Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1746.26ON29529515670.0
Skud_15.1616.26ON29329513090.0
Smik_15.1696.26ON29129512511e-175
YOL001W (PHO80)6.26ON29329512391e-173
Kpol_1037.306.26ON3672457622e-99
ZYRO0C07634g6.26ON3822447536e-98
TDEL0G044306.26ON3472437481e-97
CAGL0E02541g6.26ON3422347201e-93
Kwal_56.224436.26ON2802337021e-91
KLTH0C11110g6.26ON2802417003e-91
TPHA0J003806.26ON3562547046e-91
ACR001C6.26ON3462396941e-89
SAKL0E01408g6.26ON3072476868e-89
Ecym_30296.26ON3512356881e-88
KNAG0I017506.26ON3242476833e-88
KLLA0D01287g6.26ON3452596498e-83
TBLA0A071606.26ON2682476392e-82
NCAS0D021506.26ON3692476126e-77
NDAI0C026406.26ON4272235359e-65
YIL050W (PCL7)7.240ON2852071891e-15
Smik_9.1407.240ON2851731783e-14
Suva_9.1497.240ON2861591722e-13
Skud_9.1197.240ON2851761712e-13
KAFR0I018407.240ON3251191564e-11
Ecym_43367.240ON3851011548e-11
KNAG0D016307.240ON4381691531e-10
Kwal_23.58077.240ON4651361531e-10
KLTH0A04268g7.240ON5801261486e-10
SAKL0F08602g7.240ON4741151478e-10
NCAS0A134807.240ON4481201442e-09
ADL075W7.240ON2071011392e-09
KAFR0L008807.240ON3131211413e-09
NCAS0E032207.240ON3411881413e-09
CAGL0M12342g7.240ON4571191413e-09
KNAG0L014707.240ON3541211362e-08
KLLA0C08305g7.240ON4091331343e-08
TPHA0C010907.240ON3851411316e-08
NDAI0A025607.240ON5031131318e-08
TDEL0H020207.240ON3631361291e-07
TBLA0D040707.240ON661601282e-07
Suva_5.1677.240ON424601244e-07
Smik_5.1897.240ON415601245e-07
YER059W (PCL6)7.240ON420651245e-07
ZYRO0C08118g7.240ON405601237e-07
Skud_5.1737.240ON420601228e-07
Kpol_1033.137.240ON250601201e-06
NDAI0E047707.240ON303761163e-06
YDL179W (PCL9)7.289ON3041491102e-05
Kpol_2000.147.289ON3101091093e-05
TBLA0C048507.289ON3681421085e-05
SAKL0C12100g3.70ON3141211032e-04
Suva_4.687.289ON3051461013e-04
Suva_14.503.70ON279961004e-04
TBLA0J006507.289ON363101987e-04
NCAS0A137707.289ON312108970.001
Ecym_35353.70ON370105970.001
TPHA0P008107.289ON24798950.001
TDEL0H015507.289ON309133960.001
Kwal_23.60067.289ON304109950.001
SAKL0F09856g7.289ON335109960.002
Smik_4.607.289ON305111950.002
Smik_14.423.70ON279106940.002
Skud_14.483.70ON27996930.003
YNL289W (PCL1)3.70ON27996930.003
Kpol_1020.163.70ON282107920.004
KLLA0E13223g3.70ON282104920.004
TBLA0A078903.70ON361112920.004
NDAI0A022707.289ON330146920.005
KNAG0A014903.70ON262128910.005
CAGL0E02233g3.70ON26698910.005
AFR159C7.289ON308109910.005
KNAG0B029307.289ON312102910.005
Skud_4.797.289ON30997900.008
ZYRO0C09284g7.289ON311116900.008
Smik_4.1107.289ON308112890.010
Ecym_80387.289ON314111880.013
KLTH0A05346g7.289ON301109880.014
Suva_4.1187.289ON309102880.014
YDL127W (PCL2)7.289ON308112870.016
TPHA0A005803.70ON289106860.023
ZYRO0C02068g3.70ON330105850.032
Kpol_1020.87.289ON296150840.042
CAGL0J09328g7.289ON297104840.043
YPL219W (PCL8)6.236ON492195830.059
AEL195W3.70ON237108820.061
KNAG0B019605.347ON227126810.082
NCAS0A098703.70ON29487810.083
Skud_4.1287.289ON308102810.092
NDAI0A060503.70ON28696810.094
TDEL0E007903.70ON254102800.10
TBLA0B084403.70ON268105790.14
Smik_6.4246.236ON492195770.35
ZYRO0B14410g4.333ON57468770.39
Kwal_23.52313.70ON256137750.48
KAFR0A082803.70ON24194740.54
KLLA0F05654g7.289ON31199740.65
KAFR0C015603.70ON26787740.71
TPHA0A032507.289ON28955730.92
NDAI0C019805.347ON226104711.2
CAGL0J10846g5.347ON229138711.2
KLTH0A01584g3.70ON28187711.5
KLLA0B02024g6.236ON527102712.0
TPHA0E027506.236ON60575702.6
TPHA0B004204.343ON110065702.8
NDAI0C043005.347ON240107683.3
KNAG0F018706.236ON483108684.0
NDAI0C031405.117ON70541694.2
SAKL0A03938g6.236ON50188685.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.174
         (295 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   608   0.0  
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   508   0.0  
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   486   e-175
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   481   e-173
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   298   2e-99
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   294   6e-98
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   292   1e-97
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   281   1e-93
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   275   1e-91
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   274   3e-91
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   275   6e-91
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   271   1e-89
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   268   8e-89
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   269   1e-88
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   267   3e-88
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   254   8e-83
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   250   2e-82
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     240   6e-77
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   210   9e-65
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    77   1e-15
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    73   3e-14
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    71   2e-13
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    70   2e-13
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    65   4e-11
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    64   8e-11
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    64   1e-10
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    64   1e-10
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    62   6e-10
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    61   8e-10
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    60   2e-09
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    58   2e-09
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    59   3e-09
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    59   3e-09
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    59   3e-09
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    57   2e-08
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    56   3e-08
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    55   6e-08
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    55   8e-08
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    54   1e-07
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    54   2e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    52   4e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    52   5e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    52   5e-07
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    52   7e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    52   8e-07
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    51   1e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    49   3e-06
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    47   2e-05
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    47   3e-05
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    46   5e-05
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    44   2e-04
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    44   3e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    43   4e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    42   7e-04
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    42   0.001
Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar...    42   0.001
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    41   0.001
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    42   0.001
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    41   0.001
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    42   0.002
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    41   0.002
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.002
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    40   0.003
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    40   0.003
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    40   0.004
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    40   0.004
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    40   0.004
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      40   0.005
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    40   0.005
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    40   0.005
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    40   0.005
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    40   0.005
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    39   0.008
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    39   0.008
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    39   0.010
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    39   0.013
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    39   0.014
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    39   0.014
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    38   0.016
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    38   0.023
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    37   0.032
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    37   0.042
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    37   0.043
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    37   0.059
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    36   0.061
KNAG0B01960 Chr2 complement(376106..376789) [684 bp, 227 aa] {ON...    36   0.082
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    36   0.083
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    36   0.092
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    36   0.094
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    35   0.10 
TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {...    35   0.14 
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    34   0.35 
ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]...    34   0.39 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    33   0.48 
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    33   0.54 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    33   0.65 
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    33   0.71 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    33   0.92 
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    32   1.2  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    32   1.2  
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    32   1.5  
KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some s...    32   2.0  
TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.2...    32   2.6  
TPHA0B00420 Chr2 complement(88557..91859) [3303 bp, 1100 aa] {ON...    32   2.8  
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                31   3.3  
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    31   4.0  
NDAI0C03140 Chr3 (715356..717473) [2118 bp, 705 aa] {ON} Anc_5.1...    31   4.2  
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    31   5.0  

