Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1766.25ON74574539540.0
Smik_15.1706.25ON77374929960.0
Skud_15.1626.25ON73473529720.0
YOR001W (RRP6)6.25ON73373329450.0
NCAS0H008606.25ON75575821010.0
KAFR0G026606.25ON73574020110.0
Kpol_1037.296.25ON74674620020.0
SAKL0E01452g6.25ON73775219960.0
KNAG0M012306.25ON73874619760.0
ZYRO0C07678g6.25ON74175119160.0
NDAI0D008506.25ON79076919190.0
CAGL0E02585g6.25ON73774218920.0
TPHA0J003706.25ON74375318910.0
TDEL0G044406.25ON73574318890.0
TBLA0A071706.25ON77175018510.0
ACL001C6.25ON74575018460.0
KLLA0D01309g6.25ON74474818140.0
Ecym_30306.25ON74775217660.0
Kwal_56.224476.25ON73573917230.0
KLTH0C11066g6.25ON73574516230.0
Smik_13.3896.263ON19867980.001
TDEL0F006701.493ON63894724.6
KLTH0D11616g8.691ON302120715.4
KAFR0G004208.860ON37451715.6
YMR252C8.803ON13441676.6
Suva_13.4378.803ON13945677.9
Smik_13.4668.803ON13459678.1
YOR251C (TUM1)8.691ON304214698.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.176
         (745 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...  1527   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...  1158   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...  1149   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...  1139   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   813   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   779   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   775   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   773   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   765   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   742   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   743   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   733   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   733   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   732   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   717   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   715   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   703   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   684   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   668   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   629   0.0  
Smik_13.389 Chr13 (612617..613213) [597 bp, 198 aa] {ON} YMR184W...    42   0.001
TDEL0F00670 Chr6 (112308..114224) [1917 bp, 638 aa] {ON} Anc_1.4...    32   4.6  
KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {O...    32   5.4  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     32   5.6  
YMR252C Chr13 complement(775315..775719) [405 bp, 134 aa] {ON} P...    30   6.6  
Suva_13.437 Chr13 complement(754591..755010) [420 bp, 139 aa] {O...    30   7.9  
Smik_13.466 Chr13 complement(758422..758826) [405 bp, 134 aa] {O...    30   8.1  
YOR251C Chr15 complement(802550..803464) [915 bp, 304 aa] {ON}  ...    31   8.6  

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score = 1527 bits (3954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/745 (100%), Positives = 745/745 (100%)

Query: 1   MGHEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKIL 60
           MGHEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKIL
Sbjct: 1   MGHEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKIL 60

Query: 61  QSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRT 120
           QSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRT
Sbjct: 61  QSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRT 120

Query: 121 SNSNNSAADLQYLGDFSGKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPL 180
           SNSNNSAADLQYLGDFSGKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPL
Sbjct: 121 SNSNNSAADLQYLGDFSGKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPL 180

Query: 181 SDSLRMIETEENSPGHYPHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATL 240
           SDSLRMIETEENSPGHYPHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATL
Sbjct: 181 SDSLRMIETEENSPGHYPHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATL 240

Query: 241 KSMLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFT 300
           KSMLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFT
Sbjct: 241 KSMLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFT 300

Query: 301 NPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSK 360
           NPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSK
Sbjct: 301 NPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSK 360

Query: 361 KYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFE 420
           KYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFE
Sbjct: 361 KYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFE 420

Query: 421 YSKYRPITPSSKVYSPTEKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRF 480
           YSKYRPITPSSKVYSPTEKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRF
Sbjct: 421 YSKYRPITPSSKVYSPTEKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRF 480

Query: 481 IMPNQLLAALVAYTPIDVIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEI 540
           IMPNQLLAALVAYTPIDVIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEI
Sbjct: 481 IMPNQLLAALVAYTPIDVIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEI 540

Query: 541 VSSKFKSASLEAITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIV 600
           VSSKFKSASLEAITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIV
Sbjct: 541 VSSKFKSASLEAITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIV 600

Query: 601 YEDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPTKI 660
           YEDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPTKI
Sbjct: 601 YEDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPTKI 660

Query: 661 EDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSF 720
           EDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSF
Sbjct: 661 EDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSF 720

Query: 721 NDSEGPRAPKKKRPTTRGKNVSFKR 745
           NDSEGPRAPKKKRPTTRGKNVSFKR
Sbjct: 721 NDSEGPRAPKKKRPTTRGKNVSFKR 745

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score = 1158 bits (2996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/749 (74%), Positives = 635/749 (84%), Gaps = 6/749 (0%)

Query: 3   HEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQS 62
           +E++  N+Q     Y MAS+N DVLLSKVVNVIRAASSLA QDVDFY+NLDR+F K+L+S
Sbjct: 25  YEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKS 84

Query: 63  KSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSN 122
           KS KL +M N I+LSIDEHH+S ELK+E+IS LW DFGNIMDNLLE SDHSLD LNR   
Sbjct: 85  KSDKLADMANEIILSIDEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVT 144

Query: 123 SNNSAADLQYLGDFSGKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSD 182
           S  + ADLQYLGDFS K+  P KRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSD
Sbjct: 145 SKPNGADLQYLGDFSEKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSD 204

Query: 183 SLRMIETEENSPGHYPHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKS 242
           SLR+IE ++N+P HYPHPYEYEIDHQEY  NILQI+ EIPSK W+ SEPIWI++   L+S
Sbjct: 205 SLRLIEEDDNTPSHYPHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLES 264

Query: 243 MLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNP 302
           MLE+LKN  EIAVDLEHHDYRSYYG+VCLMQ+STRE+DYLVDTLELRE LHILNEVFT+P
Sbjct: 265 MLEELKNVQEIAVDLEHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDP 324

Query: 303 SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY 362
           SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY
Sbjct: 325 SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY 384

Query: 363 QLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYS 422
           QLADWRIRPLSKPM AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYS
Sbjct: 385 QLADWRIRPLSKPMIAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYS 444

Query: 423 KYRPITPSSKVYSPTEKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIM 482
           KYRP  PSS+VYSP EKE PWRVLMYQYNI  E+EELVKDLY+WRDVIARRDDESPRF+M
Sbjct: 445 KYRPRIPSSEVYSPIEKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVM 504

Query: 483 PNQLLAALVAYTPIDVIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVS 542
           PNQLLAALVAYTPIDVIGV+SL+NG+T+HVRQNAK+L NLIK++LR +KDT+KE + +  
Sbjct: 505 PNQLLAALVAYTPIDVIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTF 564

Query: 543 SKFKS--ASLEAITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIV 600
           S+  +   SLEAIT+ QIRDIM+RFSV S+++V+  R+ +    SIL G+ILP EE DI 
Sbjct: 565 SESMTNEVSLEAITIPQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIA 624

Query: 601 YEDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKFEVEK----PVNVEKSEMVKIETTPEP 656
           Y+++GLP++VK ED+R RAQ FNSAL  LED   EVEK    P NV+K E +  E  P+ 
Sbjct: 625 YKNNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKH 684

