Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1736.27ON32732717440.0
Smik_15.1686.27ON32732715740.0
Skud_15.1606.27ON32732715460.0
YOL002C (IZH2)6.27ON31731715440.0
SAKL0E01474g6.27ON31128110401e-142
KNAG0M012406.27ON31427710271e-140
NCAS0H015106.27ON31328210161e-138
KAFR0G026506.27ON32128510061e-136
TDEL0G044206.27ON3223169991e-135
NDAI0F017406.27ON3133109841e-133
CAGL0E02519g6.27ON3152809741e-132
KLTH0C11044g6.27ON3153099511e-128
TBLA0E030606.27ON3193209481e-128
Kwal_56.224546.27ON3152799301e-125
Ecym_30316.27ON3282829291e-125
ZYRO0C07612g6.27ON3192919161e-123
TPHA0M002906.27ON3272809031e-121
Kpol_1032.96.27ON3182768921e-119
KLLA0D01331g6.27ON3082998891e-119
ACL002C6.27ON3292688841e-118
SAKL0C09218g3.90ON3143027151e-92
KLTH0C09504g3.90ON3193137081e-91
NDAI0A071603.90ON3303127021e-90
TDEL0D053403.90ON3163096951e-89
CAGL0G04631g3.90ON3163106924e-89
TPHA0A006403.90ON3273116918e-89
ZYRO0B06556g3.90ON3183096872e-88
Skud_4.7663.90ON3163086872e-88
YDR492W (IZH1)3.90ON3163096845e-88
Suva_2.6683.90ON3153096821e-87
Smik_4.7693.90ON3162886793e-87
Kwal_56.227043.90ON3203056794e-87
Kpol_1053.263.90ON3243176692e-85
KLLA0C12441g3.90ON3153116654e-85
NCAS0I025703.90ON3143146646e-85
AFR337W3.90ON3173006639e-85
Ecym_35883.90ON3052796445e-82
KAFR0A081303.90ON3193126193e-78
TBLA0B022903.90ON3262976187e-78
KNAG0K021603.90ON3233175934e-74
TBLA0B082553.90ON2962813912e-44
NCAS0C049203.90ON3263083149e-33
NDAI0G043003.90ON3182832867e-29
KLLA0F15510g5.197ON6222882072e-17
CAGL0I07491g3.90ON3012952014e-17
NDAI0I023305.197ON5782381913e-15
Skud_12.915.197ON5422381879e-15
KAFR0J006705.197ON5092371815e-14
Smik_12.865.197ON5422341815e-14
NCAS0D026005.197ON5432411799e-14
Suva_10.1045.197ON5412381781e-13
AAL153C5.197ON4192951771e-13
KNAG0B051005.197ON5382331744e-13
YLR023C (IZH3)5.197ON5432341719e-13
TPHA0E031205.197ON5692441711e-12
Suva_15.643.90ON3123221643e-12
KLTH0B03498g5.197ON5462421612e-11
Skud_15.533.90ON3123331531e-10
Kpol_2002.945.197ON5772361541e-10
Ecym_71095.197ON5682411522e-10
TDEL0E043205.197ON4502431522e-10
SAKL0G12980g5.197ON5632591513e-10
ZYRO0B10538g5.197ON5312381496e-10
Smik_15.563.90ON3123211468e-10
Kwal_33.151225.197ON5662921434e-09
YOL101C (IZH4)3.90ON3122261362e-08
CAGL0D03322g5.197ON5452831273e-07
TBLA0C060505.197ON4372451264e-07
KNAG0K006703.90ON3212051174e-06
Ecym_41115.576ON326476750.88
Kwal_27.11066na 1ON40274693.6
Skud_5.1697.236ON53388676.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.173
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   676   0.0  
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   610   0.0  
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   600   0.0  
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   599   0.0  
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   405   e-142
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   400   e-140
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   395   e-138
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   392   e-136
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   389   e-135
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      383   e-133
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   379   e-132
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   370   e-128
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   369   e-128
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   362   e-125
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   362   e-125
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   357   e-123
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   352   e-121
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   348   e-119
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   347   e-119
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   345   e-118
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   280   1e-92
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   277   1e-91
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   275   1e-90
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   272   1e-89
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   271   4e-89
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   270   8e-89
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   269   2e-88
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   269   2e-88
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   268   5e-88
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   267   1e-87
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   266   3e-87
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   266   4e-87
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   262   2e-85
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   260   4e-85
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   260   6e-85
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   259   9e-85
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   252   5e-82
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   243   3e-78
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   242   7e-78
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   233   4e-74
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             155   2e-44
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   125   9e-33
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    114   7e-29
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    84   2e-17
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    82   4e-17
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     78   3e-15
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    77   9e-15
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    74   5e-14
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    74   5e-14
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    74   9e-14
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    73   1e-13
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    73   1e-13
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    72   4e-13
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    70   9e-13
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    70   1e-12
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    68   3e-12
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    67   2e-11
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    64   1e-10
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    64   1e-10
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    63   2e-10
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    63   2e-10
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    63   3e-10
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    62   6e-10
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    61   8e-10
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    60   4e-09
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    57   2e-08
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    54   3e-07
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    53   4e-07
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    50   4e-06
Ecym_4111 Chr4 (222529..232323) [9795 bp, 3264 aa] {ON} similar ...    33   0.88 
Kwal_27.11066 s27 (625577..626785) [1209 bp, 402 aa] {ON} YER145...    31   3.6  
Skud_5.169 Chr5 complement(262759..264360) [1602 bp, 533 aa] {ON...    30   6.5  

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/327 (100%), Positives = 327/327 (100%)

Query: 1   MIHIRKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQR 60
           MIHIRKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQR
Sbjct: 1   MIHIRKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQR 60

Query: 61  DNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETT 120
           DNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETT
Sbjct: 61  DNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETT 120

Query: 121 TWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILY 180
           TWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILY
Sbjct: 121 TWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILY 180

Query: 181 YGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVV 300
           LYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVV
Sbjct: 241 LYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVV 300

Query: 301 IASLCHMRGVLNSYELVHIKMQNGIVS 327
           IASLCHMRGVLNSYELVHIKMQNGIVS
Sbjct: 301 IASLCHMRGVLNSYELVHIKMQNGIVS 327

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/327 (87%), Positives = 315/327 (96%)

Query: 1   MIHIRKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQR 60
           M+H+RKE+F+MSTLLERT SVQELKKRAAG T+ANPAEVA+AKKVLKR+YSWDEIPEWQR
Sbjct: 1   MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60

Query: 61  DNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETT 120
           DND+ILHGYV+ETSSF++TFKSLFY+HNESVNIYSHL+PA+GF TVLLLDK+TI VFETT
Sbjct: 61  DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETT 120

Query: 121 TWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILY 180
           TW DH++IDLF++GAFACLILSSSFHC KSHSL+IATLGNKLDYLGICILIVTSMVSIL+
Sbjct: 121 TWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILF 180

Query: 181 YGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYY+KF  FCLFALITVSFG+ACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVV 300
           LY YSFSEIW QIQLFWVLLGG LYIIGAVLYGMRFPEKV PG+FDIWGHSHQLFHFLVV
Sbjct: 241 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300

Query: 301 IASLCHMRGVLNSYELVHIKMQNGIVS 327
           IASLCH+RG+LNSYELVHIKM++GI+S
Sbjct: 301 IASLCHLRGLLNSYELVHIKMESGIIS 327

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/327 (87%), Positives = 306/327 (93%)

Query: 1   MIHIRKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQR 60
           M+ I KE F+MSTLLERT SVQELKKRAAG T ANPAEVA+AKKVLKR+YSWDEIPEWQR
Sbjct: 1   MMLIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQR 60

Query: 61  DNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETT 120
           DNDYILHGYV+ET SFV+TFKSLFYMHNESVNIYSHLIPA+GF TVLLLDK+TI VFETT
Sbjct: 61  DNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETT 120

Query: 121 TWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILY 180
           TW DHM+IDLF++GAFACLILSSSFHC KSHSL+IATLGNKLDYLGICILIVTSM SILY
Sbjct: 121 TWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILY 180

Query: 181 YGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYY+KF  FCLFALITVSFGIACSIV+LKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVV 300
           LY Y+FSEIW QIQLFWVLLGG LYIIGAVLYGMRFPEKV PG+FDIWGHSHQLFHFLVV
Sbjct: 241 LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300

Query: 301 IASLCHMRGVLNSYELVHIKMQNGIVS 327
           IAS CH+RG+LNSYELVH+KM+  IVS
Sbjct: 301 IASFCHLRGLLNSYELVHLKMEGKIVS 327

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/317 (89%), Positives = 305/317 (96%)

Query: 11  MSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYV 70
           MSTLLERT SVQELKKRAAG T+ANPAEVAKAKKVL+R+YSWDEIPEWQRDND+ILHGYV
Sbjct: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60

Query: 71  KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDL 130
           KETSSF++TFKSLFY+HNESVNIYSHLIPA+GF TVLLLDK+TI VF TTTWLDHM+IDL
Sbjct: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120

Query: 131 FFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAF 190
           F++GAFACLILSSSFHC KSHSL+IATLGNKLDYLGICILIVTSMVSILYYGY++KF  F
Sbjct: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180

Query: 191 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIW 250
           CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSI+PIFSGLY YSFSEIW
Sbjct: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240

Query: 251 NQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGV 310
            QIQLFWVLLGG LYIIGAVLYGMRFPEK+ PG+FDIWGHSHQLFHFLVVIA+LCH+RG+
Sbjct: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300

Query: 311 LNSYELVHIKMQNGIVS 327
           LNSYELVHIKM+NGIVS
Sbjct: 301 LNSYELVHIKMENGIVS 317

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  405 bits (1040), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 182/281 (64%), Positives = 232/281 (82%)

Query: 43  KKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVG 102
           KK ++R+YSW+EIP+WQ+DN++I HGYV+ET+SF+  F SLFYMHNESVNIY+HL+P + 
Sbjct: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89

Query: 103 FLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKL 162
           F  V+L DK  I VF+TTT+LD++M+DLFF GAF CLILSS+FHC K+HSL+IA LGNKL
Sbjct: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149