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/295 (100%), Positives = 295/295 (100%)

Query: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60
           MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD
Sbjct: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180

Query: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240
           SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR
Sbjct: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240

Query: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295
           VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD
Sbjct: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/295 (83%), Positives = 265/295 (89%), Gaps = 2/295 (0%)

Query: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60
           ME+  REHSE   E Q IPK+ILP+EF KCSRTDLVVLISRMLVSLIAINENS+TK+PDD
Sbjct: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSK+PPNISIFNYFIRLTKFSSLEHCVL+TSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           RFLLTATTVAAKGLCDSFSTNAHY+KVGGVRCHELNILENDFLKRVNYRI+PRDHNITLC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240
           SIEQKQK FV DKNA GS DL SYSY +R KSGYNVLDKYY+RIVQLVGSF+ASPDKS++
Sbjct: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295
           V+Y LPSN D+D E   ++QQ K    +SP SHYSQKR SEAKDTN Y KRSKPD
Sbjct: 241 VDYVLPSNIDKDTESGPQIQQQKGT--LSPNSHYSQKRNSEAKDTNIYRKRSKPD 293

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  486 bits (1251), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/295 (79%), Positives = 260/295 (88%), Gaps = 4/295 (1%)

Query: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60
           MES   + SE+  EDQ I K+ILP++F KCSRTDLVVLISRMLVSLIAINENS +K P++
Sbjct: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVL+TSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           RFLLTATT+A KGLCDSFSTNAHY+KVGGVRCHELNILENDFLKRVNYRI+PRDHNI LC
Sbjct: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180

Query: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240
           SIEQKQK FVIDKNALGS DL SYSY +R KSGYNVLDKYY+RIVQLVGSF+ASPDKS++
Sbjct: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295
           ++Y LPSN D+DNE   ++ + +     S  +HYSQKR SEAKD N YHKRSKPD
Sbjct: 241 IDYVLPSNIDKDNESGPQINEQRG----SLPNHYSQKRNSEAKDANTYHKRSKPD 291

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  481 bits (1239), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/295 (80%), Positives = 261/295 (88%), Gaps = 2/295 (0%)

Query: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60
           MES + E SE+  EDQ IPK+ILP++F KCSRTDLVVLISRMLVSLIAINENS+TK+ DD
Sbjct: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVL+TSLYYIDLLQT YPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           RFLLTATTVA KGLCDSFSTNAHY+KVGGVRCHELNILENDFLKRVNYRI+PRDHNITLC
Sbjct: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240
           SIEQKQK FVIDKNALGS+DL SYSY NR KSGYNVLDKYY+RIVQLVGSF+ASPDKSR+
Sbjct: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240

Query: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295
           V+Y LP N D  +E  ++  Q K ++  +  S  SQKR SEAKD + Y+KRSKPD
Sbjct: 241 VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHS--SQKRYSEAKDAHIYNKRSKPD 293

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  298 bits (762), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 184/245 (75%), Gaps = 10/245 (4%)

Query: 9   SEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSST------KRPDDQ- 61
           +E+  E ++I  I LP +F  CSR+DLV LI+RML  LI +N+N         + P+++ 
Sbjct: 34  NENKIEIENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRS 93

Query: 62  -ITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120
            + LTR+HS++PPNIS++NY IRLTK+SSLEHCVL++++YYIDLL + YP+F +NSLT H
Sbjct: 94  VMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVH 153

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           RFLLTATT+A+KGLCDSF TN+HYSKVGGV C ELNILE +FL+RVNYRI+PRD NI LC
Sbjct: 154 RFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213

Query: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240
            IE +Q  F +D + L  V  G    +N   SG+N+LD YY +IVQLVGSF AS DKSR+
Sbjct: 214 KIEHQQNKFTMDFSDLSMV--GMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRK 271

Query: 241 VNYAL 245
            NY L
Sbjct: 272 ANYTL 276

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  294 bits (753), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 182/244 (74%), Gaps = 7/244 (2%)

Query: 18  IPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISI 77
           +P +ILP  F +CSRTDLV+LISRML  LI +N++SST   D    LT++HSK+PP IS+
Sbjct: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101

Query: 78  FNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDS 137
           +NY +RLTK+SSL+HCVL+ ++YYIDL+ + YP FTLNSLT HRFLLTATTVA+KGLCDS
Sbjct: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161

Query: 138 FSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVID-KNAL 196
           F TN HY+KVGGV C ELN+LE + L+R+NYRI+PRD NI  C++E + + FV+D ++  
Sbjct: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221

Query: 197 GSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL-----PSNFDE 251
               + S    NR+ SGYNVLD YY +IVQLVGS  ++ DKS+ VNY       P+N   
Sbjct: 222 DWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTNI-H 280

Query: 252 DNEG 255
           +NEG
Sbjct: 281 NNEG 284

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  292 bits (748), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 180/243 (74%), Gaps = 7/243 (2%)

Query: 4   PAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQIT 63
           P+    E T E   I  I LP +F KCSRTDL VLISRML  LI IN++ +  +P++   
Sbjct: 19  PSESSKEGTDE---ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARG 75

Query: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFL 123
           LTR+HS++PP IS++NY IRLTK+SSLEHCVL+T++YYIDLL + YP FTL+SLT HRFL
Sbjct: 76  LTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFL 135

Query: 124 LTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIE 183
           LTATTVA+KGLCDSF TN HY+KVGGV   ELNILE +FLKRVNYRILPRD NI  C +E
Sbjct: 136 LTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLE 195

Query: 184 QKQKTFVI-DKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVN 242
            K + F + ++  +G       S  N   SGYNVLD Y+++IVQLVGS+ +SPDKS+ VN
Sbjct: 196 TKLQKFTLYEEPEMGQNSRPQNSLKN---SGYNVLDAYFRKIVQLVGSYASSPDKSKVVN 252

Query: 243 YAL 245
           Y L
Sbjct: 253 YVL 255

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  281 bits (720), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 181/234 (77%), Gaps = 6/234 (2%)

Query: 15  DQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPN 74
           D+ IP I LP +F KC + DLV+LI+RML  +I IN+ S+ K  + +  LTR+HSKI PN
Sbjct: 11  DEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQIND-SNIKENERKYGLTRFHSKIAPN 69

Query: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134
           IS+FNYF RLTK+S LEH VL++++YYIDLL   YP F LNSLTAHRFLLTATT+A+KGL
Sbjct: 70  ISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGL 129

Query: 135 CDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKN 194
           CDSF TN HYSKVGGV+C+ELN+LEN+FL++VNYRI+PRD+NIT C +E  QK F I   
Sbjct: 130 CDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEV-QKNFFILPE 188

Query: 195 ALGSVDLGS---YSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL 245
           ++ S DL       Y++ S +GYNVL +YY +I+++VG + +SPDK+++VNY +
Sbjct: 189 SIES-DLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDI 241

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  275 bits (702), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 130/233 (55%), Positives = 176/233 (75%), Gaps = 14/233 (6%)

Query: 14  EDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPP 73
           E+  +P++ LP +F +CSRTDLV+LISRML  L  IN++      DD   LTR+HS++PP
Sbjct: 25  EEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPK---DDAKELTRFHSRVPP 81

Query: 74  NISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKG 133
            IS+++Y +RLT++SSLE  VL+ S+YYIDLL   YP F+LNSLT HRFLLTATTVA+KG
Sbjct: 82  QISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKG 141

Query: 134 LCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDK 193
           LCDSF TN+HY+KVGGV+C EL++LE++FLK+VNYRILPRD NI+ C  E+K   FV   
Sbjct: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTP- 200

Query: 194 NALGSVDLGSYSYANRS-KSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL 245
                    +YS + R   +G+NVLD YY++I+++VGSFD+SPDK++R +Y +
Sbjct: 201 ---------TYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  274 bits (700), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 179/241 (74%), Gaps = 17/241 (7%)