Query: 657 PTKIEDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRF 716
              IE+PD++VVLKKK IH+ Q     D   E+A+DYSKIPNVLSSK  QN +QQ+KRR 
Sbjct: 685 SATIENPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRS 744

Query: 717 DPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745
           DP FNDS+GPRA KKKRP TRG+NVSFKR
Sbjct: 745 DPLFNDSDGPRAAKKKRPATRGRNVSFKR 773

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/735 (77%), Positives = 641/735 (87%), Gaps = 9/735 (1%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M SEN DVL SK+V V+RAASSLA+QDVDFY+NL+R+FS +L+SKS KLT+MVN I+LSI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           DEHH+S ELKE+EIS LWKDFGNIMDNLLE SDHSLD LN T+NS  S A+LQYLGDFSG
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
           KDS  TKR+EKPQLKFK  IDNSESHPFIPLLKEKPNALKPLS+SLR+ E EEN+P HY 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
           HPY YEIDHQEY+ ++LQIK EIPSK WD SEPIWI++K  L  MLEDLKNA EIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHDYRSYYG+VCLMQVSTRERDYLVDT+ELR+ LHILNEVFT+P IVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWR RPLSKPMTA
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSK+RP TPSS+VYSP E
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           KENPWRVLMYQYNI  E+EELVKDLY WRD IARRDDESPRF+MPNQLLAALVAY PIDV
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFK--SASLEAITVS 556
           IGVVSL+NGVT+HVRQNAK+LANLI++AL ++KDT+K++  I SS+ K    SLE IT+S
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITIS 540

Query: 557 QIRDIMDRFSVFSSNSVTEDRSM--DSTASSILFGKILPYEEGDIVYEDSGLPHKVKVED 614
           QIRDIM+RFS+ S++ V  +R+   DST SSIL GK LP+EE  I Y   G P+KVKVED
Sbjct: 541 QIRDIMERFSLLSNSGVINNRTKTGDST-SSILLGKTLPFEECGISYGKKGTPNKVKVED 599

Query: 615 MRDRAQRFNSALVGLEDIKFEVEKPV----NVEKSEMVKIETTPEPPTKIEDPDEVVVLK 670
           ++ RAQ+FNSAL GLE+I FE+EKPV    +VEK E V+IE+ PE P+K E  D+++VLK
Sbjct: 600 IKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLK 659

Query: 671 KKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDSEGPRAPK 730
           KK++HKKQ AK  D+  +EAVDYSK+P+VLSSKPGQN KQQRKRRFDPS NDSEGPRA K
Sbjct: 660 KKKMHKKQPAKGKDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGPRAAK 719

Query: 731 KKRPTTRGKNVSFKR 745
           KKRP  RGKN+SFKR
Sbjct: 720 KKRPAPRGKNMSFKR 734

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/733 (74%), Positives = 636/733 (86%), Gaps = 6/733 (0%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M SEN DVLLS+V+NV+RAASSLA+QDVDFY+NLDR FSK L+SK+ KL +M N I+LSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           DEHH+S ELKEE+ISDLW +FGNIMDNLLE SDHSLD LN   NS +  +DLQYLG+FSG
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
           K+  PTKRVEKPQLKFK+PIDNSESHPFIPLLKEKPNALKPLS+SLR+++ +EN+P HYP
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
           HPYEYEIDHQEY+P ILQI+ EIPSK WD S PIW+++   L+SMLEDLKN  EIAVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHDYRSYYG+VCLMQ+STRERDYLVDTL+LRE+LHILNEVFTNPSIVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP+TPSS+VYSP E
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           KE+PW++LMYQYNI PERE LV++LY+WRD+IARRDDESPRF+MPNQLLAALVAYTP DV
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSAS--LEAITVS 556
           IGVVSL+NGVT+HVRQNAK+LANLI+ ALR++K+T++E+  I SS+ K+    LE I+V 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540

Query: 557 QIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDMR 616
           QIRD+M+RFSV  ++++++ R+   T SSIL GKILP EE DI Y   GLP+KVK ED+R
Sbjct: 541 QIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR 600

Query: 617 DRAQRFNSALVGLEDIKFEVEK----PVNVEKSEMVKIETTPEPPTKIEDPDEVVVLKKK 672
            RAQ F SAL  LEDI FE+EK    PV +E+ + V   + P    +I++ D++VVLKKK
Sbjct: 601 IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLKKK 660

Query: 673 RIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDSEGPRAPKKK 732
            I KKQ AK   V  ++AVDYSKIPN+LS+KPGQNN+QQ+KRRFDPS +DS GPRA KK+
Sbjct: 661 NIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNGPRAAKKR 720

Query: 733 RPTTRGKNVSFKR 745
           RP  +GKN+SFKR
Sbjct: 721 RPAAKGKNLSFKR 733

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/758 (54%), Positives = 537/758 (70%), Gaps = 39/758 (5%)

Query: 20  ASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSID 79
           + E    LL KVVN +RAAS+LAAQDVDFYR++D+D +  L+  S+++ +M+N ++LSID
Sbjct: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64

Query: 80  EHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGK 139
           E+ + ++  +E + D+WKDFGN+MDNL EKSD S+D + R    +N  + +QY+ +FSG+
Sbjct: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124

Query: 140 DSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPH 199
           D  P K++ KPQLKF TPIDN+ESHPFIPLLKEKP ALKPL +S++MI  +E SP HYP 
Sbjct: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184

Query: 200 PYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEH 259
           PYEYEIDHQEYN  ILQ K  IPS  W  +EPIW+++ + L+S++ DL+ + EIAVDLEH
Sbjct: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244

Query: 260 HDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQ 319
           HDYR+YYG+ CLMQ+STR+ DYL+DTL LREDL ILN VF NP I KVFHGAFMDIIWLQ
Sbjct: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304

Query: 320 RDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAY 379
           RDLGLYVVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWRIRPLSK M AY
Sbjct: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364

Query: 380 ARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP--ITPSSKVYSPT 437
           ARADTHFLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS +RP  +  +  VYSP 
Sbjct: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424

Query: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497
           EK++PW+ +M+QYNI P++E L+K+LY+WRD IARRDDESPRF+MPNQLL +LVAYTPID
Sbjct: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484

Query: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTH-------KESAEIVSSKFKSASL 550
             GVVS+SN VTD+VR N+KILANLIK+ L  MKD         +E   +V       S 
Sbjct: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLS- 543

Query: 551 EAITVSQIRDIMDRFSVFS---SNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLP 607
           + +T+ Q++++  +F + S   +NSV     + +     LF  I   ++  I Y   G  
Sbjct: 544 QKLTIHQLQNLKSKFQLLSDKFNNSVK--TRLSNHDQLYLFDGISFADDVTIKYFADG-K 600

Query: 608 HKVKVEDMRDRAQRFNSALVGLEDIKFEVE--------------KPVNVEKSEMVKIETT 653
            +   E  ++R+++F+ A+  LE++++ +                P+ V  +   ++   
Sbjct: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEM 660