Query: 163 DYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 222
           DYLGI  LIV+SM+SI+YYG++D    F  F+ +T+ FGIAC+I SL D FR REWRPYR
Sbjct: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209

Query: 223 AGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYP 282
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGG  YIIGA+LY +R PE++ P
Sbjct: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269

Query: 283 GRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQN 323
           G+FDIWGHSHQ+FH LVVIA+LCH++ VLNSYELVH K+ +
Sbjct: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 179/277 (64%), Positives = 230/277 (83%)

Query: 42  AKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAV 101
            KK+ KR+Y+W+EIPEWQ+DN++I+ GYV+ET+SF+    SLFY+HNESVN+YSHLIPA+
Sbjct: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88

Query: 102 GFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNK 161
            F +VL L+K  +  FETT+ +D++ IDLFF GAF CLILSS+FHCFKSHSLK+AT GNK
Sbjct: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148

Query: 162 LDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPY 221
           LDYLGI +LIVTSM+SILYYG+YD    F  F+ +T+SFG AC +VSLKD FR REWRPY
Sbjct: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208

Query: 222 RAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVY 281
           RAGLFV FGLS+I+PI SG++ Y   E +++IQ+ W++L G  YI+GA LYG+RFPEK  
Sbjct: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268

Query: 282 PGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
           PG++DIWGHSHQ+FH LVV+A+LCH++G++ SYELVH
Sbjct: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  395 bits (1016), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/282 (63%), Positives = 226/282 (80%)

Query: 40  AKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIP 99
            K    ++++Y+WDEIPEWQ+DN++I+ GYV+ET+SF   F SLFY+HNE+ N+YSHL+P
Sbjct: 32  TKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVP 91

Query: 100 AVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLG 159
            V F   +L DK  I  FETTT+ D+++I+LFF GAF CLILSS+FHCFKSHSLKIAT G
Sbjct: 92  GVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFG 151

Query: 160 NKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWR 219
           NKLDYLGI +LIVTSM+SIL+YG+YD  P F  F+L+T+SFG AC+IVSLKDKFR REWR
Sbjct: 152 NKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWR 211

Query: 220 PYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEK 279
           PYRAGLFV FGLS+++PI +G+ YY   E W +IQL WV+L G  YI GA LYG+RFPEK
Sbjct: 212 PYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEK 271

Query: 280 VYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKM 321
              G FDIWGHSHQ+FH LVV+A+ CH++ +L SYELVH+ +
Sbjct: 272 YVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  392 bits (1006), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/285 (63%), Positives = 228/285 (80%)

Query: 35  NPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIY 94
           N  E  ++ + + ++Y+W+EIP+WQ+DN++I+ GYVKET+SF    +SLFY+HNESVN+Y
Sbjct: 26  NKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVY 85

Query: 95  SHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLK 154
           SHLIPAV FL   LL+KT +  F TTT LD++ IDLFF GAF CLILSS+FHCFKSHSL+
Sbjct: 86  SHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLR 145

Query: 155 IATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFR 214
           IAT GNKLDYLGI +LI TSM+S+LYYG+YD    F +FA IT+SFG+AC+ VSLKDKFR
Sbjct: 146 IATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFR 205

Query: 215 KREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGM 274
            RE R YRA LFVCFGLS+++P+  GLY+Y F   W++IQL WVLL G  YI GA LYG+
Sbjct: 206 SRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGI 265

Query: 275 RFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHI 319
           RFPEK  PG++DIWGHSHQLFH LVVIA+LCH + ++ SYE VH+
Sbjct: 266 RFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHM 310

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  389 bits (999), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/316 (57%), Positives = 238/316 (75%), Gaps = 4/316 (1%)

Query: 6   KEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYI 65
           K+  + S   ++T++V   K+  +G       +    KK  +++Y+WDEIP WQRDN++I
Sbjct: 6   KKRSQCSLTTDQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHI 61

Query: 66  LHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDH 125
           L GYV ET S    F SLFY+HNESVNIY+HL+P + FL VL  DK  +T FETTT +D+
Sbjct: 62  LSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDY 121

Query: 126 MMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYD 185
           +MIDLF   +F CL LSS FHC K+HS  +AT GNKLDYLGI +L+VTSMVSI+YYG+++
Sbjct: 122 VMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181

Query: 186 KFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYS 245
               F LF+ IT +FG AC++VSLK+ FR REWRPYRA +FV FGLS+++PI +G++YY 
Sbjct: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYG 241

Query: 246 FSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLC 305
           FSEI+ +IQ+ WVLLGG  YI GAVLYG+RFPEK  PG++DIWGHSHQLFH LVV+A+LC
Sbjct: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALC 301

Query: 306 HMRGVLNSYELVHIKM 321
           H+ G++ SY LVH+KM
Sbjct: 302 HLYGLIKSYNLVHLKM 317

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  383 bits (984), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 234/310 (75%), Gaps = 1/310 (0%)

Query: 13  TLLERTNSVQELKKRAAGNTAANPAEVAKAK-KVLKRVYSWDEIPEWQRDNDYILHGYVK 71
           T+ +R N+          N   N   + + K KV+ ++Y WDEIPEWQ+DN++I+ GYV+
Sbjct: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63

Query: 72  ETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLF 131
           ET+SF     SLFY+HNES N+YSHL+P V F   ++L+K  IT++ TT+ +D++MIDLF
Sbjct: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123

Query: 132 FTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFC 191
           F GAF CLILSS FHCFKSHSLK+ATLGNKLDYLGI ILIVTSM+SI+Y+G++D    F 
Sbjct: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFY 183

Query: 192 LFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWN 251
            F+ +T  FG AC+ VSLKD FR REWRPYRAGLFV FGLS+I+PI +G +YY   E + 
Sbjct: 184 FFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243

Query: 252 QIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVL 311
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+A+ CH+RG+L
Sbjct: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303

Query: 312 NSYELVHIKM 321
           +SYE+VH ++
Sbjct: 304 SSYEIVHSRL 313

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 225/280 (80%)

Query: 41  KAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPA 100
           + K V++++Y+W+EIPEWQ+DN++I  GYV+ETSS ++  +SLFY+HNE+VNIYSHLIPA
Sbjct: 30  RKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPA 89

Query: 101 VGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGN 160
           + F + +  +K  +  + TTT +D+++ID+FF GAF+CLILSS+FHC KSHSL++A  GN
Sbjct: 90  IAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGN 149

Query: 161 KLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRP 220
           KLDYLGI  LIV SMVSILYYG++     F +F+LIT++FG AC++VSLKD FR REWRP
Sbjct: 150 KLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209

Query: 221 YRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKV 280
           YRA LFV FGLS+++PI +GL+ Y  +E W +IQL WV+L G  YI GA LYG+RFPEK+
Sbjct: 210 YRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKM 269

Query: 281 YPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIK 320
            PG FD+WGHSHQ+FH LVV+A+LCH++ +L SY LVH +
Sbjct: 270 SPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  370 bits (951), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 172/309 (55%), Positives = 227/309 (73%)

Query: 10  EMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGY 69
           E   L +R     EL  R     ++   +    ++  +R+Y+WDEIPEWQRDN++I+ GY
Sbjct: 2   EQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGY 61

Query: 70  VKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMID 129
           + ET S  +  KSL Y+HNESVNIY+HL+P   FL V + ++  I  FETT  +D++MID
Sbjct: 62  ILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMID 121

Query: 130 LFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPA 189
           LFF G F CL++SS FHCFK HSL +A LGNKLDYLGI  L+VTS+VSIL+YG++D    
Sbjct: 122 LFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLY 181

Query: 190 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEI 249
           F LF+ +T++FG+AC+ VSL +KFR REWRPYRA LFV FGLS+++P+ +G  +Y   E 
Sbjct: 182 FWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKET 241

Query: 250 WNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRG 309
           W +IQL WVLLGG  YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+A+LCH+R 
Sbjct: 242 WTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRA 301

Query: 310 VLNSYELVH 318
           +L +Y+L H
Sbjct: 302 LLGAYKLFH 310

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 181/320 (56%), Positives = 234/320 (73%), Gaps = 6/320 (1%)

Query: 11  MSTLLER---TNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILH 67
           M T ++R   T+S +E  +   G+   N  ++  +    KR+Y+WDEIP WQ DN+YI  
Sbjct: 1   MVTEVQRRKLTSSTEEGVELLYGD---NQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYT 57

Query: 68  GYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMM 127
           GYV+ET+S  ++F SLFY+HNESVNIY+HLIPA  FL++LL +   +    TTT+ D++ 
Sbjct: 58  GYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVA 117

Query: 128 IDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKF 187
           IDLFF GAF CL LSS+FHCFKSHSLKI+  GNKLDYLGI ILI TS++S+LY+GY+D  
Sbjct: 118 IDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDP 177

Query: 188 PAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFS 247
             F +F+ IT+ FGIAC I SLKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   
Sbjct: 178 FIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIR 237

Query: 248 EIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHM 307
           E++ ++QL W++  G LYI GA LYG RFPEK  PG+ DIWG SHQ+FH LVVIA+LCH+
Sbjct: 238 EVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHL 297

Query: 308 RGVLNSYELVHIKMQNGIVS 327
           RG++ SYELVH K+   + S
Sbjct: 298 RGLIGSYELVHQKLDAQLQS 317

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 165/279 (59%), Positives = 215/279 (77%)

Query: 43  KKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVG 102
           ++  +R+Y WDEIPEWQ+DN++IL+GY+ ET S     KSL Y+HNESVNIY+HLIP   
Sbjct: 35  ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 94

Query: 103 FLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKL 162
           FL + L ++  I  +ETT  +D++MIDLFF G F CL++SS+FHCFK HSL +A LGNKL
Sbjct: 95  FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 154

Query: 163 DYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 222
           DYLGI  L+VTSMVSIL+YG++D    F +F+ +T+ FG+AC+IVSL DKFR R+WRPYR
Sbjct: 155 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 214

Query: 223 AGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYP 282
           A LFV FGLS++ P+ +G+ +Y F   W +IQL WV L G  YI+GA+LYG+RFPE+V P
Sbjct: 215 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 274