Query: 9   SEDTQEDQS---IPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLT 65
           +EDT+ D     +P++ LP++F +C RTDLV+LISRML  LI IN++      D+   LT
Sbjct: 17  TEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPK---DNSSELT 73

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLT 125
           R+HS++PP IS+++Y +RLT++SSLE  VLI S+YYIDLL   Y  F+LNSLT HRFLLT
Sbjct: 74  RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT 133

Query: 126 ATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQK 185
           ATTV +KGLCDSF TN+HY+KVGGV+C EL++LE++FLKRVNYRILPRD NI  C  E++
Sbjct: 134 ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR 193

Query: 186 QKTFVIDKNALGSVDLGSYSYANRS-KSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYA 244
           +  FV            +Y+  NR   +G+NVLD YYQ+I+++VGS+D+SPDK++R +Y 
Sbjct: 194 EGLFVT----------ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYV 243

Query: 245 L 245
           +
Sbjct: 244 M 244

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  275 bits (704), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 141/254 (55%), Positives = 182/254 (71%), Gaps = 21/254 (8%)

Query: 18  IPKIILPSEFKKCSRTDLVVLISRMLVSLIAIN-------ENSSTKRPDD---------- 60
           I  I+LP+ F KCSR+DLVVLISRML  LI IN       EN+S   P            
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120
            I LTR+HS++PPNIS+ NY IRLTK++SLEH VL++SLYYIDLL + YP+F +NSLT H
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           RFLL ATTVA+KGL DSF TN+HY+KVGGVRC ELNILE DFL+R+NYRI+PRD NI LC
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 181 SIEQKQKTFVIDKNALGSVDLG-SYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSR 239
            +E+K   F +D   L + ++    ++ N   SGYNVL+ YY+++VQ+VG    S DKS+
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPN---SGYNVLNIYYRKMVQIVGLLKNSTDKSK 268

Query: 240 RVNYALPSNFDEDN 253
           +VNY + +N+++ N
Sbjct: 269 KVNYIIQTNYNDTN 282

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  271 bits (694), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 175/239 (73%), Gaps = 10/239 (4%)

Query: 13  QEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIP 72
           +  +S+ ++ LP +F  CSRT LVVLISRML SLI +N+    K     I LTR+HS++P
Sbjct: 8   ETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDK--SKPIKLTRFHSRVP 65

Query: 73  PNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAK 132
           P IS++NY IRLTK+SSLEHCVL+ S+YYIDLL   YP+F L+SLT HRFLLTATTVA+K
Sbjct: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASK 125

Query: 133 GLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVID 192
           GLCDSF TN HY+KVGGV+C ELN+LEN+FL+RVNYRILPRD NI  CS+E++++ F   
Sbjct: 126 GLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF--- 182

Query: 193 KNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL---PSN 248
             +  ++ +          +G+ VL+KYY R++ L+G F+ SPDKS  +++ L   P+N
Sbjct: 183 --SYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTN 239

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  268 bits (686), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 133/247 (53%), Positives = 177/247 (71%), Gaps = 18/247 (7%)

Query: 15  DQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPN 74
           +Q+  +I+LP EF KCSRT LVVLISRML SLI +N++      D  + LTR+HS++PP 
Sbjct: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK---DKNLKLTRFHSRVPPG 97

Query: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134
           IS++NY IRL K+SSLE  VLI ++YYIDLL + YP FTLNSLT HRFLLTATTVA+KGL
Sbjct: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157

Query: 135 CDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKN 194
            DSF TN HY+KVGGV+C ELN+LE +FLKRVNYRI+PRD NI  C  E +Q  F+    
Sbjct: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFI---- 213

Query: 195 ALGSVDLGSYSYANRSKS---GYNVLDKYYQRIVQLVGSFDASPDKSRRVNYALPSNFDE 251
                   ++  A++ K    G+NVLD YY++++QLVG  ++SPDK+ +V+Y L  +  +
Sbjct: 214 --------TFPLADKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQ 265

Query: 252 DNEGSAR 258
           +++   R
Sbjct: 266 ESQTRKR 272

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  269 bits (688), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 131/235 (55%), Positives = 174/235 (74%), Gaps = 8/235 (3%)

Query: 11  DTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSK 70
           + ++ Q +P+  LP +F  CSRT LVVLISRML SLI +N+  +     + + LTR+HS+
Sbjct: 13  ENRKAQPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTES---NTLQLTRFHSR 69

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVA 130
           +PP+IS+++Y IRLTK+SSLEHCVL+ S+YYIDLL + +P+F L+SLT HRFLLTATTVA
Sbjct: 70  VPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVA 129

Query: 131 AKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFV 190
           +KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL RVNYRILPRD NI  CS E ++ TF 
Sbjct: 130 SKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFS 189

Query: 191 IDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL 245
              N     +    S  NR    ++VL+ YY R++ L+G+ DASPDKS  +N+ L
Sbjct: 190 F-ANIPADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  267 bits (683), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 172/247 (69%), Gaps = 22/247 (8%)

Query: 18  IPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPD------------------ 59
           I  + LPS F  CSR DL+ LISRMLV LI IN++++ K+                    
Sbjct: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80

Query: 60  DQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTA 119
            +  LTR+HS +PP IS++NY IRLTK+S+LE  VL+TS+YYIDLL + YP FT+NSLT 
Sbjct: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140

Query: 120 HRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITL 179
           HRFLLTATTVA+KGLCDSF TNAHY+KVGGV+  ELNILE++FLK++NYR+LPRD NIT 
Sbjct: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200

Query: 180 CSIEQKQKTFVI-DKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKS 238
           C  E +   F I +K AL +V   +++  N   SGYNVL  YY +I+QLVG F +S DKS
Sbjct: 201 CKYEHRAHEFTIYNKAALTNVSKPTHTQRN---SGYNVLQMYYHKIIQLVGKFSSSLDKS 257

Query: 239 RRVNYAL 245
           ++ NY  
Sbjct: 258 KKANYVF 264

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  254 bits (649), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 177/259 (68%), Gaps = 18/259 (6%)

Query: 11  DTQEDQSIPKII-LPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHS 69
           D Q+  +I +II LP E+ +CSRT LVV+ISRML  LI IN+ ++    +  + LTR+HS
Sbjct: 8   DPQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAG--NQTMELTRFHS 65

Query: 70  KIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTV 129
           K  P+I+++ Y IRLTK+SSLEH VL++++YYIDLL   YP+FTLNSLT HRFLLTATT+
Sbjct: 66  KAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTI 125

Query: 130 AAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTF 189
           A+KGLCDSF TN HYSKVGGV+C ELNILEN+FL+RV YRI+PRD NI  C IEQK    
Sbjct: 126 ASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK---- 181

Query: 190 VIDKNALGSVDLGSYSYANRSK--SGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYALPS 247
                 LGS  L     A++    +G+NVL  YY++IVQLVG+   SPDK+    + +  
Sbjct: 182 ------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKM-- 233

Query: 248 NFDEDNEGSARLQQPKAAT 266
             D  N G      P + T
Sbjct: 234 -VDPMNPGIGGTLVPPSTT 251

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  250 bits (639), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 166/247 (67%), Gaps = 12/247 (4%)

Query: 21  IILPSEFKKCSRTDLVVLISRMLVSLIAINENSS-----TKRPDDQITLTRYHSKIPPNI 75
           ++L   F KCS+ DL+ LISRML   I IN++ +     T      + LTR+HSK+PPNI
Sbjct: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLC 135
           SIF+Y IRLTK+SSLE  VLITS+YYIDLL   YP+F+LNSLT HR+LLTATT+A+KGLC
Sbjct: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131

Query: 136 DSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKNA 195
           DSF TN+HY+KVGG+RC+ELN+LE +FL+RV YR++PRD+ I LC +E K        N 
Sbjct: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDINND 191