Query: 654 PEPPTKIEDPDEVVVLKKKRIHK--KQVAKRSDVAAEEAVDYSKIPNVLS----SKPGQN 707
            E P   ED DEV+VL+K   +K  K   K  +    E +DY K   VL+    S+ G+N
Sbjct: 661 IEKP---EDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRN 717

Query: 708 NKQQRKRRFDPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745
           N   +++RFDP    +EGP APKK++  TRGKNVSFKR
Sbjct: 718 NNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/740 (53%), Positives = 529/740 (71%), Gaps = 19/740 (2%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M  E    LLS VVN +RA+S+LAAQDVDFYR+LD + S  +   + +L +MVN I+LSI
Sbjct: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           DE++++L+  +EE+++ WK   NI+DNL EKSD SLD L   +    +    +Y  + + 
Sbjct: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
            ++ P KR+ KPQLKF  PIDNSESHPFIPLLKEKPNALK + +S ++I ++EN P HY 
Sbjct: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
           HPYEYEID+Q YN +ILQ++  IPSK W  +E +W+++  +L  ML D+K   EIA+DLE
Sbjct: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHDYR+YYG+VCLMQ+STRE DYLVDT+ LR DL +LNEVFT+PS+VKV HGAFMDIIWL
Sbjct: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLY+V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR+RPLSK MTA
Sbjct: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YARADTHFLLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK+RP  PS  VYS  E
Sbjct: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           KE+PWR LM+QYNI  ERE+L+K L+EWRD+IARRDDESPR+IMPNQL+  LVAYTP D 
Sbjct: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSA--SLEAITVS 556
            GV+S S  VTD+VR N+KI+ANLIK+AL   KD +++   +  +  + +  S + +TVS
Sbjct: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540

Query: 557 QIRDIMDRFSVFSSNSVT---EDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVE 613
           QI++    F   +    T   + +   S A S  FG +   ++ DI+   +G  H VK +
Sbjct: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSL--SKKLDIIEYKNGEKHSVKQQ 598

Query: 614 DMRDRAQRFNSALVGLEDIKFEV---EKPVNVEKSEMVKIETT---PEPPTKIE-DPDEV 666
            +  R   +   +  L ++++E+   ++P  ++K ++ +++ T      P K E D DEV
Sbjct: 599 QLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEV 658

Query: 667 VVLKK--KRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDSE 724
           VVLKK  ++ +K ++ +   +   + +DYSK   +L     +  ++ +KR+FDP    +E
Sbjct: 659 VVLKKVNRQPNKTKLEENEKI---DFIDYSKSEKILKGDKQRKKRESKKRQFDPFAASNE 715

Query: 725 GPRAPKKKRPTTRGKNVSFK 744
           GP+A +K++  TRG+N+S+K
Sbjct: 716 GPKAARKRKSGTRGRNLSYK 735

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/746 (53%), Positives = 517/746 (69%), Gaps = 35/746 (4%)

Query: 27  LLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLE 86
           LLS VV+ +RAASSLAAQDVDFYRNLD++ S  L   S ++T M+N ++LSI+E+++ LE
Sbjct: 9   LLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELE 68

Query: 87  LKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQPTKR 146
             +E +   WKDF N+MDNL EKSD SLD + R+  SN++ ++ QYL D +  DS P+KR
Sbjct: 69  SGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKR 128

Query: 147 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYEYEID 206
           V KPQL+F  P+DNSES PF+PLL +KP+++K  +DSL +I   E  P HY HPYE EID
Sbjct: 129 VTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEID 188

Query: 207 HQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYY 266
            QEYN ++LQ+   + S+PW+ SE  W+++   L+SML+ LK   EIAVDLEHHDYRSYY
Sbjct: 189 KQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYY 247

Query: 267 GVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYV 326
           G+VCLMQ+STR+ D+LVDTL LR++LHILNEVF +P+I+KV HGAFMDIIWLQRDLGLYV
Sbjct: 248 GIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYV 307

Query: 327 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHF 386
           V LFDTYHAS+A+G PRHSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM AYARADTHF
Sbjct: 308 VSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHF 367

Query: 387 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENPWRVL 446
           LLNIYDQ+RN+LI  NKLA VL+ESRNVAKRRFEYS++RP  PS  V++P EKE PWR L
Sbjct: 368 LLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTL 427

Query: 447 MYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVVSLSN 506
           +YQYN+   + EL+K ++EWRD+IARRDDESPR+IMPNQL+ +LV YTPID  GV+S+SN
Sbjct: 428 VYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSN 487

Query: 507 GVTDHVRQNAKILANLIKSALRSMKDTHKESAEI-------VSSKFKSASLEAITVSQIR 559
            +TDHVR N+K++ANLIK +L  MK     +          +  KF S   + +T+SQI+
Sbjct: 488 VMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFAS---DKLTISQIQ 544

Query: 560 DIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDMRDRA 619
           ++   F   +SN    ++ +      ILF  I    + +IV  D    H V  E +  RA
Sbjct: 545 NMTALFKEIASNPSIIEKDVSKKIDPILFSNIF-LSKNEIVLYDHDKRHVVTNEQLAGRA 603

Query: 620 QR----FNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPTK------------IEDP 663
           +      N A      I  E    ++VE+ E  +      PP               ED 
Sbjct: 604 EEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDM 663

Query: 664 DEVVVLK--KKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDP--S 719
           ++++VLK  KKR + K   K+  +  +E +DYSK+  +LS +  +N+K   KR+ DP   
Sbjct: 664 NDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEKRENSK---KRKGDPFGE 720

Query: 720 FNDSEGPRAPKKKRPTTRGKNVSFKR 745
            N  EGP+A KK++   RGKNVSFKR
Sbjct: 721 ENGLEGPKAAKKRKQINRGKNVSFKR 746

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/752 (52%), Positives = 535/752 (71%), Gaps = 42/752 (5%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M+S+  D LLS +V  +RAAS+L+AQD+DF+++LD   SK ++  SSKL  ++N ++LSI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           DE++D++E  ++   + WKD G+IMDNL EKSDH+ D L R S  N   +++QYL D S 
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNS-INQGNSNVQYLDDSSR 119

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
            +  P+KR+EKPQL FKTPIDN+ESHPF PLL+ KP+AL+PLS+ L+     EN P HYP
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
           HPY YEID QEYN +ILQI+  IPS+PW+ ++P+W+++K +L+ +L +L++A EIAVDLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHDYRSYYG+VCLMQ+STRERD+LVDT+ LRE+LH+LNE+FT+PS++KVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWRIRPL+KPM A
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+ +RP   S+ V+SP E
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           K+ PWR LMYQYNI   RE L++ LYEWRD IARRDDESPR++MPNQLL +LVA  P D 
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSASL-EAITVSQ 557
            GV+S+SN +TD+VR N+K+L+NLIK  L S+K+    +    SS+ +   L + +++SQ
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQ 539

Query: 558 IRDIMDRFSVFSSNSVTEDRSMDSTAS-SILFGKILPYEEGDIVYE-DSGLPHKVKVEDM 615
           I+++  +F+  +S     + + +S    SILF       +GD ++  D  + +    + +
Sbjct: 540 IQNMCLQFNSLASKVKKANSATNSMPKVSILF-------DGDHIFSNDRAVLYSKNSKIV 592