Query: 283 GRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKM 321
           G FDIWG SHQLFH LVVIA+ CH+R +L +Y+ VH +M
Sbjct: 275 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 163/282 (57%), Positives = 211/282 (74%)

Query: 44  KVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGF 103
           K   +++SW EIPEWQRDN++IL GYVKET+SF +T  SL Y+HNESVNIY+HLIP V F
Sbjct: 43  KPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCF 102

Query: 104 LTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLD 163
             VL L+K  I+ F+TTTW D+ +ID FF GAFACL++S ++HC KSHS  ++ +GN+LD
Sbjct: 103 FCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLD 162

Query: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223
           Y+GI ILI TSM S+LYYG+Y+    F  F+ +T+  G  C++V+L  +FR R WRPYRA
Sbjct: 163 YIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRA 222

Query: 224 GLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPG 283
            +FV FGLSSI+PI + + YY   E WN +QL W++L G LYI GA +YG+RFPE + PG
Sbjct: 223 SIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPG 282

Query: 284 RFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQNGI 325
            FDIWGHSHQLFH LVVIA+LCH + V  SYELVH ++   +
Sbjct: 283 SFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAV 324

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  357 bits (916), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 211/291 (72%)

Query: 31  NTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNES 90
           N      ++       K +Y+W+EIP+WQ+DN++I+ GYV+ET+S  +  +SL Y+HNES
Sbjct: 24  NQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83

Query: 91  VNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKS 150
           +NIY+H +P + FL   + DK  I  F+TTTW+D+M ID FF GAF+CLILSS+FHCFKS
Sbjct: 84  INIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS 143

Query: 151 HSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLK 210
           HS +++  GNKLDYLGI ILIV SM+SILYY ++D    F  F LI   FG++C+I S  
Sbjct: 144 HSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFD 203

Query: 211 DKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAV 270
           D FR REWRPYRAGLFV FGLS+++PI  G+  Y F E W +IQ+ WV+L G  YI GA 
Sbjct: 204 DTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAF 263

Query: 271 LYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKM 321
           LY +RFPE++ PG FD  GHSHQ+FH LVVIA+LCH+  ++NSYELVH  +
Sbjct: 264 LYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  352 bits (903), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 161/280 (57%), Positives = 213/280 (76%)

Query: 39  VAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLI 98
           + +  + L  +  WD++P+WQ+DN++I  GYVKET+SF++ F+SLF++HNESVNIYSH++
Sbjct: 43  IGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMV 102

Query: 99  PAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATL 158
           P +  L +LL+D   I  F TTT++D+ MIDLF  GAF+CLILSS+FH  KSHSL +A  
Sbjct: 103 PGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIY 162

Query: 159 GNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREW 218
           GNKLDYLGI ILIVTSM+SILYYG+YD    F LF+ IT+ FGIAC  VSL +KFR REW
Sbjct: 163 GNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREW 222

Query: 219 RPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPE 278
           RPYRA LFVCFGLS++ P+ +G++YY   + + +IQL W++  G  YI GA LY MR+PE
Sbjct: 223 RPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPE 282

Query: 279 KVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
           ++ PG FD+WGHSHQ+FH  VVIA+  H  G+L++YE  H
Sbjct: 283 RICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAH 322

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 214/276 (77%)

Query: 48  RVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVL 107
           ++ +W+ +P+WQ+DN++IL GYVKET+S      SL ++HNESVNI+SHL+PA  F+T +
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 108 LLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGI 167
           + DK  +  + TTT  D++M+DLF  GAF CL++SS+FHC K+HS  +++ GNKLDYLGI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 168 CILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 227
            +LIV+SM SILYYG+YD    +  F+ IT +FG++C++VSL ++FR REWRPYRA +FV
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 228 CFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDI 287
            FGLS+++PIF+G  YY   E   ++QL WV+L G  YI GA+LYG+RFPE++ PG FDI
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 288 WGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQN 323
           WGHSHQLFH LVV+A+LCH+RG+L SY +VH ++ +
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  347 bits (889), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 212/299 (70%), Gaps = 5/299 (1%)

Query: 25  KKRAAGNTAANPAEVAKAKKVLK----RVYSWDEIPEWQRDNDYILHGYVKETSSFVDTF 80
           K+       A   E    KK ++    RVYSWDEIP+WQ+DN++ILHGYV+ET S+ + F
Sbjct: 5   KRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELF 64

Query: 81  KSLFYMHNESVNIYSHLIPAVG-FLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACL 139
            SLFY+HNESVNIY+HLIPAV  F  +L      I  + TT+ +D+ MI+LFF G   CL
Sbjct: 65  HSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCL 124

Query: 140 ILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVS 199
            +SS FH  K HSL IAT GNKLDYLGI +LI TSM+SIL+YG++D    F  FA +T  
Sbjct: 125 TMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSL 184

Query: 200 FGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVL 259
           FG+ C  +SLKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E W ++QL WV+
Sbjct: 185 FGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVI 244

Query: 260 LGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
             G LYI GA LYG+RFPE++ PG+FDIWGHSHQLFH LVV+A+LCH++ ++ SY LVH
Sbjct: 245 WEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVH 303

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  345 bits (884), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 204/268 (76%)

Query: 51  SWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLD 110
           SWD++P+WQ+DN++IL GYV+ET+S+  TF+SLFY+HNESVNIYSHLIP + FL + L +
Sbjct: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFN 113

Query: 111 KTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICIL 170
           K  +  + TTTW D++MID+F  GA  CL LS  +HC KSHSL+++  GNKLDY+GI  L
Sbjct: 114 KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVAL 173

Query: 171 IVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFG 230
           I  SM+S +YYG+YD    F LF+ +T+S  +AC++VSL   FR REWR YRA +F  FG
Sbjct: 174 ISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAFG 233

Query: 231 LSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGH 290
           LS ++P+ +  +YY   E +++IQL W+ L G LYI GAVLYG+RFPEK+ PG FDIWGH
Sbjct: 234 LSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGH 293

Query: 291 SHQLFHFLVVIASLCHMRGVLNSYELVH 318
           SHQLFH LVVIA+LCH+R +L+ Y+ VH
Sbjct: 294 SHQLFHVLVVIAALCHLRALLSCYKNVH 321

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  280 bits (715), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 197/302 (65%), Gaps = 3/302 (0%)

Query: 19  NSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVD 78
           +S   +++R      A+   +A AK   KR+ +++E+P+WQ+DN+ IL GYV+ET S  +
Sbjct: 2   SSTTTVRQRRKTTQKASAESIATAKG-RKRLCTFEELPDWQKDNELILDGYVRETRSVSE 60

Query: 79  TFKSLFYMHNESVNIYSHLIPAVGFLTVL--LLDKTTITVFETTTWLDHMMIDLFFTGAF 136
            FKSL Y HNE+VNIY+HL+P V +L +L  L D   I  F ++T  D+++I+ F  GAF
Sbjct: 61  CFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAF 120

Query: 137 ACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALI 196
            CL+ SS FHC K HS + + + +K+DY+GI +LI  SMVSILYYG++D    F +F ++
Sbjct: 121 VCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVV 180

Query: 197 TVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLF 256
           TV  G  C+   L D+F  + +R +RA  FV FG S +VPI  GL  +  SE  +++QL 
Sbjct: 181 TVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLK 240

Query: 257 WVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYEL 316
           +V L    YI GAV YG R PE   PG+FD+ GHSHQ+FH +VV+ SLCH+R V+ SY  
Sbjct: 241 YVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIF 300

Query: 317 VH 318
           +H
Sbjct: 301 MH 302

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  277 bits (708), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 191/313 (61%), Gaps = 10/313 (3%)

Query: 13  TLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKE 72
           TL +R       K +A  + A  P +          +  ++E+P+WQRDND IL GYV+E
Sbjct: 6   TLRQRRQQCAPNKGKAGTSGATAPGK--------NGLCCFEELPDWQRDNDKILAGYVRE 57

Query: 73  TSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWLDHMMIDL 130
           T+S    F+SL Y HNE+VNIY+HLIP+  +L +L+   D   I  F TTT  D++MI+ 
Sbjct: 58  TNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINF 117

Query: 131 FFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAF 190
           F  GAF CL+ S+ FHC K HS   + + +K+DY+GI +LI  S VS+LYYG+YD    F
Sbjct: 118 FLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHF 177

Query: 191 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIW 250
            +F +  V  G  C+   L D+F  + WR  RAG FV FG S IVPI  GL  +  +E  
Sbjct: 178 KMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESS 237

Query: 251 NQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGV 310
            ++QL +VLL    YI GAV+YG R PE + PG+FD  GHSHQ+FH LVV+ SLCH R +
Sbjct: 238 KRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRAL 297

Query: 311 LNSYELVHIKMQN 323
           L SY  +H  + +
Sbjct: 298 LGSYFFMHTGISS 310

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  275 bits (702), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 205/312 (65%), Gaps = 9/312 (2%)

Query: 14  LLERTNSVQ---ELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYV 70
           L  R+NSV    E       +T+  P    + +K+   +  +DE+PEWQ+DND IL GYV
Sbjct: 17  LRSRSNSVGGIFETNHLEDNDTSQKPKTNRRKRKI--HLSKFDELPEWQKDNDKILTGYV 74

Query: 71  KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFL----TVLLLDKTTITVFETTTWLDHM 126
           +ET+SF+  F+SLFY++NE++NIY+HLIP++ +L    T + ++   I  F TT+ +D++
Sbjct: 75  RETNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYI 134

Query: 127 MIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDK 186
           +I++F  GAF CL+LSS FHC K HS K  TL +KLDY+GI ILI  S++ ILY+GY+D+
Sbjct: 135 VINIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDR 194

Query: 187 FPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSF 246
              F  F ++T SF I CSI+ L +KF    +RP RAGLF+ F  + ++P+ +G Y + +
Sbjct: 195 LSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGY 254

Query: 247 SEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCH 306
             +  +I L +VLL    YIIG +LYG R PE   PG FD++G SHQ+FH  VV+ S+CH
Sbjct: 255 KGVMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICH 314

Query: 307 MRGVLNSYELVH 318
              V+ SY L+H
Sbjct: 315 FGAVIKSYCLMH 326

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  272 bits (695), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 200/309 (64%), Gaps = 12/309 (3%)