Query: 196 LGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYALPSNFDEDNEG 255
           +   D           SGYNVL  YY ++VQLVG+  +S +  R VNY    N DE    
Sbjct: 192 IHIPD-------ELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDEIYNS 244

Query: 256 SARLQQP 262
              L++P
Sbjct: 245 MPELEKP 251

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  240 bits (612), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 128/247 (51%), Positives = 167/247 (67%), Gaps = 5/247 (2%)

Query: 5   AREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINE---NSSTKRPDDQ 61
           ++E + ++     I  I +P E+ KCSR+DLVVL+SRMLV LI  N+   N+S    D  
Sbjct: 13  SKESTAESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSN 72

Query: 62  ITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHR 121
           + LTR+HS+IPPNISIFNY  RLTK+  +EHCVL++ +YYIDL   AYP FT NSLTAHR
Sbjct: 73  MHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHR 132

Query: 122 FLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCS 181
           FLLTA TVA KGLCDSF T A Y+K+GGV+  ELNILE  FL+ VNYRI+PR  N+TL  
Sbjct: 133 FLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIK 192

Query: 182 IEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRV 241
           +E+  + F +D   +    L   SY     +GY+VL+ YYQ IV++ G+  +S    +RV
Sbjct: 193 LERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRV 250

Query: 242 NYALPSN 248
            Y  P+N
Sbjct: 251 IYTFPNN 257

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  210 bits (535), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 113/223 (50%), Positives = 147/223 (65%), Gaps = 10/223 (4%)

Query: 20  KIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQIT---LTRYHSKIPPNIS 76
           KI LP +F +C R DLVVLISRMLV+LI IN+   TK  D+ +     TR+HS++ P IS
Sbjct: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKIND---TKANDNNLPSNYATRFHSRVIPGIS 112

Query: 77  IFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCD 136
           I NY +RLTKF  L+  VL+T++YYIDLL   +P F+ NSLTAHRF+LTA  VA+K LCD
Sbjct: 113 IGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCD 172

Query: 137 SFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKNAL 196
           S  +  HY+K GGV+ +EL +LE  FLK + YR+LPRD N  LCS+E    TF ++   +
Sbjct: 173 SCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQI 232

Query: 197 GSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVG---SFDASPD 236
                 S+SY     SGYNVL  YY+RI+ ++G       SPD
Sbjct: 233 KESGT-SFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD 274

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 103/207 (49%), Gaps = 31/207 (14%)

Query: 1   MESPAREHSEDTQ-EDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENS------ 53
           +ES A+ HS D +  +Q+  KI+  ++F      +L+++IS +L  +I  N+ +      
Sbjct: 78  LESEAKTHSLDEETNEQTDVKILNIADFPT---DELILMISALLNRIITANDETTDVSQQ 134

Query: 54  -STKRPDDQIT-LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPD 111
            S +  D+ +T +  ++ K  P I++  Y  R+ K+    + + ++ L Y D +   Y  
Sbjct: 135 VSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGH 194

Query: 112 -----------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILEN 160
                      F ++S   HR L+T  T+  K L D F +N+ Y+KVGG+   ELN LE 
Sbjct: 195 SSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLEL 254

Query: 161 DFLKRVNYRILPRDHNITLCSIEQKQK 187
            FL   ++++        L S+E+ QK
Sbjct: 255 QFLILCDFKL--------LVSVEEMQK 273

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 85/173 (49%), Gaps = 27/173 (15%)

Query: 34  DLVVLISRMLVSLIAINENS---STKRPDDQ-----ITLTRYHSKIPPNISIFNYFIRLT 85
           +L++++S +L  +I +N+ +   S + P D        +  ++ K  P I +  Y  R+ 
Sbjct: 109 ELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQ 168

Query: 86  KFSSLEHCVLITSLYYIDLLQTAY---PD--------FTLNSLTAHRFLLTATTVAAKGL 134
           K+    + + ++ L Y D +   Y   P+        F ++S   HR L+T  T+  K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFL 228

Query: 135 CDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQK 187
            D F +N+ Y+KVGG+   ELN LE  FL   ++++        L S+E+ QK
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKL--------LVSVEEMQK 273

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 78/159 (49%), Gaps = 23/159 (14%)

Query: 34  DLVVLISRMLVSLIAINENSSTKRPDDQIT----------LTRYHSKIPPNISIFNYFIR 83
           +L++++S +L  ++  N+   T  P  Q+           +  ++ K  P I++  Y  R
Sbjct: 110 ELILMVSALLNKIVKANDE--TTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLER 167

Query: 84  LTKFSSLEHCVLITSLYYIDLLQTAY---PD--------FTLNSLTAHRFLLTATTVAAK 132
           + K+    + + ++ L Y D +   Y   PD        F ++S   HR L+T  T+  K
Sbjct: 168 IQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTK 227

Query: 133 GLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
            + D F +N+ Y+KVGG+   ELN LE  FL   ++++L
Sbjct: 228 FMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 83/176 (47%), Gaps = 27/176 (15%)

Query: 31  SRTDLVVLISRMLVSLIAIN----ENSSTKRPDDQITLTR----YHSKIPPNISIFNYFI 82
           S  +L+ +IS +L  ++  N    E S     D+Q  L      ++ K  P IS+  Y  
Sbjct: 106 STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLE 165

Query: 83  RLTKFSSLEHCVLITSLYYIDLLQTAYPDFT-----------LNSLTAHRFLLTATTVAA 131
           R+ K+    + + ++ L Y D +   Y  F+           ++S   HR L+T  T+  
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICT 225

Query: 132 KGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQK 187
           K L D F +N+ Y+KVGG+   ELN LE  FL   ++++        L S+E+ QK
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKL--------LVSVEEMQK 273

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 10/119 (8%)

Query: 63  TLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL----------QTAYPDF 112
           +L  +H K  P+I+I  YF R+ K+    + V +  L   D +            +   F
Sbjct: 177 SLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLF 236

Query: 113 TLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
            ++S   HRF++   TV  K L D F +N+ Y+KVGG+  HE+N LE  FL   +++++
Sbjct: 237 VMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL----QTAYPD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +        P  F ++S   HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 122 FLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDF 162
            ++ A TV+ K   D F +N+ Y++VGG+  HELN LE  F
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQF 334

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 77/169 (45%), Gaps = 31/169 (18%)

Query: 34  DLVVLISRMLVSLIAINENSSTKRP-----------DDQITLTRYHSKIPPNISIFNYFI 82
           D++ +++ +L  +++ N+  +   P           D    +T ++ K  P I+I  Y +
Sbjct: 242 DILQMLTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQYLL 301

Query: 83  RLTKFSSLEHCVLITSLYYIDLL--------------------QTAYPDFTLNSLTAHRF 122
           R+ K+    + + ++ L + D +                    Q  +  F ++S   HR 
Sbjct: 302 RIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNIHRL 361

Query: 123 LLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           L+   TV+ K   D F +NA Y++VGG+   E+N LE  FL   ++++L
Sbjct: 362 LIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLL 410

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 57  RPDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPD----- 111
           RP+    +  +  K  P I++  YF R+ K+    + V ++ L Y D +           
Sbjct: 314 RPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQL 373

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR +++A TV+ K   D F +N+ Y++VGG+   ELN LE  FL   ++ + 
Sbjct: 374 FVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFEL- 432

Query: 172 PRDHNITLCSIEQKQK 187
                  + S+E+ QK
Sbjct: 433 -------IISVEELQK 441

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 13/126 (10%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL-----QTAYPDFTLNSLTAHR 121
           +  K  P I++  YF R+ K+    + V ++ L Y D +           F ++S   HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 122 FLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCS 181
            +++A TV+ K   D F +N+ Y++VGG+   ELN LE  FL   ++ +        + S
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFEL--------IIS 546