Query: 616 RDRAQRFNSALVGLEDIKFEVEKP-----VNVEKSEMVKI--------------ETTPEP 656
            D  Q     L   E +K EV++P     VNV   E  ++              ET P  
Sbjct: 593 IDENQLQERKLEVSEKLK-EVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLE 651

Query: 657 PTKIEDPDEVVVLKKKRIH----KKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQR 712
             K    DE++VLKKK+ H    +K+V   +DV   E +DY     +L +    + ++  
Sbjct: 652 TNK----DEIIVLKKKKRHEPQDRKKVGNSTDV---EPMDYKNAEKLLGNSKKSSKQKTT 704

Query: 713 KRRFDPSFNDSEGPRAPKKKRPTTRGKNVSFK 744
           KRRFDP  +++ GP++ KK++  T GKN+SFK
Sbjct: 705 KRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/746 (52%), Positives = 508/746 (68%), Gaps = 27/746 (3%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M SE    LLSK V  +RA+SSL  QDV F+ NLD + +  ++   +++ EM+N I+ SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAA-DLQYLGDFS 137
           DE+        E++ + W+DF N+ DNL EKSD S+D + + +  N  A  ++QYL D  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 138 GKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHY 197
           G DS   KR+ KPQL F  P+DNSES PF PLL EKPNALKPL +SL+M+   EN P HY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 198 PHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDL 257
           P+PY+YEI +QEYN +IL+ +  IPS PW  SEP+W++S   L+S+L+DLK   E+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 258 EHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIW 317
           EHHDYRSYYG+VCLMQ+STR+ DYLVDT+ LR++LHILN+VFT+P + KVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 318 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 377
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWRIRPLSKPM+
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 378 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPT 437
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK+RP      V++P 
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497
           EKE+PWR LM+QYN+ PE+EELVK LYEWRD IARRDDESPR+IMPNQLL +L AYTP D
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSMK----DTHKESAEIVSSKFKSASLEAI 553
            + +VS+++ VTD VR N+K+LANLIKS + S K     ++  + E  S+ F       +
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPF------VL 534

Query: 554 TVSQIRDIMDRFSVFSSN-SVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKV 612
           T+SQI+DI  RF+  + N   +  + +     S  FG  L   +  + Y D+     V  
Sbjct: 535 TLSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKT-TPVSQ 592

Query: 613 EDMRDRAQRFNSALVGLEDIKFEVEK----------PVNVEKSEMVKIETTPEPPTKI-E 661
             +  R+++FN  +    DI++++            P     +E    +T  +PP  I E
Sbjct: 593 SVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKE 652

Query: 662 DPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKP--GQNNKQQRKRRFDPS 719
           D DE+VVLKK +    +     + A  E VDYSK   VL  +    +      K+RFDP 
Sbjct: 653 DMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPF 712

Query: 720 FNDSEGPRAPKKKRPTTRGKNVSFKR 745
              SEGP+APKK++  T+GKN SFKR
Sbjct: 713 SAISEGPKAPKKRKAVTKGKNASFKR 738

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/751 (54%), Positives = 517/751 (68%), Gaps = 34/751 (4%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           MA E+++ LL KVV  +RAA++LAAQDVDFYR+LD+  +K L   S++L  M+N  +L I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           D++   LE  +E++ D  KDF N+MDNL EKSD SLD L R    +   A L YL D + 
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
            D  P KR+ KPQ++F+ PIDN+E+HPF PLL+ KP+AL+PLSD +R+++ +E+ P HYP
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
            PYEYEI++QEYN +IL+I   IPSKPWD SEP+W+++K +L SML+DLK + EIAVDLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHDYRSYYG+VCLMQVSTR+ DYLVDTL LR+DL +LNEVF NP IVKVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSK M+A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSKYRP  P+S VYSP +
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           + + W+VLM QYNI  E+E LVK+LYEWRD IARRDDESPR++MPNQLLA LV YTP+D 
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKE-SAEIVSSKFKSASLEAITVSQ 557
            GV+S+S  VTDHVR NAK LANLI  +L+ + D   +   E V  K +    + +TV Q
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQ 539

Query: 558 IRDIMDRFSVFSS--NSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDM 615
           I   + +F   S     +++  +  +++SSI+FG IL    G + Y  S L   V  + +
Sbjct: 540 IESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRS-LKKPVTDKQI 598

Query: 616 RDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPP------------------ 657
             R    + A   LE I  E    +  E       E T EP                   
Sbjct: 599 EKRKLELSEA---LEFIDAETATTIQEEDRGS---ELTHEPADDKKVSENDESKKEEAKE 652

Query: 658 -TKIEDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRF 716
               ED +E++ LKK +   K+  + ++   EE +DY K   +L ++  + +K  +KR F
Sbjct: 653 TEPEEDKNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETE--KKSKSTKKRAF 710

Query: 717 DP--SFNDSEGPRAPKKKRPTTRGKNVSFKR 745
           DP  + ND+     PKKKR   RGK+ SFKR
Sbjct: 711 DPYAASNDAGNAPKPKKKRRMARGKSASFKR 741

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/769 (51%), Positives = 540/769 (70%), Gaps = 52/769 (6%)

Query: 25  DVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDS 84
           D LL +VV  +RA+ +LAAQDVDFYR++D+  +K L+  +S+L +M+N ++L++DE+ ++
Sbjct: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 85  LELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQPT 144
           L+  +E + D WKDF N+MDNLLEKSD S+D L R+ N+N + +++QYL ++SG+D   +
Sbjct: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 145 KR--VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYE 202
           KR  + KPQL+F  P+DN+E+HPFIPLLK KPNALK L +S++++  +EN P HY  PYE
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 203 YEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDY 262
           YEID+Q YN  ILQ+   IPS+PW  +  IW+++  +L+SM++DL N  E AVDLEHHDY
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 263 RSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDL 322
           R+YYG+VCLMQ+STR +DY+VDTL+LR  L  LNE FTNP I KV HGAFMDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 323 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARA 382
           GLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +YAR+
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 383 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENP 442
           DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY KYRP+  SS VYSP EK +P
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 443 WRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVV 502
           W+ LMYQYNI   +E L+K+LY+WRD IARRDDESPR+IMPNQLL +LVAY P++  GVV
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 503 SLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIV---------SSKFKSASL-EA 552
           S+SN VTDHVR N+KILANLIK+ L  +KDT    + I+         S+   +  L E 
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565

Query: 553 ITVSQIRDIMDRF-SVFSS----NSVTED-RSMDSTASSILFGKILPY--EEGDIVYEDS 604
           +++ Q+  +  +F S++S       VT + R+ +   S +L    + +  E+G    + S
Sbjct: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625

Query: 605 GLP---HKVKVEDMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPT--- 658
             P    K+  E++  R + F+ A+  L+ +++ +  P N    E+V +E+  + P+   
Sbjct: 626 VSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPEN----EIVVVESEQQEPSIPA 681