Query: 12  STLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVK 71
           +T+ +R  +VQE +K          A  +K   + K++Y ++E+PEWQ+DND IL GYV+
Sbjct: 5   TTIRQRKTTVQETQK----------ARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVR 54

Query: 72  ETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWLDHMMID 129
           ET S +    SL Y +NESVNIY+HL+ AV +  +LL   D   I  F +TT  D+++I+
Sbjct: 55  ETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIIN 114

Query: 130 LFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPA 189
            +  GAF CL+ SS FHCFK HS   +   +K+DY+GI  LI  S++S+LYYGY+D    
Sbjct: 115 FYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFY 174

Query: 190 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEI 249
           F LF++ITV   +ACS+  L D+F   + RP RA  F+ F  SS++PI +G++ + ++E+
Sbjct: 175 FKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEV 234

Query: 250 WNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRG 309
           ++++QL +V      Y+ GA+LYG R PE + PG+FD  G SHQLFH LVV+ S CH+R 
Sbjct: 235 FHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRA 294

Query: 310 VLNSYELVH 318
           V+ SY  +H
Sbjct: 295 VMGSYMFMH 303

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  271 bits (692), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 139/310 (44%), Positives = 202/310 (65%), Gaps = 8/310 (2%)

Query: 12  STLLER-TNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYV 70
           +TL +R + SV E   R  G+  A+  E  K++K+L   + ++E+PEWQ+DND IL GYV
Sbjct: 5   TTLRKRASKSVGESGGRNDGSIHAHGEE--KSEKLL---WHFNELPEWQKDNDKILRGYV 59

Query: 71  KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGF--LTVLLLDKTTITVFETTTWLDHMMI 128
           +ET+SF    +SL Y++NESVNIY+HLIPAV +  L++ L +   I V+ +T+ +D+++I
Sbjct: 60  RETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVII 119

Query: 129 DLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFP 188
           ++FF GAF CL+ SS FHC K HS     + +KLDYLGI  LI  S V ++YYGY+D   
Sbjct: 120 NVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHIS 179

Query: 189 AFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSE 248
            F +F  IT+   I CS+  L DKF   E+RP RA  F  FG S I+P+ +G   +    
Sbjct: 180 EFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEG 239

Query: 249 IWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMR 308
           +  +I L ++ L    YI GA++YG RFPE + PG+FD +G SHQ+FH +VV+ S+CH+ 
Sbjct: 240 VLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLF 299

Query: 309 GVLNSYELVH 318
            ++ SY L+H
Sbjct: 300 AMVESYHLIH 309

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  270 bits (691), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 196/311 (63%), Gaps = 8/311 (2%)

Query: 10  EMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGY 69
           E S+ L R    +       G       E+ +     K++YS+ E+PEWQ+DN+ I+ GY
Sbjct: 12  EQSSKLSR----RRFSVSKNGTVLLESTEIVETYS--KKLYSFHELPEWQKDNELIIQGY 65

Query: 70  VKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWLDHMM 127
           V+ET+S+   F SL Y HNES+NIY+HLIP + +  +LL   D   +  F +TT +D+++
Sbjct: 66  VRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIV 125

Query: 128 IDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKF 187
           ID +  GAF CL+ SS FHC K HS   +   +K+DY+GI  LI  S++S+LYYGY+D F
Sbjct: 126 IDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHF 185

Query: 188 PAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFS 247
             F +F LIT+     C++  L ++F  + +RP RAG FV F  S+++PI +GL  + + 
Sbjct: 186 IYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYV 245

Query: 248 EIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHM 307
           E+ N+IQL +V      Y++GA+LYG R PE   PGRFD+ G SHQ+FH +VVI SL H+
Sbjct: 246 EVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHL 305

Query: 308 RGVLNSYELVH 318
           + V+ SYE +H
Sbjct: 306 KAVIGSYEFMH 316

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  269 bits (687), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 197/309 (63%), Gaps = 3/309 (0%)

Query: 19  NSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVD 78
           +S+ E+K+R       N   + K     K +Y + E+PEWQ+DND IL GY++ET S + 
Sbjct: 2   SSITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLK 61

Query: 79  TFKSLFYMHNESVNIYSHLIPAVGFLTVLL--LDKTTITVFETTTWLDHMMIDLFFTGAF 136
             +SLF  +NE+VNIY+HL+ AV +  ++L   D   +  F T+T+ D+ +I+ +  GAF
Sbjct: 62  CVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAF 121

Query: 137 ACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALI 196
            CL+ SS FH FK HS   +   +K+DY+GI +LI  SM+S++YYG++D    F LF ++
Sbjct: 122 GCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVL 181

Query: 197 TVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLF 256
           T++   AC++  L DKF  +++RP RAG F+ FGLS + P+ +G+  +       ++QL 
Sbjct: 182 TLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLK 241

Query: 257 WVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYEL 316
           ++ L    YI GA++YG R PE ++PGRFD WGHSHQ+FH LVVIAS  H++ V+ SY  
Sbjct: 242 YLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIF 301

Query: 317 VHIKMQNGI 325
            H  + NG+
Sbjct: 302 KHSHL-NGV 309

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  269 bits (687), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 126/308 (40%), Positives = 193/308 (62%), Gaps = 2/308 (0%)

Query: 13  TLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKE 72
           T   R N      K    +      +   A +  K ++++DE+PEWQ+DND IL GYV+E
Sbjct: 4   TTTRRRNQESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRE 63

Query: 73  TSSFVDTFKSLFYMHNESVNIYSHLIPAVGFL--TVLLLDKTTITVFETTTWLDHMMIDL 130
           T S+    +SLFY +NE+VNIY+HL+PA+ +    + L +   I VF +T+W D+ +I++
Sbjct: 64  TLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVINI 123

Query: 131 FFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAF 190
           F  GAF+CL+ SS FHC K HS + +   +KLDYLGI  LI  SM+ I+Y+GY+D    F
Sbjct: 124 FLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYF 183

Query: 191 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIW 250
            LF  +T+     C++  L +KF    +RP+RA  F+ FG S ++P+ +G + +    + 
Sbjct: 184 SLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVL 243

Query: 251 NQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGV 310
           N+I++ +V      YI GAV+YG R PE + PG+FD  G SHQ+FH +VV+ SLCH++ +
Sbjct: 244 NRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAI 303

Query: 311 LNSYELVH 318
           ++SY+L+H
Sbjct: 304 IDSYKLMH 311

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  268 bits (684), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 198/309 (64%), Gaps = 4/309 (1%)

Query: 12  STLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVK 71
           +T     +SV     RA+    A   +    K+  K ++++DE+PEWQ+DND IL GYV+
Sbjct: 5   TTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQ--KLLHNFDELPEWQKDNDKILTGYVR 62

Query: 72  ETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFL--TVLLLDKTTITVFETTTWLDHMMID 129
           ET S+     SLFY +NE+VNIY+HL+PA+ +    + L +   I VF +T+W D+ +I+
Sbjct: 63  ETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 130 LFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPA 189
           +F  GAF+CL+ SS FHC K HS K +   +KLDYLGI  LI  SM+ I+Y+GY+D    
Sbjct: 123 IFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISY 182

Query: 190 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEI 249
           F LF ++T+     C++  L DKF    +RP+RA  F+ FG S ++P+ +G + +    +
Sbjct: 183 FSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 250 WNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRG 309
            N+I++ +V      YI GAV+YG R PE + PG+FD +G SHQ+FH +VV+ S+CH++ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKA 302

Query: 310 VLNSYELVH 318
           +++SY+L+H
Sbjct: 303 IIDSYKLMH 311

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  267 bits (682), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 197/309 (63%), Gaps = 10/309 (3%)

Query: 20  SVQELKKRAAGNTAANPA-----EVAKAKKVLKR---VYSWDEIPEWQRDNDYILHGYVK 71
           S+   ++R   N     +     E  K+K  L++   ++ + E+P+WQRDND IL GYV+
Sbjct: 2   SITATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVR 61

Query: 72  ETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLT--VLLLDKTTITVFETTTWLDHMMID 129
           ET S+     SLFY +NE+VNIY+HL+PA+ +    V L +   I VF +TTW D+ +I+
Sbjct: 62  ETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVIN 121

Query: 130 LFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPA 189
           +F  GAF CL+ SS FHC K HS K +   +KLDYLGI  LI  SM+ I+Y+GY+D    
Sbjct: 122 IFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASY 181

Query: 190 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEI 249
           F LF ++T+     C+I  L DKF    +RP+RA  F+ FG S ++P+ +GL+ +    +
Sbjct: 182 FSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGV 241

Query: 250 WNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRG 309
            N+I++ +V      YI GA++YG R PE + PG+FD +G SHQ+FH +VV+ S+CH++ 
Sbjct: 242 LNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKA 301

Query: 310 VLNSYELVH 318
           +++SY+L+H
Sbjct: 302 IIDSYKLMH 310

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  266 bits (679), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 126/288 (43%), Positives = 191/288 (66%), Gaps = 5/288 (1%)

Query: 33  AANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVN 92
           A +   V++ KK+L   +++DE+PEWQ+DND IL GYV+ET S+     SLFY +NE+VN
Sbjct: 27  AVSSTTVSEKKKLL---HNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVN 83

Query: 93  IYSHLIPAVGFL--TVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKS 150
           IY+HL+PAV +    + L +   I VF +T+W D+ +I++F  GAF+CL+ SS FHC K 
Sbjct: 84  IYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQ 143

Query: 151 HSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLK 210
           HS K +   +KLDYLGI  LI  SM+ I+Y+GY+D    F LF ++T+     C++  L 
Sbjct: 144 HSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLH 203

Query: 211 DKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAV 270
           +KF    +RP+RA  F+ FG S ++P+ +G + +    + N+I++ +V      YI GAV
Sbjct: 204 EKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAV 263

Query: 271 LYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
           +YG R PE + PG+FD  G SHQ+FH +VV+ S+CH++ ++ SY+L+H
Sbjct: 264 IYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  266 bits (679), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 136/305 (44%), Positives = 188/305 (61%), Gaps = 5/305 (1%)