Query: 182 IEQKQK 187
           +E+ QK
Sbjct: 547 VEELQK 552

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 10/115 (8%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL----------QTAYPDFTLNS 116
           +  K  P IS+  YF R+ K+    + V ++ L Y D +          +     F ++S
Sbjct: 337 FRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDS 396

Query: 117 LTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
              HR ++ A TV+ K   D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 397 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (47%), Gaps = 15/120 (12%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQ-------TAYPD-------- 111
           +  K  P IS+  YF R+ K+    + V ++ L Y D +        T+  D        
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR ++   TV  K   D F +N+ Y++VGGV   ELN LE  FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL----QTAYPD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +        P  F ++S   HR
Sbjct: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124

Query: 122 FLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDF 162
            ++ A TV+ K   D F +N+ Y++VGG+   ELN LE  F
Sbjct: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 63  TLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL----QTAYPD------- 111
            +  +  K  P I++  YF R+ K+    + V ++ L Y D +     + + +       
Sbjct: 171 AMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQ 230

Query: 112 -FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRI 170
            F ++S   HR ++   TV+ K L D F +N+ Y+KVGG+   ELN LE  FL   ++ +
Sbjct: 231 IFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNL 290

Query: 171 L 171
           L
Sbjct: 291 L 291

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 79/188 (42%), Gaps = 42/188 (22%)

Query: 26  EFKKCSRTDLVVLISRMLVSLIAIN-------ENSSTKRPDD----QITLTR----YHSK 70
           +  K S   L+ +IS +L  LI  N       E S   R DD    +  L R    +  K
Sbjct: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAY---------PD---------- 111
             P I +  YF R+ K+    + VL+  L Y D +             P+          
Sbjct: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 112 --------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFL 163
                   F L+S   HR +++A TV+ K   D F +N+ Y+KVGG+   E+N LE  FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

Query: 164 KRVNYRIL 171
              N+ ++
Sbjct: 308 LISNFDLI 315

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (48%), Gaps = 14/119 (11%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQ------------TAYPD--F 112
           +  K  P I+++ YF R+ K+    + V ++ L Y D +             T+  D  F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 113 TLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
            ++S   HR ++   TV  K   D F +N+ Y++VGG+   ELN LE  FL   ++ +L
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 16/121 (13%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL----------------QTAYP 110
           +  K  P I++  YF R+ K+    + V ++ L Y D +                Q    
Sbjct: 211 FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTL 270

Query: 111 DFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRI 170
            F +NS   HR ++    V+ K   D F +NA Y+KVGG+   E+N LE  FL   ++ +
Sbjct: 271 LFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSL 330

Query: 171 L 171
           L
Sbjct: 331 L 331

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 28/133 (21%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQ--------------TAYPD- 111
           +  K  P I++  YF R+ K+    + VL++ L + D +                + PD 
Sbjct: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299

Query: 112 -------------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNIL 158
                        F ++S   HR ++ A TV+ K + D F +N+ Y++VGG+   ELN L
Sbjct: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359

Query: 159 ENDFLKRVNYRIL 171
           E  FL   ++R++
Sbjct: 360 ELQFLILCDFRLI 372

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 36/141 (25%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPD--------------- 111
           +  K  P IS+  YF R+ K+  + + V ++ L Y D +     +               
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 112 ---------------------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGV 150
                                F ++S   HR ++TA TV+ K   D F +N+ Y++VGG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 151 RCHELNILENDFLKRVNYRIL 171
              ELN LE  FL   +++++
Sbjct: 328 SLQELNHLELQFLILCDFQLM 348

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 14/113 (12%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQ---TAYPD-----------FTLNSLT 118
           P I++  YF R+ K+    + V ++ L Y D +     + P            F ++S  
Sbjct: 358 PQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMFVMDSYN 417

Query: 119 AHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
            HR ++   TV  K   D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 418 IHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 58/136 (42%), Gaps = 31/136 (22%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYID-----------------LLQTAY 109
           +  K  P IS+ +YF R+ K+    + V ++ L Y D                  LQ   
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 110 PD--------------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHEL 155
           P               F ++S   HR L+   TV+ K   D F +N+ Y++VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 156 NILENDFLKRVNYRIL 171
           N LE  FL   ++ +L
Sbjct: 316 NHLELQFLVLCDFELL 331

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR ++   TVA K   D F +NA Y+KVGG+   ELN LE  FL   ++++L
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR ++   TV+ K L D F +N+ YS+VGG+   ELN LE  FL   ++ +L
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR ++   TV+ K L D F +N+ YS+VGG+   ELN LE  FL   ++ +L
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 108 AYPD-FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRV 166
           A+P  F ++S   HR ++   TV+ K L D F +N+ YS+VGG+   ELN LE  FL   
Sbjct: 325 AHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384

Query: 167 NYRIL 171
           ++ +L
Sbjct: 385 DFELL 389

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR ++  TTV+ K   D F +N+ Y++VGG+   ELN LE  FL   ++ +L
Sbjct: 320 FVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNYLELQFLILCDFELL 379

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR ++   TV+ K L D F +N+ YS+VGG+   ELN LE  FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           F ++S   HR ++   TV+ K   D F +N+ Y++VGG+   ELN LE  FL   ++ +L
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 114 LNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILP- 172
           +NS T HR +L   TV++K L D   +N  Y++  G+   ELN LE  FL+  N+ +   
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNLSVS 286

Query: 173 ----RDHNITLCSIEQ 184
                D+   LCS  Q
Sbjct: 287 LNELEDYGTALCSCSQ 302

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 75/149 (50%), Gaps = 22/149 (14%)

Query: 28  KKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISIF--NYFIRLT 85
           KK    +++  ++    S+I I EN      ++ I   R     PP++SIF  N  I+  
Sbjct: 13  KKPVSQEMIQFLATSTASIIKIREN------NNPIQGCR-----PPDLSIFIKNVVIQ-- 59

Query: 86  KFSSLEHCVLITSLYYIDLLQTAYPD--FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAH 143
             S+++   L+ +  Y++ L++  P   + +N+ T HR  L    +AAK L DS   N H
Sbjct: 60  --SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCLILAAKTLNDSSPWNKH 116

Query: 144 YSKV--GGVRCHELNILENDFLKRVNYRI 170
           ++    G +R  E+N +E + L+ +N+ +
Sbjct: 117 WTTYTEGLLRIREVNTIERELLEYLNWDV 145

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 5/109 (4%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPD--FTLNSLTAHRFLLTATTVAAKG 133
           SIF +   L K S+++   L+ S  Y+  L++  P   + + S T HR  L    +AAK 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 134 LCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           L DS   N H++K   G +   ++N +E + L  +N+  + +  ++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 13/142 (9%)

Query: 26  EFKKCSRT-DLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISIFNYFIRL 84
           +FK+ + T +++  +S    S I I   S +   ++ I      S IPP   ++ +   L
Sbjct: 10  KFKRKAVTGEMIQFLSNCAASAIQIRPTSDSNLTNESI------SNIPP---LYTFIKNL 60

Query: 85  TKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLCDSFSTNAH 143
              S+++   L+T++ Y+  L+   P        T HR  L    +AAK L DS   N H
Sbjct: 61  VAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLNDSSPLNKH 120

Query: 144 YSKV--GGVRCHELNILENDFL 163
           ++K   G ++  E+N +E + L
Sbjct: 121 WAKYTNGLLQLREVNTIEREIL 142

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 9/121 (7%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  +L +++++    L+T++ Y+  L+T  P D T    T HR  L    ++AK  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLK------RVNYRILPRDHNITLCSIEQKQ 186
            DS   NAH+S+   G     ++N++E   L+      R+N   L +D    L  I++  
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQDLQWLLLPIKEDL 174

Query: 187 K 187
           K
Sbjct: 175 K 175

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 16/146 (10%)