Query: 659 ------------KIEDPDEVVVLKK--KRIHKKQVAKRSDVAAE---EAVDYSKIPNVLS 701
                       K ED DE++VLKK  +   KK+  K SD   E   E +DYSK+  VL 
Sbjct: 682 ANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLD 741

Query: 702 SK-----PGQNNKQQRKRRFDPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745
           +        +NN   +++RFDP   ++EGPRAPKK++  TRGKNVSFKR
Sbjct: 742 NSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/742 (50%), Positives = 524/742 (70%), Gaps = 20/742 (2%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M+S++ D +L KV+  +RA+++LA+QDV+F++++D   +  L+     +  ++N I+LSI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           D +++ L+   E + ++ K+F N+MD L EK+D SLD LNR S++N++  ++Q+L D + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
            ++ P++R+ KPQL FKTP+DNSESHPF PLL EKPNALK + +S +++   E+ P H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
            PYEYEI +QEYN +IL+ K  IPS  W  +  IW+++  +L+ M+++LK + EIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHD+RSYYG+VCLMQ+STR +DY+VDT+ LR+DL +LNEVFTNP I KVFHGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P  P + +++P E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           KE+PWR LMYQYNI  ++E L+++LYEWRD++ARRDDESPR++MPNQLL +LVAY P+D 
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSA------SLEA 552
           I VVS+S+ VTDHVR+N+K LANLIK  L  +K    +S   ++++  S+       L+ 
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKS---INNRLPSSLDVSQDELQF 537

Query: 553 ITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKV 612
           +   +I  +   F    +      +S  +  SS++  +IL + E  + Y + G    V+ 
Sbjct: 538 LPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHN-GSACSVEE 596

Query: 613 EDMRDRAQRFNSA--LVGLEDIKFEVEK-----PVNVEKSEMVKIETTPEPPTKIEDPDE 665
            +++DR   +  A  L   ++I   +E      P+  E++   K +     P K ED DE
Sbjct: 597 SELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDE 656

Query: 666 VVVLKKKRIHKK-QVAKRSDV-AAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDS 723
           +VVLKKK+IH   Q AK  D    EE VDYSK  N+L+S   +  K+ +KR FDP  +  
Sbjct: 657 IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSSTG 715

Query: 724 EGPRAPKKKRPTTRGKNVSFKR 745
           EGP+A KK+R  T+GK +SFK+
Sbjct: 716 EGPKAAKKRRLVTKGKKISFKK 737

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/753 (50%), Positives = 517/753 (68%), Gaps = 41/753 (5%)

Query: 23  NSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHH 82
           N+D LL  VV+ +RAAS+LAAQDVDFYR+LD++ +  L + S K+T+M+N I+ S+DE+ 
Sbjct: 2   NADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENS 61

Query: 83  DSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQ 142
           + L   +E + + WKD GN++D+L E +DHS+D L++ S  +++   ++YL D    +S 
Sbjct: 62  EGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESD 121

Query: 143 PTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYE 202
              R+ KPQL F  P+DNSE+HPF PLL +KPNA+ PL + L++++  E++P HYP PYE
Sbjct: 122 NVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYE 181

Query: 203 YEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDY 262
            EID QEYN  +LQ    IPSK W+ +E IW++++ +L +ML +LK A E+AVDLEHHD+
Sbjct: 182 TEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDF 241

Query: 263 RSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDL 322
           RSYYG+ CLMQ+STR  DYLVDT+ LR+ L +LN VFT+P I K+ HGAFMDIIWLQRDL
Sbjct: 242 RSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDL 301

Query: 323 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARA 382
           GLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSK+YQLADWR RPLSK M AYARA
Sbjct: 302 GLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARA 361

Query: 383 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENP 442
           DTHFLLNI+DQLRN LI+ +KLA +L+ESR VAKRRFEYSKY+P  PSS V+SPTE + P
Sbjct: 362 DTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMP 421

Query: 443 WRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVV 502
           WR ++YQYNI  ++ ELVK L+EWRD IARRDDESPR+IMPNQL+A+LV Y P +  GV+
Sbjct: 422 WRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVI 481

Query: 503 SLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFK---------SASLEAI 553
           S++  +TD VR NAK +ANLIKS L  MK+ +  S  +VS+  K         S S    
Sbjct: 482 SVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNI-STTVVSTTAKDKETSSNDLSTSQIKF 540

Query: 554 TVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVE 613
            VSQ  +I++++S  S+NS   D +      S++F KI    + DI+  D G  H +  +
Sbjct: 541 IVSQFENILEKYS--SNNSNLNDVTSKEGKDSLVFSKIFNSRD-DIITYDKGTKHLITEQ 597

Query: 614 DMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPTKI------------- 660
            + DR +  ++A+   E+I F +E  V     E +K +  PEP   I             
Sbjct: 598 QLSDRQKEVDAAMKQAEEIAFSME--VQDTHKESMK-QPFPEPEEVISQSHLPAFEDKEE 654

Query: 661 -EDPDEVVVLK--KKRIHKKQVAK-RSDVAAEEAVDYSKIPNVLSSKPGQNNKQQ--RKR 714
            ED DE++VLK  K R +++   + RS  +    +DYSK   +LS    Q+N+++   KR
Sbjct: 655 QEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILS----QDNRRRTPNKR 710

Query: 715 RFDP--SFNDSEGPRAPKKKRPTTRGKNVSFKR 745
           ++DP  + N+    +  K++RPT + +NVSFKR
Sbjct: 711 KYDPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/743 (52%), Positives = 515/743 (69%), Gaps = 24/743 (3%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M     D LL KVV+ IRA+S+LAAQDVDF+R+L R   K L   S+++  ++N ++ SI
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           D++ + L   +E +++ WKDF N+MDNL E SD S D L R   S      L++L + S 
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPL-SDSLRMIETEENSPGHY 197
            DS P+KR+ KPQL FK P++N+E  PF+PLLKEKP AL+PL SD   ++   +  P HY
Sbjct: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISD---IVPGNDAVPEHY 177

Query: 198 PHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDL 257
             PYEYEI+HQEY  +++     IPSKPW+ +E +W+++   LK+M+ DLK+  EIAVDL
Sbjct: 178 AQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDL 237

Query: 258 EHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIW 317
           EHHDYRSYYG+VCLMQ+STRERDYL+DT+ LR+DL ILNEVF NP I+KVFHGAFMDIIW
Sbjct: 238 EHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIW 297

Query: 318 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 377
           LQRDLGLYVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M 
Sbjct: 298 LQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMN 357

Query: 378 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPT 437
           AYARADTHFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK+RPI PS  VY P 
Sbjct: 358 AYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPI 417

Query: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497
           +K +PW+VLM+QY+I+P REELVK LY+WRD IARRDDESPR++MPNQLL  L    P +
Sbjct: 418 DKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTE 477

Query: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSM-KDTHKESAEIVSSKFKSASLEAITVS 556
            I V+S+++ VTDHVR N+ +LA+LIK+ L S  K++ K + E  ++   +ASL  +TV 
Sbjct: 478 PINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASL--LTVP 535