Query: 19  NSVQELKKR--AAGNTAANPAEVAKAKKVLKRVYS-WDEIPEWQRDNDYILHGYVKETSS 75
           +S   LK+R  A  N   N      A++  K     ++E+PEWQRDN+ IL GYV+ET S
Sbjct: 2   SSTCTLKQRRSACKNELKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRS 61

Query: 76  FVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWLDHMMIDLFFT 133
                +SL Y HNE++NIY+HLIP+  +L +L+   D   I  F +TT  D++MI+ +  
Sbjct: 62  MRKCLESLTYFHNETLNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLL 121

Query: 134 GAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLF 193
           GAF CL+ S+ FHC K HS   + + +K+DY+GI +LI  S VS+LYYG++D    F +F
Sbjct: 122 GAFLCLLCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIF 181

Query: 194 ALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQI 253
            +  V  G  C+   L D+F  + WR  RAG FV FG S IVPI  GL  +  +E   ++
Sbjct: 182 TIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRV 241

Query: 254 QLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNS 313
           QL +VLL    YI GA++YG R PE + PG+FD  GHSHQ+FH LVV+ SLCH R ++ S
Sbjct: 242 QLRFVLLEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGS 301

Query: 314 YELVH 318
           Y  +H
Sbjct: 302 YFFMH 306

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  262 bits (669), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 199/317 (62%), Gaps = 3/317 (0%)

Query: 10  EMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGY 69
            ++T+    +SV + +   + N         +  + +K  + + E+P+WQ+DN++IL GY
Sbjct: 3   HIATVEREYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCH-FHELPDWQKDNEFILTGY 61

Query: 70  VKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWLDHMM 127
           V+ET+S     +SL   +NES+NIYSHLI A+ +  VLL   D   I  F +TT++D+M+
Sbjct: 62  VRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYMV 121

Query: 128 IDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKF 187
           IDL+  GAF CLI SS FHC K HS   + + +K+DY+GI  LI  S++S+LYYGY D F
Sbjct: 122 IDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDHF 181

Query: 188 PAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFS 247
             F +F +IT+     C+I  L  +F  + +RP RAG F+ F +S+++PI +G   + F+
Sbjct: 182 IYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGFT 241

Query: 248 EIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHM 307
           E+  +IQL +V      Y++GA+LYG R PE +YPG FD+ G SHQ+FH +V++ S+ H+
Sbjct: 242 EVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFHL 301

Query: 308 RGVLNSYELVHIKMQNG 324
           + VL SY  +H  + + 
Sbjct: 302 KAVLGSYTFMHSNISSN 318

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  260 bits (665), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 192/311 (61%), Gaps = 5/311 (1%)

Query: 15  LERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETS 74
           +  T +++  +  +       P  ++     +KR+Y + E+PEWQ+DND I+ GY++ET 
Sbjct: 1   MSATTTIRHRRSISEKLEQLTPVAISST---IKRLYRYSELPEWQQDNDKIITGYIRETK 57

Query: 75  SFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVL--LLDKTTITVFETTTWLDHMMIDLFF 132
           S  +  KSLF  HNES+NIYSHL+P + +L +L  L D   +  F  +T +  +MI  F 
Sbjct: 58  SVKECVKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFL 117

Query: 133 TGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCL 192
            G+  CL  SS FHC K HS     + +K+DY+GI I+I  S++S+LYYG++D    F  
Sbjct: 118 LGSVLCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKC 177

Query: 193 FALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQ 252
           F + TV  G  C++ +L DKF  + +RP+RA  +V FGLS IVPI +G + +   E   +
Sbjct: 178 FTVFTVILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRR 237

Query: 253 IQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLN 312
           +QL +VLL    YI GAV+YG RFPE + PG+FD  GHSHQ+FH +VV+ S+CH R +L 
Sbjct: 238 VQLKYVLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILG 297

Query: 313 SYELVHIKMQN 323
           SY  +H  M +
Sbjct: 298 SYVFMHTGMHH 308

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  260 bits (664), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 195/314 (62%), Gaps = 2/314 (0%)

Query: 11  MSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYV 70
           MS +        +++  A G++  +       +   +R+++++E+PEWQRDND IL GYV
Sbjct: 1   MSRVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYV 60

Query: 71  KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLT--VLLLDKTTITVFETTTWLDHMMI 128
           +ET SF    +SL Y +NE++NIY+HLIPA+ +LT  V L++   +  F TT+ +D+ +I
Sbjct: 61  RETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVI 120

Query: 129 DLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFP 188
           ++F  GAF CLILSS FHC K HS +  TL +KLDY+GI ILI  S++ ++Y+GY+D   
Sbjct: 121 NVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLY 180

Query: 189 AFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSE 248
               F ++T SF   CSI  L +KF    +RP+RA +F+ F  S  +PI +G Y + F  
Sbjct: 181 YVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHG 240

Query: 249 IWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMR 308
           ++ ++ L +V      YI GA LYG R PE   PG FD  G SHQ+FH LVV+ S+CH R
Sbjct: 241 VFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFR 300

Query: 309 GVLNSYELVHIKMQ 322
            V+ SY L+H  M 
Sbjct: 301 AVIKSYILMHSSMN 314

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  259 bits (663), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 125/300 (41%), Positives = 186/300 (62%), Gaps = 8/300 (2%)

Query: 17  RTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSF 76
           +  ++ E+ +  A  T+         KK ++++Y++DE+P WQ+DN+ IL GYV+ET+S 
Sbjct: 8   KEQTISEMAQEMAHTTSEG------LKKRIRKLYTFDELPAWQKDNELILSGYVRETNSV 61

Query: 77  VDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWLDHMMIDLFFTG 134
            +  +++ Y +NES+NIY+HLIP V +L + L+  D     +       +H M+  +  G
Sbjct: 62  KECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLG 121

Query: 135 AFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFA 194
           AF CL  SS FHC K HS   + L +K+DYLGI   I  S +S+LYYGY+     F  F+
Sbjct: 122 AFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFS 181

Query: 195 LITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQ 254
            +TV+   AC+++ L D F    +RP RA LF+ FGLS ++P+ +G Y + F+E   +IQ
Sbjct: 182 TLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQ 241

Query: 255 LFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSY 314
           L +VL     YI GA++YG R PE+  PG+FD+ GHSHQ+FH LVV+ +LCH R V  SY
Sbjct: 242 LKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  252 bits (644), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 179/279 (64%), Gaps = 2/279 (0%)

Query: 38  EVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHL 97
                K   +R+YS+DE+PEWQ+DN+ I  GYV+ET+SF++  KS+ Y +NESVNIY+HL
Sbjct: 11  RCGHKKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHL 70

Query: 98  IPAVGFL--TVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKI 155
           +P+V +    +L +D     +F  TT  +++MID +  G F CL+ S+ FHC K HS   
Sbjct: 71  VPSVTYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESH 130

Query: 156 ATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRK 215
             + +K+DY+GI + I +S+VSILYYG+YD        +++T++ G+ C    L D+F  
Sbjct: 131 NRIWSKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNA 190

Query: 216 REWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMR 275
            ++R  RA  F  FG S +VP+  G+Y +   E   +IQL +VL G   YI GA++YG R
Sbjct: 191 IDYRLLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFR 250

Query: 276 FPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSY 314
            PE + PG+FD  GHSHQ+FH LVV+ S+CH R V+ SY
Sbjct: 251 IPEALAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  243 bits (619), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 193/312 (61%), Gaps = 13/312 (4%)

Query: 19  NSVQELKKRAAGNTAANPAEVAKAK-----KVLKRV-YSWDEIPEWQRDNDYILHGYVKE 72
           +S+   +KR+    +A  + + + +     K+ KR+ Y + E+P WQ+DND IL GYV+E
Sbjct: 4   HSLTRTRKRSKSFRSAK-STITRTRSDSSIKIEKRILYHFHELPTWQQDNDKILGGYVRE 62

Query: 73  TSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLT--VLLLDKT----TITVFETTTWLDHM 126
           T+SF    +SLFY++NES+NIYSHLIP++ +LT  V+LL +      I ++ TTT  D +
Sbjct: 63  TNSFTKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFI 122

Query: 127 MIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDK 186
            I++F  GAF CL+ S  FH  K HS       +++DY+GI +LI  SM+ +LYYG++D 
Sbjct: 123 FINIFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDH 182

Query: 187 FPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSF 246
              F  F  +T++F   CSI+ + + F   ++R  RA +F  FG S ++P+  G   +  
Sbjct: 183 IVLFYCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGL 242

Query: 247 SEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCH 306
           S ++ +I L ++      Y++GA LYG R PE + PG+FD++G SHQLFH  VVI S+ H
Sbjct: 243 SGVFQRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLH 302

Query: 307 MRGVLNSYELVH 318
            + V+ SY L+H
Sbjct: 303 FKAVIESYILMH 314

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  242 bits (618), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 183/297 (61%), Gaps = 3/297 (1%)

Query: 25  KKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLF 84
           + ++  +  +  AE  K K     +Y+++E+P WQ+DN+ IL GY++ET+S+    +SL 
Sbjct: 19  RSKSISSILSQAAEDVKQKITDTLLYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLT 78

Query: 85  YMHNESVNIYSHLIPAVGFLTVLLLDKTTI---TVFETTTWLDHMMIDLFFTGAFACLIL 141
           + HNE++NIYSH I A  +L +L+   T +     F TTT  D++++D++  GA  CL L
Sbjct: 79  FFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTL 138

Query: 142 SSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFG 201
           SS FHC K HS   + + +K+DY+GI  LI  S +S+LY+GY D F  F  FA+ T    
Sbjct: 139 SSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFNYFKFFAISTFILA 198

Query: 202 IACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLG 261
           I C++    +KF  R+W+  RA  F+ F  S ++P+ +G+  + F E+W ++QL  + L 
Sbjct: 199 ITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLE 258

Query: 262 GALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
              Y+IGA+LYG R PE   PG+FD  G+SHQ FH  VV+ SL H+R ++ SY  +H
Sbjct: 259 LICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMH 315

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  233 bits (593), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 186/317 (58%), Gaps = 20/317 (6%)