Query: 28  KKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISIFNYFIRLTKF 87
           K+    +++  ++    S+I I +N S             H   PP +SIF    ++   
Sbjct: 12  KRPVSQEMIQFLATSTASIIQIRKNDSP-----------VHGCPPPELSIF--IKKVVVQ 58

Query: 88  SSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLCDSFSTNAHYSK 146
           S+++   L+ +  Y++ L++  P        T HR  L    +AAK L DS   N H++ 
Sbjct: 59  SNVQTPTLMATTVYLNKLKSIIPKNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTT 118

Query: 147 V--GGVRCHELNILENDFLKRVNYRI 170
              G ++  E+N +E + L+  N+ +
Sbjct: 119 YTEGLLKVREVNTIERELLEYFNWDV 144

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H++K   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAA 131
           P++++F    RL   S+++   L+++L Y+  L+   P D      T HR  +    +AA
Sbjct: 45  PSLALF--IKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAA 102

Query: 132 KGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
           K L DS   N H+++   G  +  E+N +E + L+  N+ +
Sbjct: 103 KSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 54/108 (50%), Gaps = 3/108 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGL 134
           ++ N+   L K S+++   L+ +  Y+  L++  P        T HR  L    +AAK L
Sbjct: 49  TLSNFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIETTRHRIFLGCLILAAKTL 108

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
            DS   N H+++   G ++  E+N +E + L+  ++ +  +  ++ +C
Sbjct: 109 NDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AEL195W
          Length = 370

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 55/105 (52%), Gaps = 3/105 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  ++ +++++    L+T++ Y++ L+   P D T    T+HR  L    ++AK  
Sbjct: 115 SLTTFIAKIVRYTNVYTATLLTTVVYLNKLKKVLPKDATGIPSTSHRIFLACLILSAKFH 174

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNI 177
            DS   N H+++   G     ++N++E   LK  ++ I   +H++
Sbjct: 175 NDSSPLNKHWTEYTDGLFTIQDVNLMERQLLKLFDWNIRVSEHDL 219

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTA-HRFLLTATTVAAKGL 134
           S+ ++   + K+S ++   L+ S  +++ L+   P +     TA HR  L    +A+K L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+ K   G +   E+N +E + L+ +++ +
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 59/133 (44%), Gaps = 14/133 (10%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAA 131
           P  S+ N+   L   S+++   L+ +  Y+  L++  P        T HR  L    +AA
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLILAA 104

Query: 132 KGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLCS-------- 181
           K L DS   N H++    G +  HE+N +E + L+  ++ +     ++  C         
Sbjct: 105 KTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLAPFLQPIK 164

Query: 182 ---IEQKQKTFVI 191
              I QKQ+ +++
Sbjct: 165 EQFIRQKQQNYLL 177

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKG 133
           +S+ N+   L   S+++   L+++  Y+  L++  P   L    T HR  L    +AAK 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 134 LCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           L DS   N H++    G +   E+N +E + L+  ++ +      + +C
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAIC 153

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKG 133
           +S+ ++   L   S+++   L++++ Y+  L++  P        T HR  L    +AAK 
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 134 LCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           L DS   N H+S+   G +   E+N +E + L+  ++++     ++  C
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITC 150

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 9/111 (8%)

Query: 72  PPNISIF--NYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATT 128
           PP++S F  N  I+    S+++   L+ +  Y++ L+   P        T HR  L    
Sbjct: 47  PPDLSTFIKNVVIQ----SNVQTPTLMATSVYLNKLRNIIPRNVYGIETTRHRIFLGCLI 102

Query: 129 VAAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNI 177
           +AAK L DS   N H++    G +R  E+N +E + L+  N+ +    H++
Sbjct: 103 LAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDVRITTHDL 153

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLL 124
           ++ +++P   S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L
Sbjct: 47  KHMARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFL 103

Query: 125 TATTVAAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNY 168
               ++AK   DS   N H+++   G     ++N++E   L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H+++   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H+++   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  +L +++++    L+T+  Y+  LQ   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYH 113

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITL 179
            DS   N H+++   G     ++N++E   L  +N+ +   ++++ L
Sbjct: 114 NDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDLRINENDLIL 160

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 6/104 (5%)

Query: 68  HSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTA 126
           H+ +P   S+  +  RL +++++    L+T++ Y++ L+   P D      T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 127 TTVAAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNY 168
             ++AK   DS   N H++K   G     ++N++E   L+   +
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTV 129
           IP   S+  +  R+ ++++++   L+ ++ Y++ L+   P D      T HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 130 AAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITL 179
           +AK   DS   N H++    G     ++N++E   L  +++ +   +H I L
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNLQLTEHEIIL 166

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 11/146 (7%)

Query: 28  KKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISIFNYFIRLTKF 87
           KK    ++V  ++    S+I + + ++    ++ I +     +IPP   + N+   L   
Sbjct: 12  KKSVSHEMVHFLATNTASIIQVKKGNNIVTTENGIPI-----EIPP---LSNFIKNLVMH 63

Query: 88  SSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLCDSFSTNAHYSK 146
           S+++   L+ +  Y+  L+   P        T HR  L    +AAK L DS   N H++K
Sbjct: 64  SNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLILAAKTLNDSSPLNKHWTK 123

Query: 147 V--GGVRCHELNILENDFLKRVNYRI 170
              G +   E+N +E + L+   + +
Sbjct: 124 YTDGLLHIREVNTIERELLEYFEWNV 149

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 44  VSLIAINENSSTKRPDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYID 103
           V+L  +    + + P    + T    K P   S+  +  +L +++++    L+T++ Y++
Sbjct: 27  VTLKVLPNTPAQQYPSPPSSPTELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLN 86

Query: 104 LLQTAYP-DFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKV--GGVRCHELNILEN 160
            L+   P D      T HR  L    ++AK   DS   N H++K   G     ++N++E 
Sbjct: 87  KLKRILPKDAKGLPSTIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMER 146

Query: 161 DFLKRVNY 168
             L  +N+
Sbjct: 147 QLLNLLNW 154

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+ ++ Y++ L+   P D T    T HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+++   G     ++N++E   L+ +N+ I
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTA-HRFLLTATTVAAKG 133
           +S+ ++   L K S+++   L++++ Y+  L++  P       T+ HR  L    +AAK 
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 134 LCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           L DS   N H+ +   G +   E+N +E + L+  N+ +   + ++  C
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVA 130
           PP  ++  +   L   S +    L+ S  Y+  L+   P   +    T HR  L    +A
Sbjct: 44  PPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIA 103

Query: 131 AKGLCDSFSTNAHYSKVGG--VRCHELNILENDFLKRVNYRI 170
           AK L D+   N H+SK     +   E+NI+E + L  + +R+
Sbjct: 104 AKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 77  IFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLC 135
           +F +  ++   S+++   L+ +  Y++ L+   P        T HR  L    +AAK L 
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIETTRHRIFLGCLILAAKTLN 107

Query: 136 DSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
           DS   N H+S    G ++  E+N +E + L+  N+ +
Sbjct: 108 DSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 8/116 (6%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPD--FTLNSLTAHRFLLTA 126
           S  PP   +  +   L  +S+++   L+ +  Y+  L++  P   F + + T HR  L  
Sbjct: 42  SPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGC 97

Query: 127 TTVAAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
             +AAK L DS   N H++    G +   E+N +E + L+  ++ +      +  C
Sbjct: 98  LILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVA 130
           PP     N   RL K S+++   L+ +  Y+  L++  P        T HR  L    +A
Sbjct: 47  PPLTEFIN---RLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLILA 103

