  L  
Sbjct: 349 HPPYSE--SCSAVMAVTYSSGSGEFIHSTDINDQ-CSDRHGGTSAAAPLAAGIYALLLEA 405

Query: 422 QP 423
            P
Sbjct: 406 NP 407

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 11/85 (12%)

Query: 197 YEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS------DLNGHGTHCAGI 250
           YE+  G GV + ++D G+D   ED +           ND         D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 251 IGSR-----HFGVTKNTNLVAVKVL 270
           I +        GV  N  L  +++L
Sbjct: 214 IAAVPNDFCAVGVAFNAKLSGIRIL 238

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 97/246 (39%), Gaps = 23/246 (9%)

Query: 198 EDAAGRGVTSYVLDTGIDINHEDF------EGRAVWGAVIPDNDEASDLNGHGTHCAGII 251
           E+  G GV + ++D G+D  +ED       EG   +    P        + HGT CAG I
Sbjct: 151 ENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEI 210

Query: 252 GSRH-----FGVTKNTNLVAVKVL--RSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXX 304
            +        GV  N+ +  +++L  +   E   + +I G++  V D             
Sbjct: 211 AAFRNDICGVGVAYNSKVSGIRILSGQITAEDEAASLIYGLD--VNDIYSCSWGPSDDGK 268

Query: 305 XXTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDE--DAC-LSSPAGAEKSITVGA 361
              A  +L   K   ++         G  +  A+GN     D+C       +  SITVGA
Sbjct: 269 TMQAPDTL--VKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITVGA 326

Query: 362 STFSDDRAFFSDWGTCVDV--FAPGV-NILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418
             +      +S+  + V V  ++ G  N + T       S +  GTS AAP  AGI +  
Sbjct: 327 IDWKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYTLV 386

Query: 419 LSLQPS 424
           L   P+
Sbjct: 387 LEANPN 392

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 41/100 (41%), Gaps = 18/100 (18%)

Query: 190 GQDL---EYLYEDAAGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEAS 238
           G DL   E  Y +  G GV + ++D G+D   ED    F     W       +P      
Sbjct: 144 GNDLNITELWYNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGD 203

Query: 239 DLNGHGTHCAGIIGSRH-----FGVTKNTNLVAVKVLRSN 273
           D   HGT CAG I +        GV  N  +  +++L ++
Sbjct: 204 D--NHGTRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 93/247 (37%), Gaps = 33/247 (13%)

Query: 201 AGRGVTSYVLDTGIDINHED----FEGRAVW----GAVIPDNDEASDLNGHGTHCAGIIG 252
            G+GV + ++D G+D N ED    F     W       +P      D   HGT CAG I 
Sbjct: 162 TGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY--HGTRCAGEIA 219

Query: 253 SRH-----FGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDXXXXXXXXXXXXT 307
           +        GV     +  +++L  +G+ T  D    + Y +   I+             
Sbjct: 220 AVKNEYCGLGVAYGAKVAGIRIL--SGQITAEDEAASLMYGLD--INDIFSCSWGPPDDG 275

Query: 308 ANLSLGSS--KSPAMEMAVNAAVESGVHFAIAAGNEDE--DAC-LSSPAGAEKSITVGAS 362
            +L   S   K   ++       E G  +  A+GN     D C       +  SIT+GA 
Sbjct: 276 KHLQGPSDLVKKAMIKGTQEGRNEKGSIYVFASGNGGHYGDNCNYDGYTNSIYSITIGAI 335

Query: 363 TFSDDRAFFSDWGTCVDVFA------PGVNILSTYIGSRNASLSLSGTSMAAPHVAGILS 416
                   +S+  +C  V A       G  I ST I S+  S    GTS AAP  AGI +
Sbjct: 336 DHKGLHPPYSE--SCSAVLAVTYSSGSGEYIHSTDIKSQ-CSDRHGGTSAAAPLAAGIYA 392

Query: 417 YFLSLQP 423
             L   P
Sbjct: 393 LVLEANP 399

>TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1563

 Score = 32.3 bits (72), Expect = 3.1,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 65  ESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSD 117
           ++LP +YI + + D S+ S+E+H        NES+ +  +D +  +S  + SD
Sbjct: 710 KTLPLKYISSLNSDQSMASVETHIFETTSTTNESLVR--RDPSILLSEGSASD 760

>TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.380
           YMR146C
          Length = 346

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 17/68 (25%)