Query: 22  QELKKRAA--GNTAANPAEVAKAKK---------------VLKRVYSWDEIPEWQRDNDY 64
            EL+KRA   G TA   A V++  +                  R+  ++E+P WQ+DND 
Sbjct: 3   SELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDNDC 62

Query: 65  ILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLT--VLLLDKTTITVFETTTW 122
           I  GYV+ET S      SL Y +NESVN+YSHL+PAV ++    L L +  +  F TTTW
Sbjct: 63  IRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTW 122

Query: 123 LDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYG 182
            D+++I+ F  GA ACL+ SS FHC K HS +     +++DY+GI +LI  S + ++Y+G
Sbjct: 123 SDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFG 182

Query: 183 YYDKFPAFCLFALITVSFGIACSIVSLKDK-FRKREWRPYRAGLFVCFGLSSIVPIFSGL 241
           Y+D      LF  +TV+ G+ACS V L +K F    ++  RA  F+ F  + ++P+ +G 
Sbjct: 183 YFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGF 242

Query: 242 YYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVI 301
             +    + ++I L +V      YI GA+LYG R PE   PG+ D+WG+SHQ+FH +VV 
Sbjct: 243 VKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVF 302

Query: 302 ASLCHMRGVLNSYELVH 318
            SLCH++ VL SY L+H
Sbjct: 303 GSLCHLKAVLESYSLMH 319

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  155 bits (391), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 146/281 (51%), Gaps = 28/281 (9%)

Query: 51  SWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLD 110
           +++++P+WQ+DN  I++ YV+ET+S   +  S+F  H+ES+NI++HLIPA      LL  
Sbjct: 10  NFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA------LLYA 63

Query: 111 KTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICIL 170
           K T     T   + + ++  +      C +LSS FH FK  S++      KLDY+GI +L
Sbjct: 64  KFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGISLL 122

Query: 171 IVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREW------------ 218
           I  ++VS+   G+ +          +T +  +   ++ L  K   ++             
Sbjct: 123 INATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGTLSE 182

Query: 219 ---------RPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGA 269
                    +  RA LF   GLS ++P+ +GLY Y    ++ +I +  V+     YI+G 
Sbjct: 183 DDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYIVGT 242

Query: 270 VLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGV 310
           ++Y  + PEK YPGRFD+ G SHQLFH  +V  ++CH   +
Sbjct: 243 LIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  125 bits (314), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 158/308 (51%), Gaps = 10/308 (3%)

Query: 16  ERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRD--NDYILHGYVKET 73
           +    +Q+  K    N         +  KVL  +    E+P+WQ+   N  I++GYV+ET
Sbjct: 11  QTATEIQDADKLTPFNAPKYSVTFPRRPKVLPIL---KELPQWQKQYSNSKIINGYVRET 67

Query: 74  SSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWLDHMMIDLF 131
           +S +    ++ Y +N++VNI  + + +  + T+LL   D   I     TT  D++M++ +
Sbjct: 68  NSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIMVNFY 127

Query: 132 FTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFC 191
             GAF    L+S F+  +SHSL    L  KL +L     I TS+++ LYY ++D    F 
Sbjct: 128 LFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDNVFYFK 187

Query: 192 LFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLS-SIVPIFSGLYYYSFSEIW 250
              + T+      +I +L ++F ++  R  R  + + F +S  I+P  S ++ ++   I 
Sbjct: 188 FLTISTLLISSIFAIFTLSEQFLRKN-RSQRNMVSITFIVSLLILPTASLMFKFNTFRIL 246

Query: 251 NQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGV 310
            +++   +LL  +LY+    L  ++ PE+ +   FD  G+S  ++H  +++ SL H + +
Sbjct: 247 RRVEGKAILLELSLYLFSMTLKAVQVPER-FSENFDFIGNSENIYHICIILGSLLHFKML 305

Query: 311 LNSYELVH 318
           LNSY  +H
Sbjct: 306 LNSYFFMH 313

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  114 bits (286), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 145/283 (51%), Gaps = 9/283 (3%)

Query: 42  AKKVLKRVYSWDEIPEWQRD--NDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIP 99
           +K   +  Y   E+PEWQR+  +  ++ G++KET+SF     S  Y HN S+NI  + I 
Sbjct: 26  SKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIA 85

Query: 100 AVGFLTVLLL--DKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIAT 157
           A  +  +L    D   I  F +TT  D+++++L+   A    ++ + F+  KSHS + A 
Sbjct: 86  ATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAF 145

Query: 158 LGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSF--GIACSIVSLKDKFRK 215
           L  KL+ +G+   I +S+V++LYY Y+D    F  F ++T+       CSI+S  D F K
Sbjct: 146 LWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIIS--DSFNK 203

Query: 216 REWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMR 275
                    L     L +++P    +  +  +++  +I L  ++L   +Y  G  +   +
Sbjct: 204 MTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQ 263

Query: 276 FPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
            PE+ +   FD  G+S  ++   +++ S  H + ++NSY L+H
Sbjct: 264 LPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMH 305

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 130/288 (45%), Gaps = 41/288 (14%)

Query: 54  EIPEWQRDNDYILHGY------VKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVL 107
           E+P   R+N YI+HGY      VK   S V+ +      HNE++NI+SHL  AV    +L
Sbjct: 303 ELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYG----WHNETLNIWSHLFGAVYLAYLL 358

Query: 108 LLDKTTITVF--ETTTWLDHMMIDLFFTGAFACLILSSSFHCFK-SHSLKIATLGNKLDY 164
            +   T  VF  +       ++I +F      CL+ SS +H    +  L +      +DY
Sbjct: 359 FIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDY 418

Query: 165 LGICILIVTSMVSILYYGYYDKF-----PAFCLFALITVSFGIACSIVSLKDKFRKREWR 219
            GI +LI  S++S  +   Y+        +  ++  +++  GI  S ++   +F + E R
Sbjct: 419 TGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESR 478

Query: 220 PYRAGLFVCF-GLSSI----VPIFSGLYYYS--FSEIWNQIQLFWVLLGGALYIIGAVLY 272
           P+R   +V   GL  I    + I  G+ + S  F  +WN+  L W       Y+IG V Y
Sbjct: 479 PFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNR-SLIW-------YLIGVVFY 530

Query: 273 GMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIK 320
           G   PE+        W    +L + +   A LC    +L  ++ VH +
Sbjct: 531 GSFIPER--------WRTDVELDYTIPTDAELCSNLDILTKHKHVHFR 570

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 141/295 (47%), Gaps = 24/295 (8%)

Query: 41  KAKKVLKRVYSWDEIPEWQR--DNDYILHGYVKET-SSFVDTFKSLFYMHNESVNIYSHL 97
           + K V  ++ + +++P W R   N  I  GY   T ++++   + L   +N+S++IY +L
Sbjct: 2   EKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNL 61

Query: 98  IPAV--GFLTVLLLDKTTITVFETTTWLDHMMIDLFF---TGAFACLILSSSFHCFKSHS 152
           +  +  G + +   D   I    +TT  D+++I+LF    T  FA + L       K HS
Sbjct: 62  VCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLG---QLLKGHS 118

Query: 153 LKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDK 212
                L N+   L + +L+  S+V++LYY ++D    F LF + T       SIV + D+
Sbjct: 119 EYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQ 178

Query: 213 FRKREWRPYRAGLFVCFGLSSI-VPIFSGLYYYSFSEIWNQIQLFWVLLGG--ALYIIGA 269
           +++ +    +    V FG+ SI +PI   +  +   + + + ++ + +L     LY + A
Sbjct: 179 YKRVQ----KLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSA 234

Query: 270 VLYGMRFPEKVYPGR------FDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
           +L   R PE             D  G+S Q+   + + A + H   ++ +YE+VH
Sbjct: 235 MLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 115/238 (48%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFK----SLFYM---HNESVNIYSHLIPAVGFLTV 106
           ++P   R+N YI++ Y      F D+ K    S+F     HNES NI++HL+ A+  + +
Sbjct: 254 QLPFPWRENRYIIYNY-----RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYL 308

Query: 107 LLLDKTTITVF--ETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLD 163
            + D     +F  E       +++ LF   A  CL+ S  +H F   S LK+ +    +D
Sbjct: 309 SIYDFPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVD 368

Query: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223
           Y GI ILI  S+++  +   Y  F A C++  I++S G+    ++   KF + E RP R 
Sbjct: 369 YSGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRI 428

Query: 224 GLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
             F+   L + + + S L+    + +     L   +   ++  Y++G V YG   PE+
Sbjct: 429 KFFI---LLASMGVLSFLHLTYLTNLQYATWLLTPVTNKSIVWYLVGVVFYGSFIPER 483

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 117/238 (49%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTF-KSLFYM------HNESVNIYSHLIPAVGFLTV 106
           ++P   R+N YI+HGY      F +T  KSL  +      HNE+ NI+SHL+ A+  + +
Sbjct: 219 QLPFPWRENRYIIHGY-----RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYL 273

Query: 107 LLLDKTTITVFETTTWLDHM--MIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLD 163
            + D     V+           ++ +F   A  C++ S  +H F   S L++ +    +D
Sbjct: 274 AIYDFPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVD 333

Query: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223
           Y GI ILI  S+++  +   Y  + A C +  I+++ G+    ++   +F + E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRI 393

Query: 224 GLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
             F+   L + + + S L+    ++I+   +LF  +   ++  Y++G V YG   PE+
Sbjct: 394 RFFI---LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVVWYLVGVVFYGSFIPER 448

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 110/237 (46%), Gaps = 20/237 (8%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFK----SLFYMHNESVNIYSHLIPAVGFLTVLLL 109
           ++P   R+N YI++ Y      F D+ K    S+F +HNE+ NI+SHL+ A+ FL VL  
Sbjct: 197 QLPFPYRENRYIINNY-----RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFH 251

Query: 110 D--KTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLDYLG 166
           D   + I           + + LF   +  C++ S+ +H F   S LK+      +DY G
Sbjct: 252 DLPNSIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSG 311

Query: 167 ICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLF 226
           I ILI +S++SI +   YD       +   +   G+    ++    F   E RP R   F
Sbjct: 312 ISILITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFF 371