Query: 557 QIRDIMDRFSVFS-SNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDM 615
           QI+ +   F+  S + ++ ++   D  +SSI F  IL  E+  + Y  + + H  K E  
Sbjct: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSSI-FTDILTSEDDAVNYVGNNMDHITKKELG 594

Query: 616 RDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMV---------KIETTPEPPTKIEDPDEV 666
           +  A+   S     E   + +  P   ++S  +         +++ +P PP   ED DE+
Sbjct: 595 KRAAKALQSMEQFDEATSYYMPIPEIAKESNTMEEIRPPAPEEVKESPSPPK--EDMDEI 652

Query: 667 VVLKKKRIHKKQVAKRSDVAAEE--AVDYSKIPNVLSSKPGQNNKQQRKRR--FDPSFND 722
           + LKK +  K Q  K   ++  E  AVDY+K   VL++   +N  +++++   +  S + 
Sbjct: 653 ITLKKIKKQKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAASNHS 712

Query: 723 SEGPRAPKKKRPTTRGKNVSFKR 745
           S+ PRAPKK++P  R +NVSFKR
Sbjct: 713 SDAPRAPKKRKPVNRERNVSFKR 735

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/750 (50%), Positives = 500/750 (66%), Gaps = 27/750 (3%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M+ +N + LL  +V V+RA+++LAAQDVDFY++LD+  S  L   ++   ++ N ++LSI
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           DE+   LE  ++ I D W  F NIMDNL+EKSDH +D L++ +N N    +  +L + S 
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
            +S P+KR+EKPQL F  P+DN++S PF PLL EKPNALKPL DSL ++      P HY 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
            PYEYEID+QEYN  +++I+   P KPW+ +  IWI++K +L  +L DL+   EIAVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHD RSYYG+ CLMQ+STRE+DY+VDT+ LR+DL +LNE+FTNP+I KVFHGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR RPL+  M A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K+RP  P   +Y+  E
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           KE PW+ L+ QYNI  E+E LV+ L+EWRD+IARRDDESPR+IMP Q+L +L++YTP D 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVS---SKFKSASLEAITV 555
            GV+S+SN VT+HVR N+  LANLIK AL S K     S    +   S+  +     I++
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISI 565

Query: 556 SQIRDIMDRFSVFSSN-SVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVED 614
           ++I +I  +F+  S + + ++  +     SS+LF  I+        Y         K ED
Sbjct: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDK-TTSFKSED 624

Query: 615 MRDRAQRFNSALVGL------------EDIK---FEVEKPVNVEKSEMVKIETTPEPPTK 659
           M  R  R +  L GL            EDIK      E P+   + +  + +TT E    
Sbjct: 625 MIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEIN-- 682

Query: 660 IEDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRR-FDP 718
            ED +E++VLKK     ++  K +D  +   VDYSK   +   K    N   +KR+ FDP
Sbjct: 683 -EDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDP 741

Query: 719 SFNDSEG---PRAPKKKRPTTRGKNVSFKR 745
             ND +    PRA KK++  TRGKN+S+KR
Sbjct: 742 YNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/750 (50%), Positives = 511/750 (68%), Gaps = 29/750 (3%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           MAS + D L  ++V+ IRAA++L+AQD+DFYR+L     + L   S+ +  ++N ++LS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           DE+++ L+   +   D WK+  N+MDN+ EKSDH+ D++   S+S N   ++QYL D S 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
            DS P+KR+EKPQL FKTP+DN+E HPF PLLKEKP+ALKPL +SL +   EEN P HYP
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
           HPYEYEID Q YN ++L+++  I  +PW+A+EPIW+++  +L  ML++LK   E+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHDYRSYYG+VCLMQ+S+R +D+LVDT+ LR+DLH+LN +  +P++VKVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+ +RP  P S VYSP E
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
              PWR LMYQYN+ P +E L+K LYEWRD +ARRDDES R++MPNQLL +LV+ +P + 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSASLEAITVS-- 556
            GV+S+S  VTD+VR NA+ LANLIK  L ++K      AE  SS+ ++ S  A T+S  
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSE-RALSNPAATLSLH 539

Query: 557 QIRDIMDRFSVFSSNSVTEDRSMDST-ASSILFGKILPYEEGDIVYEDSGLPHKVKVEDM 615
            I+++ D F      +  +  S+ S  +SS+LF   L      + Y + G  H +    +
Sbjct: 540 MIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTN-GQKHVIGDNVL 598

Query: 616 RDRA----QRFNSALVGLEDIKFEVEKPVNVEKSE--MVKIETTPEPP------TKIEDP 663
           + R     Q+F S  V  E +  ++E P +   SE   V  + +P  P       + ++P
Sbjct: 599 QTRKHALLQKFTSQPV--EPVT-DIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEP 655

Query: 664 D----EVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVL----SSKPGQNNKQQ-RKR 714
           D    E+VVL+KK+    Q  K +  +  E VDYS    VL    SS   + +K + RKR
Sbjct: 656 DFEKSEIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPRKR 715

Query: 715 RFDPSFNDSEGPRAPKKKRPTTRGKNVSFK 744
           +FDP   D+  P   KKK   ++GK++SFK
Sbjct: 716 KFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/748 (49%), Positives = 507/748 (67%), Gaps = 25/748 (3%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M+SE+ D LLS +V  +R++S+LAAQD+DFY++LD + +  L+  S+ +  ++N ++LSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138
           D ++D ++  ++   D WK   NIMDNL EKSDH+LDN+   +  N     L+YL D   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198
            +++P+KR+EKPQL FKTP+DN+E HPF PLL+ KP++L+P   SL+M+  EE+ P HYP
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258
           HPYEYEIDHQ+YN +IL     IPSK WD +E IW+++   L  M ++L  A E+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318
           HHDYRSYYG+VCLMQ+S RE D++VDT+ LRE+L+ILN++FT+P++ KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWRIRPL+KPM A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS +RP  PSS V+SP E
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498
           K+ PW+ +M+QYNI   +E L++ LYEWRD IARRDDESPR++MPNQLL +LVA  P + 
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSASLE---AITV 555
           I V+S+S+ V++H+R N+K++ANLIK  L  +K     SA  +    +S   +    IT 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 556 SQIRDIMDRFSVFSS--NSVTEDRSMDSTASSILFGKILPYEEGDIV------------Y 601
           SQI+ I + F   +S  NS   +   +S   S+LF  I   +    V            +
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNEQNS-EKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599

Query: 602 EDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPTK-- 659
           E     H++     ++   R   ++V   +   E E P  V   E      T +P  +  
Sbjct: 600 ELLKRQHEITRTLEQEYTDRQAQSIVLPSN---EDEAPTQVSNDENRNEVITSDPSQEEI 656

Query: 660 IEDPDEVVVLKKKRIHKKQVAKR-SDVAAEEAVDYSKIPNVL-SSKPGQNNKQQRKRRFD 717
            E+ DEV+ L+K++       K  S  A+ E +DY+   ++L S+K   N+++ +KRRFD
Sbjct: 657 EENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFD 716