Query: 131 AKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           AK L DS   N H+++   G +   E+N +E + L+  ++ +     ++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAA 131
           P +S+ ++   L   S+++   L++++ Y+  L++  P +      T HR  L    +A+
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 132 KGLCDSFSTNAHYSKVGG--VRCHELNILENDFLKRVNYRILPRDHNITLC 180
           K L DS   N H+ +     +   E+N +E + L+  N+ +L  + ++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKG 133
           +S+ ++   L   S+++   L+++  Y+  L++  P +      T HR  L    +AAK 
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN 102

Query: 134 LCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           L DS   N H++    G +   E+N +E + L+  ++ +     ++  C
Sbjct: 103 LNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVA 130
           PP +   N   RL K S+++   L+ +  Y+  L++  P        T HR  L    +A
Sbjct: 47  PPLVKFIN---RLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLILA 103

Query: 131 AKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
           AK L DS   N H+++   G +   E+N +E + L   ++ +
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDV 145

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVA 130
           PP     N   RL K S+++   L+ +  Y+  L++  P        T HR  L    +A
Sbjct: 47  PPLTKFIN---RLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILA 103

Query: 131 AKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRILPRDHNITLC 180
           AK L DS   N H+++   G +   E+N +E + L+  ++ +     ++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSL--TAHRFLLTA 126
           SK+P   S+  +  +L +++++    L+T+  Y+  LQ   P    N L  T HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 127 TTVAAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
             ++AK   DS   N H+++   G     ++N++E   L  +N+ I
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDI 154

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTAT 127
           SK+P   S+ ++  RL + +++    L+ +  Y++ L+   P D +    T HR  L   
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPSTIHRMFLACL 139

Query: 128 TVAAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
            ++AK   DS   N H++K   G     ++N++E   ++ +N+ +
Sbjct: 140 ILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDL 184

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 72/150 (48%), Gaps = 18/150 (12%)

Query: 26  EFKKCSRT-DLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISIFNYFIRL 84
           EF K + T +++  +S +  S+I +      +R +  I++      +PP   +  +   L
Sbjct: 9   EFNKKTVTKEMIAYLSNITESIIQV------RRSNSMISIA-----LPPP-PLVKFITNL 56

Query: 85  TKFSSLEHCVLITSLYYIDLLQTAYPD--FTLNSLTAHRFLLTATTVAAKGLCDSFSTNA 142
              S+++   L+ +  Y+  L+   P   + + S T HR  L    +A+K L DS   N 
Sbjct: 57  CLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILASKTLNDSSPLNK 115

Query: 143 HYSKV--GGVRCHELNILENDFLKRVNYRI 170
           H+++   G ++  E+N +E + L+  ++ I
Sbjct: 116 HWARYTSGILQLREVNTIERELLEYFDWNI 145

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 71  IP-PNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATT 128
           IP P + +F    +L K+S+++   L+ +  ++  L++  P        T HR  L    
Sbjct: 44  IPAPKLELF--IKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLI 101

Query: 129 VAAKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
           ++AK L DS   N H+++   G +   E+N +E + L+  ++ +
Sbjct: 102 LSAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 81/195 (41%), Gaps = 18/195 (9%)

Query: 16  QSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNI 75
           +SIPKI   S+ +  S+    + +   L   I  N N+     +D      +  K PP++
Sbjct: 305 ESIPKIPELSDDEALSKFRENIELILQLSKKINDNANTLAISSEDPQKFVNFVMKNPPSL 364

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDF--------TLNSLTAHRFLLTAT 127
           S  ++  R+         V + + Y + L+     +          L    AHR +++  
Sbjct: 365 SFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDGPIKLKAKLQEDQAHRIIISTI 424

Query: 128 TVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQK 187
            +A K L D   +  +  KV G+    L  LE  F+  VN+  L       + + E+ +K
Sbjct: 425 RIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNFDGL-------MITCEKLEK 477

Query: 188 TF-VID--KNALGSV 199
           T  ++D  + ALG+ 
Sbjct: 478 TLHILDDTRQALGNT 492

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 9/108 (8%)

Query: 76  SIFNYFIRLTKFSSLEHCVLIT-SLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134
           SI  +  RL +++++    L+T ++Y   L      D T    TAHR  L    ++AK  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILENDFLK------RVNYRILPRD 174
            DS   N H++K   G     ++N++E   L+      RV +R L RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>KNAG0B01960 Chr2 complement(376106..376789) [684 bp, 227 aa] {ON}
           Anc_5.347 YHR071W
          Length = 227

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 57/126 (45%), Gaps = 8/126 (6%)

Query: 76  SIFNYFIRLTKFS-SLEHCVLITSLYYIDLLQT----AYPDFTLNSLTAHRFLLTATTVA 130
           SI  + + + K S S  H   + S Y+  L+Q     A P+F   +  A R  L    +A
Sbjct: 81  SISGFLVEVLKRSKSNRHTTSLASFYFTRLMQAEKFDALPEF---AQCAKRVFLICLILA 137

Query: 131 AKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFV 190
            K L D+  +   +SK+ G+    L+ +E   LK+++Y +      +T  + E   +T +
Sbjct: 138 HKFLTDNTFSAETWSKISGLPKKTLSDMERWVLKKLDYNLFVEAETMTKWNTELLSQTTI 197

Query: 191 IDKNAL 196
              + L
Sbjct: 198 TLSHGL 203

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILE 159
            DS   N H+ K   G     ++N++E
Sbjct: 114 NDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 35.8 bits (81), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVA 130
           PP     N  I   K S+++   L+ +  Y+  L++  P        T HR  L    +A
Sbjct: 47  PPLTKFINGLI---KHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILA 103

Query: 131 AKGLCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
           AK L DS   N H+++   G +   E+N +E + L+  ++ +
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDV 145

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLT 125
           Y  ++P   S+  +   L +++++    L+T++ Y++ L+   P D T    T HR  L 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLA 104

Query: 126 ATTVAAKGLCDSFSTNAHYSKV--GGVRCHELNILE 159
              ++AK   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 70  KIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATT 128
           K+P   S+ ++  RL + +++    L+T+  Y++ L+   P D +    T HR  L    
Sbjct: 48  KLP---SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPSTVHRIFLACLI 104

Query: 129 VAAKGLCDSFSTNAHYSKVGG--VRCHELNILENDFLKRVNY 168
           ++AK   DS   N H++K         ++N++E   ++ +N+
Sbjct: 105 LSAKFHNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {ON}
           Anc_3.70 YNL289W
          Length = 268

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL  ++++    L+T+  Y++ L+   P + +    T HR  L    ++AK  
Sbjct: 46  SLQTFITRLVNYTNVPSGTLLTTAVYLNRLKQLLPAEASGIQSTRHRIFLACLILSAKYN 105

Query: 135 CDSFSTNAHY-SKVGGVRC-HELNILENDFLKRVNYRILPRDHNI 177
            DS   N H+ +    + C +++N++E   LK +N+ +   +H++
Sbjct: 106 NDSSPLNIHWMNHTNDLFCLNDINLMERQLLKLLNWDLSITEHDL 150

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 80/195 (41%), Gaps = 18/195 (9%)

Query: 16  QSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNI 75
           +SIPKI   S+ +  S+    + +   L   I  N N      +D      +  K PP++
Sbjct: 305 ESIPKIPNLSDNEALSKFRENIELILQLSKKIDENANILAISSEDPQKFVNFVMKNPPSL 364

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFT--------LNSLTAHRFLLTAT 127
           S  ++  R+         V + + Y + L+     +          L    AHR +++  
Sbjct: 365 SFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMNGPIKLKTKLQEDQAHRIIISTI 424

Query: 128 TVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQK 187
            +A K L D   +  +  KV G+    L  LE  F+  VN+  L       + + E+ +K
Sbjct: 425 RIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMACVNFDGL-------MITCEKIEK 477

Query: 188 TF-VID--KNALGSV 199
           T  ++D  + ALG+ 
Sbjct: 478 TLHILDDTRQALGNT 492

>ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|Q04636 Saccharomyces
           cerevisiae YML069W POB3 facilitates RNA Polymerase II
           transcription elongation
          Length = 574