Query: 227 VCFGLSSIVPIFSGLYYYSFSE--IWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
           +   LSS       L +  F E  I+  I +   L   ++  Y++G V YG   PE+
Sbjct: 372 IL--LSSCGAF--ALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 115/234 (49%), Gaps = 12/234 (5%)

Query: 54  EIPEWQRDNDYILHGYV---KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLD 110
           ++P   R+N YI+HGY      + S +  F + +  HNE+ NI+SHL+ A+  + + + D
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 111 KTTITVFETTTWLDHM--MIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLDYLGI 167
                V++          ++ +F   A  C++ S  +H F   S LK+ +    +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 168 CILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 227
            ILI  S+++  +   Y  + A C +  I+++ GI    ++   +F + E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 228 CFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
              L + + + S L+    +++    +LF  +   ++  Y++G   YG   PE+
Sbjct: 398 ---LLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVAFYGSFIPER 448

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 110/241 (45%), Gaps = 26/241 (10%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFK-------SLFYMHNESVNIYSHLIPAVGFLTV 106
           ++P   R+N YI++ Y      F D+ K       + +  HNE+ NI++HLI  +  + +
Sbjct: 220 QLPFPWRENRYIIYNY-----RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYM 274

Query: 107 LLLD--KTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFK-SHSLKIATLGNKLD 163
            + D  ++ I + +       +++ LF   A  CL  S  +H F  + +LK+ +    +D
Sbjct: 275 AVYDFPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVD 334

Query: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223
           Y GI ILI  S+++  +   Y  + A C++  I++S GI    ++   KF + E RP R 
Sbjct: 335 YSGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRI 394

Query: 224 GLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGA-----LYIIGAVLYGMRFPE 278
             FV      ++       + +F   W      W+L          Y IG V YG   PE
Sbjct: 395 KFFVLLASMGVL----SFLHLTFLTDWKYAT--WLLAPVTNKSIVWYCIGVVFYGSFIPE 448

Query: 279 K 279
           +
Sbjct: 449 R 449

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 116/238 (48%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDT-FKSLFYM------HNESVNIYSHLIPAVGFLTV 106
           ++P   R+N YI+HGY      F +T +KSL  +      HNE+ NI++HL+ A+  + +
Sbjct: 219 QLPFPWRENRYIIHGY-----RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYL 273

Query: 107 LLLDKTTITVFETTTWLDHM--MIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLD 163
            + D     V++          ++  F   A  C++ S  +H F   S L + +    +D
Sbjct: 274 AVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVD 333

Query: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223
           Y GI ILI  S+++  +   Y  + A C +  I+++ G+    ++   +F + E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRI 393

Query: 224 GLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
             F+   L + + + S L+    +++   I LF  +   ++  Y++G V YG   PE+
Sbjct: 394 RFFI---LLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPER 448

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 127/295 (43%), Gaps = 31/295 (10%)

Query: 5   RKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEV------AKAKKVLKRVYSWDEIPEW 58
           R EA    ++L  +       K A   T +   E       ++A+ + + ++ W E+P  
Sbjct: 55  RGEAGGGRSVLCASGEPGSAHKWAGAVTCSGAEEQPLHWAESRARGLARHLHYW-ELPYA 113

Query: 59  QRDNDYILHG---YVKETSSFVDTFKSLFYMHNESVNIYSHLIPA--VGFLTVLLLDKTT 113
            R+N YI++G   Y     S +    + +  HNE++NI+SHL+ A  + +L      ++ 
Sbjct: 114 WRENRYIIYGHRFYHSHRKSLLSVLNA-YGWHNETINIWSHLVGAAVLAYLLCWGWPRSD 172

Query: 114 ITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLDYLGICILIV 172
           +        L    I  F      C+  S ++H F     LK+ +    +DY GI +L+ 
Sbjct: 173 VYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVCVDYTGITLLVT 232

Query: 173 TSMVSILYYGYYD-KFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGL 231
            S+V+ +    Y    P    + + ++  G A  +++    F + E RP R  ++V  GL
Sbjct: 233 ASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEARPLRIAVYV--GL 290

Query: 232 SSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL-------YIIGAVLYGMRFPEK 279
           +++     GL   SF  +W Q++     L   L       Y IG V Y    PE+
Sbjct: 291 AAL-----GL--VSFVHVWMQVRWASAHLMAPLVYKSLVWYGIGVVFYATLVPER 338

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 106/233 (45%), Gaps = 10/233 (4%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFKSL--FYMHNESVNIYSHLIP--AVGFLTVLLL 109
           E+P   R+N YI+H Y    S+      ++  +  HNE+ NI+SH +    V +L V   
Sbjct: 221 ELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFLGFFYVVYLAVYEF 280

Query: 110 DKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLDYLGIC 168
            ++ +   +        ++ +F   A  CLI S+ +H F   + LK+      +DY GI 
Sbjct: 281 PQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRFACVDYSGIS 340

Query: 169 ILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 228
           ILI  S+++  +    D  P   L+  I+++ GI    ++   +F   E RP R   F+ 
Sbjct: 341 ILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEARPLRIRFFML 400

Query: 229 FGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
                ++   +  Y  S++     + L   +   ++  Y++G V YG   PE+
Sbjct: 401 LAAMGVLSFINASYLESWAY---AVDLLSPITNKSIVWYLVGVVFYGSFIPER 450

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 114/234 (48%), Gaps = 12/234 (5%)

Query: 54  EIPEWQRDNDYILHGYV---KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLD 110
           ++P   R+N YI+HGY      + S +  F + +  HNE+ NI+SHL+ A+  + + + D
Sbjct: 220 QLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 111 KTTITVFETTTWLDHM--MIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLDYLGI 167
                V+  +        ++ +F   A  C++ S  +H F   S LK+ +    +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 168 CILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 227
            ILI  S+++  +   Y  + A   +  I+++ G+    ++   +F + E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 228 CFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
              L + + + S L+    +++     LF  +   ++  Y++G V YG   PE+
Sbjct: 399 ---LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPER 449

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 111/244 (45%), Gaps = 31/244 (12%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFKSL-------FYMHNESVNIYSHLIPAVGFLTV 106
           E+P   R+N YI+HGY      F D F  L       + +HNE+ NI++H++ A   + +
Sbjct: 248 ELPFPWRENKYIIHGY-----RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYL 302

Query: 107 LLLD-KTTITVFET--TTWLDHMMIDLFFTGAFACLILSSSFHCFK-SHSLKIATLGNKL 162
           L +D + T  V +T         +I +F      C+  S  +H F  + S+++      +
Sbjct: 303 LTVDFQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCV 362

Query: 163 DYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 222
           DY GI +LI  S++S  Y   YD   A   + +++  F +    ++   KF   E RP R
Sbjct: 363 DYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLR 422

Query: 223 AGLFVCF----GLSSIVPI-FSGLYY--YSFSEIWNQIQLFWVLLGGALYIIGAVLYGMR 275
              FV      GLS +  +   GL    + FS + N+  ++        YIIG   YG  
Sbjct: 423 IKFFVLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSVIY--------YIIGVFFYGSF 474

Query: 276 FPEK 279
            PE+
Sbjct: 475 IPER 478

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 139/322 (43%), Gaps = 37/322 (11%)

Query: 11  MSTLLERTNSVQELKKRAAGNTAANPAEVAKAK---KVLKRVYSWDEIPEWQRDNDYILH 67
           M++L     S  E K      + A  A  + A    K  K+ + + ++ +WQ+       
Sbjct: 1   MASLTTVEQSPVEPKTATEKYSDATGAVTSNADVETKETKKGFPFHDLAKWQKQ------ 54

Query: 68  GYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMM 127
              K  SS  ++  +L Y+   S++ +  LI    F  + L   TT       T  D+++
Sbjct: 55  --YKNKSSRSESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPTTT-------TMTDYIV 104

Query: 128 IDLFFTGAFACLILSSSFHCFKSHSLKI-ATLGNKLDYLGICILIVTSMVSILYYGYYDK 186
            + +    F   ++   +H  K+ SL+    +  K  YL    L+++S ++ILYY +YD 
Sbjct: 105 FNFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDY 164

Query: 187 FPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLF------VCFGLSSIVPI--F 238
              F +F L+    G+A   V L DK     ++ +   +F      VC  L  +  I  F
Sbjct: 165 VFFFKIFTLLMTFIGLAAYFVILTDKL--NSYKRFNKTVFFISVSVVCCSLPLLTAIITF 222

Query: 239 SGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKV--YPGRFDIWGHSHQLFH 296
            GL       + ++I+L  +       ++ +++Y  RFPE +     + + W HS   FH
Sbjct: 223 DGL-----ENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFH 277

Query: 297 FLVVIASLCHMRGVLNSYELVH 318
            L+   +  H   ++ SY L+H
Sbjct: 278 LLISGTAFYHFFILIQSYILMH 299

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 107/242 (44%), Gaps = 23/242 (9%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFKSLFYM---HNESVNIYSHLIPAV--GFLTVLL 108
           E+P   R+N +I+HGY +  +S+  +  S+F     HNE+VNI++HL  A+   FL    
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 109 LDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKS-HSLKIATLGNKLDYLGI 167
             +TT+   E        M  +F T    C + S  +H F     LK  +    +DY GI
Sbjct: 278 FSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGI 337

Query: 168 CILIVTSMVS---ILYYGYYDKFPAFCL--FALITVSFGIACSIVSLKDKFRKREWRPYR 222
            +L+  S+++   +   G  D    + L  F   + + G     ++   KF + E RP R
Sbjct: 338 TVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLR 397

Query: 223 AG---LFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFP 277
                L   FG       FS L+   F+   +   L   +   +L  YIIG V YG   P
Sbjct: 398 IAFYLLLASFGF------FSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIP 451

Query: 278 EK 279
           E+
Sbjct: 452 ER 453

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 74/333 (22%), Positives = 140/333 (42%), Gaps = 48/333 (14%)

Query: 11  MSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYV 70
           ++T+ +     +   ++  G      + V    K +K+ + + ++ +WQ+        Y 
Sbjct: 4   LTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQ-------YR 56