Query: 718 PSFNDSEGPRAPKKKRPTTRGKNVSFKR 745
           P   +  GP+  KKK    +GKNVSFKR
Sbjct: 717 PYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/752 (48%), Positives = 497/752 (66%), Gaps = 30/752 (3%)

Query: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78
           M+S+N D LL+K++  +RAASSLAAQD+DF R+LD    ++L   S  +  ++N ++LS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAAD--LQYLGDF 136
            + ++ LE+ ++ +   WKD  NI+DNL EKSDHSLD L +  +S++S  D  +QYL   
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 137 SGKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGH 196
           S +D + ++R+ KPQL+FK P+DNSE HPF PLLK KP+ALKPL +   +    E  P H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 197 YPHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVD 256
           YPHPYEYEID+Q Y+ ++L IK  I    WD +EPIW+++   L  ML  LKN  EIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 257 LEHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDII 316
           LEHHDYRSYYG+VCLMQ+STRE D+LVDT+ LR+DL +LNE+FT+PSI+KVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 317 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM 376
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWRIRPLSKPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 377 TAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSP 436
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+ +RP   S  V+SP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 437 TEKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPI 496
            EK++PWR LM QYN+   +E L++ LY+WRD++AR+DDES R++MPNQLL +LV   P 
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 497 DVIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKE--SAEIVSSKFKSASLEAIT 554
           D  G++++ + + DHVR NA++L N+I   +  +K    E  S E V++ + SA    ++
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 555 VSQIRDIMDRFSVFSSNSVTEDRSMDSTAS--SILFGKILPYEEGDIVYEDSG--LPHKV 610
           VS I+  MDR   F  + V       S+    S+LF   L  +   + Y   G  L +  
Sbjct: 541 VSLIK-TMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDR 599

Query: 611 KVEDMR-DRAQRFNSAL------VG--LEDIKFEVEKPV----NVEKSEMVKIETTPEPP 657
           ++ D + D +Q+F+         +G  +E +    E P     NVE     K E+     
Sbjct: 600 ELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPS--KEESKNNSD 657

Query: 658 TKIEDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQN----NKQQRK 713
              ED  E++VLK+KR +       S    +E VDY+ + ++L +   Q+     +   K
Sbjct: 658 DLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDK 717

Query: 714 RRFDPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745
           R+F      S G  A KK  P ++GK VS+K+
Sbjct: 718 RKFHSDLQGSIGAAAIKK--PRSKGKTVSYKK 747

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/739 (47%), Positives = 489/739 (66%), Gaps = 36/739 (4%)

Query: 27  LLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLE 86
           +L++VV  IRA+S+++AQDVDFY++LD   S+ L   S+KL  ++N +V+SID+++D +E
Sbjct: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIE 71

Query: 87  LKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQPTKR 146
                + + W + G +MD L EKS+H+L  + +   SN    +LQYL D          +
Sbjct: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKK-KGSNIIGNNLQYLDDSQPLTDTTLTK 130

Query: 147 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYEYEID 206
           + KPQ  F  P+DN+ESHPF PLL +KPNAL+PL D L++   EE  P HYPHPYEYEID
Sbjct: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190

Query: 207 HQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYY 266
           HQEY+ ++L+I+P IPSKPW+ ++  W+++  TL  M+ +L  A E+A+DLEHHDYR+YY
Sbjct: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250

Query: 267 GVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYV 326
           G+ CLMQ+STRE D+LVDT+ LR+ L +LNE+FTNP ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310

Query: 327 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHF 386
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+ AYARADTHF
Sbjct: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370

Query: 387 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENPWRVL 446
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K+RP   +S+VYSP E+E+PWR L
Sbjct: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430

Query: 447 MYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVVSLSN 506
           ++ YNI   +  L+K LYEWRD IARRDDESPR++MPNQLL ALV   P D  G++S+++
Sbjct: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490

Query: 507 GVTDHVRQNAKILANLIKSALRSMKD------THKESAE-IVSSKFKSASLEAITVSQIR 559
            VT+HVR NAK L+ LIK  L S +D       H +S + +V SK     ++A   +   
Sbjct: 491 FVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGDVKANHQN--- 547

Query: 560 DIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDMRDR- 618
              D+++  S   V    ++     S+  GK LP  E  + Y+ + + H ++   + DR 
Sbjct: 548 --FDQYTRKSRELVIHGPTV-VRGCSLFPGKPLP-NEAYVSYQGTQV-HHIEPTVLDDRR 602

Query: 619 ---AQRFNSALVGLEDIKFEVEKP----VNVEKSEMVKIETTPEPPTKI-EDPDEVVVLK 670
              AQ   +     E ++  VEK     V+ E  E    E + +  +++ ED DE+VVLK
Sbjct: 603 ELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVVLK 662

Query: 671 KKRIHKKQVA--KRSDVAAEEAVDY---SKIPNVLSSKPGQNNKQQRKRRFDPSFNDSEG 725
           +++   +  +  K ++   +E +D+    KI    +S P ++ K     RFDP    + G
Sbjct: 663 RRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTK-----RFDPYAIQASG 717

Query: 726 PRAPKKKRPTTRGKNVSFK 744
           P    K+R  TRG   SFK
Sbjct: 718 PDG-VKRRKKTRGIQKSFK 735

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/745 (46%), Positives = 486/745 (65%), Gaps = 32/745 (4%)

Query: 18  AMASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLS 77
           A  SE+  VL ++V+  IRA+S++ AQDV FY+NLD   +  + + S++L  ++N I+LS
Sbjct: 4   AHGSEDGSVL-NQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLS 62

Query: 78  IDEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFS 137
           +DE++D +E   E +   W + G +MD L EKS+H+L    +  N   S   +QYL D  
Sbjct: 63  VDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKT-VQYLDDSP 121

Query: 138 GKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHY 197
                  K++ KPQL FK PIDNSESHPF PLLK+KP+AL+ L +SLR+   +E+ P HY
Sbjct: 122 SLHDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHY 181

Query: 198 PHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDL 257
           P PYEYEIDHQEYN ++LQI   +PS PWD +E  W+++   LK ML +L  A+EIA+DL
Sbjct: 182 PQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDL 241

Query: 258 EHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIW 317
           EHHDYR+YYG+ CLMQ+STRE+D+L+DT+ LR+DL ILNEVFT+P I KV HGAFMDIIW
Sbjct: 242 EHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIW 301

Query: 318 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 377
           LQRDLGLY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR+RPL K + 
Sbjct: 302 LQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALK 361

Query: 378 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPT 437
           AYARADTHFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++ +RP   +S V+SP 
Sbjct: 362 AYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPI 421

Query: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497
           E+E+PWR LM+QYNI   +  LV+ LYEWRD++ARRDDESPR+++PNQLL +L    P  
Sbjct: 422 EREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTT 481

Query: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSK--FKSASLEAITV 555
              +++ S  VT+H+RQNAK LA LIK   +S++ +  E  ++++S    +++S   ++ 
Sbjct: 482 PALIMATSTFVTEHIRQNAKSLALLIK---KSLESSSNEFGQLLNSANTVQNSSPTKMSS 538