Query: 70  RYIIAFHEDSSV-----------RSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDL 118
           RYIIA H+D  V           +S+E+HK+ I ++Q       + D ++F++ S  S  
Sbjct: 166 RYIIAGHKDGKVSKYNAKTGEFLKSVEAHKQTIGDIQ------FSPDRSYFITASRDSTA 219

Query: 119 QFGGIDSF 126
               +++F
Sbjct: 220 HILDVETF 227

>TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.380
           YMR146C
          Length = 347

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 17/68 (25%)

Query: 70  RYIIAFHEDSSV-----------RSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDL 118
           RYIIA H+D  V           +S+E+HK+ I ++Q       + D ++F++ S  S  
Sbjct: 166 RYIIAGHKDGKVSKYNAKTGEFLKSVEAHKQTIGDIQ------FSPDRSYFITASRDSTA 219

Query: 119 QFGGIDSF 126
               +++F
Sbjct: 220 HILDVETF 227

>CAGL0J10318g Chr10 complement(1008835..1009995) [1161 bp, 386 aa]
           {ON} weakly similar to uniprot|P53939 Saccharomyces
           cerevisiae YNL078w
          Length = 386

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 57  EPKVVYKAESLPYRYIIAFH-EDSSVRSIESHKRMIQEVQNESVSKLA-KDDAFFVSTSA 114
            P+VV   E +P R    +H +DS+V    S KR +  V+N  V+++  +D    +++ A
Sbjct: 157 RPRVVPTVERIPSR---VYHVDDSTVSRKNSIKRSMPSVRNSKVNQMRHRDPVVSITSQA 213

Query: 115 PSDL 118
           PS L
Sbjct: 214 PSGL 217

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 71/185 (38%), Gaps = 33/185 (17%)

Query: 122 GIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRI 181
           G+ SF D+     G        + +  +   ++   + E  + + +  F+ +  W L   
Sbjct: 86  GVISFHDLKPYRLGKRAPIPNPIPEPPMDSSMVPLKKAEQMLDIKDPLFERQ--WHLINP 143

Query: 182 SHREKAKYGQDLE---YLYEDAAGRGVTSYVLDTGIDINHED----FEGRAVWGAVIPDN 234
           S       G D+      YE   G+GV   ++D G+D   ED    F     W     D 
Sbjct: 144 SFP-----GHDVNVTGLWYEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSW-----DF 193

Query: 235 DEASDL-------NGHGTHCAGIIGSRH-----FGVTKNTNLVAVKVLRSNGEGTVSDVI 282
           +E  +L       + HGT CAG I +        GV   + +  +++L  +G+ T  D  
Sbjct: 194 NENQNLPKPLLYDDYHGTRCAGEIAAAKNEYCGLGVAYGSKVSGIRIL--SGQITAEDEA 251

Query: 283 KGIEY 287
             + Y
Sbjct: 252 ASLVY 256

>Smik_3.74 Chr3 complement(104188..105348) [1161 bp, 386 aa] {ON}
           YCL008C (REAL)
          Length = 386

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 129 INGLFRGYTGYFTEEVIKR--VLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRIS 182
           +N L+R    Y T++++ R  V+QD I +F E  +  K      ++EA   +H ++
Sbjct: 233 VNELYREDVNYVTDKILARQTVMQDSITRFYEMIAVDKNHIQAVEQEAEQAMHSLN 288

>KNAG0H02210 Chr8 complement(397385..398719) [1335 bp, 444 aa] {ON}
           Anc_2.260 YNL051W
          Length = 444

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 10/90 (11%)

Query: 24  DEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKVVYKAESLPYRYIIAFHEDSSVRS 83
           D ++YL      ++N K  E L +Q    +H  E   +YK  SL  +  +    + +V+S
Sbjct: 178 DAVIYL----HIYQNIK--ELLREQTNAKYHDFELDKIYKLASLYSQLELTVQNNINVKS 231

Query: 84  IESHKRMIQEVQNESVSKLAKDDAFFVSTS 113
           ++    +I++++N+ V K +KD   ++S S
Sbjct: 232 LQ----LIKQIENDFVKKNSKDLLNYLSVS 257

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,893,472
Number of extensions: 2127832
Number of successful extensions: 5781
Number of sequences better than 10.0: 90
Number of HSP's gapped: 5713
Number of HSP's successfully gapped: 92
Length of query: 476
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 363
Effective length of database: 40,524,141
Effective search space: 14710263183
Effective search space used: 14710263183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)