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 118 TAHRFLLTAT---TVAAKGLCDSF-----STNAHYSKVGGVRCHELNILENDFLKRVNYR 169
           T   FLL AT   TV     C  F     + N    ++ G    + N+++NDF +R N +
Sbjct: 41  TKQPFLLPATELSTVQWSRGCRGFELKVNTKNQGVVQLDGFAPDDFNLIKNDFHRRFNVQ 100

Query: 170 ILPRDHNI 177
           + P++H++
Sbjct: 101 VEPKEHSL 108

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 65/137 (47%), Gaps = 6/137 (4%)

Query: 27  FKKCSRTDLVVLISRMLVSLIAINENSSTKR-PDDQITLTRYHSKIPPNISIFNYFIRLT 85
           FK     D++  ++   +++I    N++ +  P    +    H +  P  S+  +  RL 
Sbjct: 11  FKSPVTDDMIRYLTNTTLTVIPCAHNNNRQTYPSPPASPQEPHKRTLP--SLMTFVTRLV 68

Query: 86  KFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHY 144
           +++++    L+T+  Y++ L+   P D      T+HR  L    ++AK   DS   N H+
Sbjct: 69  RYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTSHRIFLACLILSAKFHNDSSPQNKHW 128

Query: 145 SK-VGGVRCHE-LNILE 159
           +    G+ C E +N++E
Sbjct: 129 AAYTDGLFCLEDVNLME 145

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 80  YFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLCDSF 138
           +  +L +++ +    L+ ++ Y++ L+   P        T HR  L    ++AK   DS 
Sbjct: 59  FICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKNHNDSS 118

Query: 139 STNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
             N H++K   G     ++N++E   L  +N+ +
Sbjct: 119 PLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKG 133
           +S+ ++   L + S+++   L+ +  Y+  L++  P D      T HR  +    +AAK 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 134 LCDSFSTNAHYSKV--GGVRCHELNILENDFLKRVNYRI 170
           L DS   N H++    G     ++N +E + L   ++ +
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D      T HR  L    ++AK  
Sbjct: 59  SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLIISAKFH 118

Query: 135 CDSFSTNAHYSKV--GGVRCHELNILE 159
            DS   N H+++   G     ++N++E
Sbjct: 119 NDSSPLNKHWTRYTDGLFSLEDINLME 145

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 118 TAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCH--ELNILENDFLKRVNYRI 170
           T HR  L    ++AK L DS   N H++K      H  E+N +E + L   ++ +
Sbjct: 91  TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 12/104 (11%)

Query: 76  SIFNYFIRLTKFS-SLEHCVLITSLYY------IDLLQTAYPDFTLNSLTAHRFLLTATT 128
           SI  Y + + K S S  + V++ S Y+      + L Q   P+F      + R  L+   
Sbjct: 87  SIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEFVH---CSKRIFLSCLI 143

Query: 129 VAAKGLCD-SFSTNAHYSKVGGVRCHELNILENDFLKRVNYRIL 171
           ++ K L D +FS  A +S + G+   +L+ILE   L R+NY ++
Sbjct: 144 LSHKFLNDKTFSMKA-WSLISGISKRDLSILERWCLMRLNYHLV 186

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 62/138 (44%), Gaps = 16/138 (11%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAY------PDFTLNSLTAHRFLLTATTV 129
           SI N+   +TK + +   +L+ +  Y D L  ++      P+F   +    R LL    +
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEF---AYCGKRLLLVCIIL 128

Query: 130 AAKGLCD-SFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNIT-----LCSIE 183
           A K   D +FS    +++V G+    + I+E   LK++NY +   +  +T     L   E
Sbjct: 129 AHKFSNDITFSMRV-WTQVSGLPTRSIAIMERWCLKQLNYGLTVTNEAMTSWGSKLAGYE 187

Query: 184 QKQKTFVIDKNALGSVDL 201
           Q+  T V    ++ +  L
Sbjct: 188 QRHTTSVCTLTSIANATL 205

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D      T HR  L    ++AK  
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLILSAKYH 146

Query: 135 CDSFSTNAHYSK-VGGVRC-HELNILE 159
            DS   N H++    G+ C  ++N++E
Sbjct: 147 NDSSPQNKHWAAYTDGLFCLDDVNLME 173

>KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 527

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLY----YIDL-LQTAYPDFTL-NSLT-- 118
           +  K  P +SI  Y  R+    S    + +T+ +    Y D+   T    F L N +T  
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGSGKFHLENPITES 451

Query: 119 -AHRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILE 159
             HR L+    +AAK L D   +++++SKV G+    L+ LE
Sbjct: 452 MTHRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLE 493

>TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.236
           YGL134W
          Length = 605

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 90  LEHCVLITSLYYI-----DLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHY 144
           L   VL+ SL+ +     +L++  YP   L     HR L+ +  V++K L D   ++ + 
Sbjct: 498 LGTIVLLQSLFLVREKETNLIKLKYP---LEESYVHRLLIASIRVSSKVLQDFVHSHEYI 554

Query: 145 SKVGGVRCHELNILE 159
           SKV GV    L  LE
Sbjct: 555 SKVFGVSKRLLTKLE 569

>TPHA0B00420 Chr2 complement(88557..91859) [3303 bp, 1100 aa] {ON}
           Anc_4.343 YML075C
          Length = 1100

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 76  SIFNYFIRLTKFSSLEHC-VLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134
           SI+N    +T+FS  E   +LI  + Y+ +LQT Y  F   S T  +F L+  T+   G 
Sbjct: 179 SIYNNL--MTRFSESEPFDILIILVAYLMVLQTVYSLFVEMSKTGSKFWLSLATICNSGC 236

Query: 135 CDSFS 139
              FS
Sbjct: 237 AFFFS 241

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 11/107 (10%)

Query: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAY--------PDFTLNSLTAHRFLLTAT 127
           S+ ++   +TK S  +  +L+ + YY   L T+         P+F   +  A R  LT  
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCI 150

Query: 128 TVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRD 174
            +A K L DS  +   +S + G+    L+ +E   L +++Y +   D
Sbjct: 151 IIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query: 51  ENSSTKRPDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLL----- 105
           ENS+ K   D    +R+  K  P++S  ++  R+      +  V +++ Y + +L     
Sbjct: 337 ENSAVKSEHD--LCSRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERS 394

Query: 106 ---QTAYPDFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYSKVGGV 150
               +    F L     HR ++    ++ K L D   ++ ++SKV GV
Sbjct: 395 AESNSLELKFKLQRDGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>NDAI0C03140 Chr3 (715356..717473) [2118 bp, 705 aa] {ON} Anc_5.117
           YLR047C
          Length = 705

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 155 LNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKNA 195
           LNI   +F+KR+ ++I+P  H  T+ ++   +   +I +N 
Sbjct: 308 LNICHKNFIKRIFFKIIPFQHPFTIATLPTDETIKLIIRNG 348

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 70  KIPPNISIFNYFIRLTKFSSLEHCVLITSLYYI-DLLQTAYPD------FTLNSLTAHRF 122
           K  P++S   Y  R+         V +T+ Y + +L  T   D      F L     HR 
Sbjct: 371 KSSPSLSYEEYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQIHRI 430

Query: 123 LLTATTVAAKGLCDSFSTNAHYSKVGGV 150
           ++ +  +AAK L D   ++A++SKV GV
Sbjct: 431 IIASIRLAAKLLEDFVHSHAYFSKVCGV 458

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,784,960
Number of extensions: 1436592
Number of successful extensions: 4499
Number of sequences better than 10.0: 129
Number of HSP's gapped: 4622
Number of HSP's successfully gapped: 132
Length of query: 295
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 186
Effective length of database: 40,982,805
Effective search space: 7622801730
Effective search space used: 7622801730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)