Query: 556 SQIRDIMDRFSVFSSNSVTEDRSMD---STASSILFGKILPYEEGDIVYEDS--GLPHKV 610
             I      F  F  +  + +++ D   S  SS+   K +P EE  + Y++S   L    
Sbjct: 539 EDIEKNSRMFEKFLED-FSYEKAADCGISLGSSLFQKKFVPCEEY-VSYQESRASLVDHN 596

Query: 611 KVEDMRDRAQRFNSALVGLEDIKFEV---------EKPVNVEKSEMVKIETTPEPPTKIE 661
            +E+ R +  +   A   +   +  +         +K    E +E  + E       + E
Sbjct: 597 SLENRRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENK----ARKE 652

Query: 662 DPDEVVVLKKKRI--HKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPS 719
           + DEV+VLK+++    K+Q A      + E +D      +L +    NN ++ K+RFDP 
Sbjct: 653 EMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAP--SNNVRRPKKRFDPY 710

Query: 720 FNDSEGPRAPKKKRPTTRGKNVSFK 744
              + GP +  KKR  T+G   SF+
Sbjct: 711 ATLAAGPPS-VKKRKKTKGLQKSFR 734

>Smik_13.389 Chr13 (612617..613213) [597 bp, 198 aa] {ON} YMR184W
           (REAL)
          Length = 198

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 10/67 (14%)

Query: 2   GHEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAASSLAAQDVDFY-RNLDRDFSKIL 60
           GH D+         +Y + S N D LL+K+ N+    S L+++++DFY + LD + +KIL
Sbjct: 96  GHTDR---------QYNIISYNEDELLTKINNLSEPGSKLSSKELDFYKKKLDSNIAKIL 146

Query: 61  QSKSSKL 67
           QS  +K+
Sbjct: 147 QSDHTKI 153

>TDEL0F00670 Chr6 (112308..114224) [1917 bp, 638 aa] {ON} Anc_1.493
           YML046W
          Length = 638

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 11/94 (11%)

Query: 180 LSDSLRMIETEENSPGHYPHPYEYEID-------HQEYNPNILQIKPEIPSKPWDASEPI 232
           + D + +I+ + N+P  YP  Y+  +D        +  +PNIL  KP+I +   D +  I
Sbjct: 543 MMDPILLIQLKLNNPQWYPGRYKQSLDWHRSREFRENGHPNILDDKPQISNTVLDQTTKI 602

Query: 233 WINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYY 266
           + N +  L +     +N   I   L+H D  S Y
Sbjct: 603 FGNRQLPLPT----FRNLERINQPLKHDDIFSKY 632

>KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {ON}
           similar to uniprot|Q08686 Saccharomyces cerevisiae
           YOR251C catalyzes transfer of the sulfane atom of
           thiosulfate to cyanide to form sulfite and thiocyanate
          Length = 302

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 23/120 (19%)

Query: 327 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPL-SKPMTAYA----- 380
           VG F     +  + +  H L YLL NF  +K             PL + P T+++     
Sbjct: 99  VGNFSAPRCAWTLAVFGHELVYLLNNFPAYKAEG---------FPLDTTPRTSFSELEPS 149

Query: 381 --RADTHFL---LNIYDQLRNKLIESNKLAGV--LYESRNVAKRRFEYSKYRPITPSSKV 433
             ++D  F    +  Y+++ +KL+E  KLA V  ++++R + +   E S+ RP  PS  +
Sbjct: 150 DYKSDADFTKQEVVSYEEI-HKLVEDGKLAEVYNVFDARALPRFTGESSEPRPEIPSGHI 208

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 341 LPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIY 391
           L +  L  L     NF  + +YQ+A W+ R  ++  + +   D HF  NI+
Sbjct: 112 LVKGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>YMR252C Chr13 complement(775315..775719) [405 bp, 134 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YMR252C is not an essential gene
          Length = 134

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 61  QSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGN 101
           Q  SSK    + G+ + +DEH+DS  +     +D+WK F N
Sbjct: 66  QYPSSKTNVSLKGLSIGMDEHNDSPSVFGIFYNDIWKSFKN 106

>Suva_13.437 Chr13 complement(754591..755010) [420 bp, 139 aa] {ON}
           YMR252C (REAL)
          Length = 139

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 61  QSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIMDN 105
           Q  SSK    + G+++ +DEH+DS  +     +D+WK   N  +N
Sbjct: 69  QYPSSKTNVSLKGLIIGMDEHNDSPSVFGIFYNDIWKSLKNEPEN 113

>Smik_13.466 Chr13 complement(758422..758826) [405 bp, 134 aa] {ON}
           YMR252C (REAL)
          Length = 134

 Score = 30.4 bits (67), Expect = 8.1,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 43  AQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGN 101
           +Q  +F +   +++    Q  SSK    + G+ + +DEH+DS  +     +D+WK F N
Sbjct: 50  SQKQEFIQRFVKNYKH--QYPSSKTNVSLKGLCIGMDEHNDSPSVFGIFYNDIWKKFKN 106

>YOR251C Chr15 complement(802550..803464) [915 bp, 304 aa] {ON}
           TUM1Rhodanese domain sulfur transferase, accepts
           persulfite from Nfs1p and transfers it to Uba4p in the
           pathway for 2-thiolation of the wobble uridine base of
           tRNAs; also stimulates sulfur transfer by Nfs1p; may be
           mitochondrially localized
          Length = 304

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 95/214 (44%), Gaps = 16/214 (7%)

Query: 306 KVFHGAFMDIIWLQRDLGLYV---VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY 362
           KVF  A M  + +Q+D  L V   VG F +   +  +G+  H   YLL NF  ++   KY
Sbjct: 76  KVFDDA-MSNLGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLNNFNQYREF-KY 133

Query: 363 QLADWRIRPLSK-PMTAYARADTHFLLNIYD-QLRNKLIESNKLAGVL--YESRNVAKRR 418
            L   ++   S  P + Y  +++     I D +   +L++S +LA     +++R++   R
Sbjct: 134 PLDSSKVAAFSPYPKSHYESSESFQDKEIVDYEEMFQLVKSGELAKKFNAFDARSLG--R 191

Query: 419 FEYSKYRPITPSSKVYSPTEKENPWRVLM-YQYNIAPEREELVKDLYE--WRDVIARRDD 475
           FE ++  P +     + P  +  P+  L+  +    PE  E +    E   +D     D 
Sbjct: 192 FEGTEPEPRSDIPSGHIPGTQPLPYGSLLDPETKTYPEAGEAIHATLEKALKDFHCTLDP 251

Query: 476 ESPRFIMPNQLLAALVAYTPIDVIGV--VSLSNG 507
             P        ++ ++  T +++ GV  V L +G
Sbjct: 252 SKPTICSCGTGVSGVIIKTALELAGVPNVRLYDG 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 83,725,792
Number of extensions: 4006807
Number of successful extensions: 14137
Number of sequences better than 10.0: 171
Number of HSP's gapped: 14846
Number of HSP's successfully gapped: 174
Length of query: 745
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 628
Effective length of database: 40,065,477
Effective search space: 25161119556
Effective search space used: 25161119556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)