Query: 71  KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL--DKTTITVFETTTWL-DHMM 127
            ++S             NES+    +L+ ++    +L+   D   I +F TTT + D+++
Sbjct: 57  NKSS------------RNESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 128 IDLFFTGAFACLILSSSFHCFKSHSLKIATLG-NKLDYLGICILIVTSMVSILYYGYYDK 186
            + +    F   ++   +H  K+ SL+       K  YL    L+++S ++ILYY +YD 
Sbjct: 105 FNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 187 FPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLF-----VCFGLSSIVPI--FS 239
              F +F L+    G+      L DK    + R  +   F     VC  L  +  I  F 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFD 223

Query: 240 GLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVY--PGRFDIWGHSHQLF-- 295
           GL       +  +I++  +       +  +++Y  RFPE ++    + + W HS  LF  
Sbjct: 224 GL-----ENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHL 278

Query: 296 --------HFLVVIASLCHMRGVLNSYELVHIK 320
                   HF ++I S   M   LN  EL++ K
Sbjct: 279 VISGTAFYHFFILIQSYILMHSSLNQPELINFK 311

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 108/236 (45%), Gaps = 16/236 (6%)

Query: 54  EIPEWQRDNDYILHGY--VKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLD- 110
           ++P   R+N YI++GY    + S  + +  + +  HNE+ NI+SHL+ A+ F  ++L + 
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 111 -KTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSH-SLKIATLGNKLDYLGIC 168
            K+ I            ++ LF      C++ S  +H F    S+K+      +DY GI 
Sbjct: 315 PKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGIT 374

Query: 169 ILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 228
           ILI  S+++  +   YD      ++  +++ FG     ++   KF   E RP R   F+ 
Sbjct: 375 ILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFI- 433

Query: 229 FGLSSIVPIFSGLYYYSFSEIWNQIQLFWV---LLGGAL--YIIGAVLYGMRFPEK 279
                ++    GL ++  + +       W+   +   ++  Y+IG   YG   PE+
Sbjct: 434 -----LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVWYLIGVFFYGSFIPER 484

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 111/241 (46%), Gaps = 25/241 (10%)

Query: 54  EIPEWQRDNDYILHG---YVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLD 110
           E+P+  R+N YI++G   Y     S +    +++  HNE++NI+SH+  A+  L ++L  
Sbjct: 244 ELPQPWRENPYIIYGHRFYHSHKKSLLSIL-NVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 111 KTTITVFETTT--WLDHMMIDLFFTGAFACLILSSSFHCFKSHS-LKIATLGNKLDYLGI 167
                VF +T    +    I +F      C++ S  +H F     L + +  + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 168 CILIVTSMVSILYYGYYDKFP-AFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLF 226
            ILI  S+++   +  Y   P A  L+  I++  G+  +  +   +F   + R +R   +
Sbjct: 363 TILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFY 422

Query: 227 VCFGLSSIVPIFSGLYYYSFSEI-----WNQIQLFWV-LLGGAL--YIIGAVLYGMRFPE 278
           V         I +GL   SF  +     W+  +L    L+  ++  Y+IG V Y    PE
Sbjct: 423 V---------ILAGLGLISFVHLTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPE 473

Query: 279 K 279
           +
Sbjct: 474 R 474

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 112/243 (46%), Gaps = 30/243 (12%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDT-FKSLFYM------HNESVNIYSHLIPA--VGFL 104
           ++P   R+N +I+HGY      F D+ +KSL  +      HNE+ NI++HL  A  V +L
Sbjct: 136 QLPFPWRENRFIIHGY-----RFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWL 190

Query: 105 TVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFK-SHSLKIATLGNKLD 163
            V    +T++   E    +   ++ +F   A  C++ S   H F  +  L + +    +D
Sbjct: 191 AVYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVD 250

Query: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223
           Y GI +LI  S+++  +   Y+   +   +  ++   GI   I++   KF + E RP R 
Sbjct: 251 YSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLRI 310

Query: 224 GLFVCF----GLSSI-VPIFSGLYYYSF--SEIWNQIQLFWVLLGGALYIIGAVLYGMRF 276
             F+      GLS + + +  G  Y S+  + +     L W       Y++G   YG   
Sbjct: 311 KFFILLAAMGGLSFMQLGLLGGWKYASWLMAPV-THKSLVW-------YLLGVAFYGSFV 362

Query: 277 PEK 279
           PE+
Sbjct: 363 PER 365

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 118/259 (45%), Gaps = 32/259 (12%)

Query: 43  KKVLKRVYSWDEIPEWQRDNDYILHGYV---KETSSFVDTFKSLFYMHNESVNIYSHLIP 99
           K  L R   + E+P   R+N +I+HGY      T S +    + +  HNE+ NI++HL  
Sbjct: 225 KTGLSRHLHYYELPFPWRENRFIIHGYRFYHSHTKSLLSIL-NWYGWHNETTNIWTHLFG 283

Query: 100 A--VGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSH-SLKIA 156
           +  + +L      ++++ +          M+ LF    F CL+ S ++H F     L + 
Sbjct: 284 SLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLR 343

Query: 157 TLGNKLDYLGICILIVTSMVSILY---YGYYDKFPAFCLFALI---TVSFGIAC--SIVS 208
           +    +DY GI +LI  S+++  +   YG  D   +   F+LI    VS  + C    ++
Sbjct: 344 SKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMN 403

Query: 209 LKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSF---SEIWNQIQLFWVL---LGG 262
              +F + E RP R   ++         + +G+ + +F   + I N     W++   L  
Sbjct: 404 WSPRFDRPESRPLRIAFYL---------LLAGMGFLAFLHLTLITNFAHSSWLIRPVLDK 454

Query: 263 AL--YIIGAVLYGMRFPEK 279
           ++  Y+IG + YG   PE+
Sbjct: 455 SVCWYLIGVIFYGSFIPER 473

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 112/238 (47%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFKSL---FYMHNESVNIYSHLIPAVGFLTVLL-- 108
           ++P   R+N YI+HGY +  +S   +F S+   +  HNE+ NI++HL+  +  + +    
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 109 LDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFK-SHSLKIATLGNKLDYLGI 167
              + I + +        ++ +F   A  C+  S  +H F  +H L++ +    +DY GI
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGI 327

Query: 168 CILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 227
            ILI  S++++ +   YD   +   + + +++ GI    ++   KF + E RP R   F+
Sbjct: 328 TILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFI 387

Query: 228 CF---GLSSIVP-IFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRFPEK 279
                G SS +  +F   + Y+         L   L   ++  Y+IG   YG   PE+
Sbjct: 388 LLATVGCSSFIRLVFLTNWRYA-------ADLLTPLTNKSVVWYLIGVFFYGSFIPER 438

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 60.8 bits (146), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 136/321 (42%), Gaps = 38/321 (11%)

Query: 11  MSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYV 70
           ++T+ +         ++   +TA   + V    K  K+ + + ++ +WQ           
Sbjct: 4   LTTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQ--------Y 55

Query: 71  KETSSFVDTFKSLFYMHNESVNIYSHLIPA-VGF-LTVLLLDKTTITVFETTTWL-DHMM 127
           K  SS            NESV    +L+ + + F L +   D   I +F TTT + D+++
Sbjct: 56  KNKSS-----------RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 128 IDLFFTGAFACLILSSSFHCFKSHSLKIATLG-NKLDYLGICILIVTSMVSILYYGYYDK 186
            + +    F   ++   +H  K+ SL+       K  YL    L+++S ++ILYY +YD 
Sbjct: 105 FNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 187 FPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLF-----VCFGLSSIVPI--FS 239
              F +F L+    G+      L DK    + R  +   F     +C  L  +  I  F 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFD 223

Query: 240 GLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPG--RFDIWGHSHQLFHF 297
           GL       +  +I++  +       +  +++Y  RFPE    G  + + W HS  LFH 
Sbjct: 224 GL-----ENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHL 278

Query: 298 LVVIASLCHMRGVLNSYELVH 318
           ++  A+  H   ++ SY L+H
Sbjct: 279 IISGAAFYHFFILIQSYILMH 299

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 125/292 (42%), Gaps = 35/292 (11%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFKSLFYM---HNESVNIYSHLIPAVGFLTVLL-- 108
           E+P   R+N +I+HGY +  +S+  +  S+F     HNE+VNI++HL  A+ +L  LL  
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGAL-YLAYLLFR 296

Query: 109 -LDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKS-HSLKIATLGNKLDYLG 166
              +T +   E        M  +F      C + S  +H F     L+  +    +DY G
Sbjct: 297 GFSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCACVDYTG 356

Query: 167 ICILIVTSMVS---ILYYGYYDKFPAFCLFALITVS--FGIACSIVSLKDKFRKREWRPY 221
           I IL+  S+++   +   G  +    + L    T S   G+    ++   KF + E RP 
Sbjct: 357 ITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRPL 416

Query: 222 RAG---LFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGAL--YIIGAVLYGMRF 276
           R     L   FG       FS L+   F    +  +L   +L  +L  Y+IG V YG   
Sbjct: 417 RIAFYLLLASFGF------FSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFYGTFI 470

Query: 277 PEKVYPGRFDIW-----GHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQN 323
           PE+    R D+         H+L   L +I    H+     S  + H K +N
Sbjct: 471 PER---WRSDVQVDPTIPTEHELITNLDIITKQRHVH--FRSQPVTHQKCKN 517

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 101/226 (44%), Gaps = 17/226 (7%)

Query: 104 LTVLLLDKTTITVFETTTWL-DHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLG-NK 161
           L +   D   I +F TTT + D+++ + +    F   ++   +H  K+ SL+       K
Sbjct: 80  LLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQK 139

Query: 162 LDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPY 221
             YL    L+++S ++ILYY +YD    F +F L+    G+      L DK    + R  
Sbjct: 140 FSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFN 198

Query: 222 RAGLF-----VCFGLSSIVPI--FSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGM 274
           +   F     VC  L  +  I  F GL       +  +I++  +       +  +++Y  
Sbjct: 199 KTVFFISVSVVCCSLPLLTAIITFDGL-----ENLKERIKVNAITWELVALVAASIIYVT 253

Query: 275 RFPEKVY--PGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318
           RFPE ++    + + W HS  LFH L+   +  H   ++ SY L+H
Sbjct: 254 RFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMH 299

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 116/283 (40%), Gaps = 36/283 (12%)

Query: 54  EIPEWQRDNDYILHGYVKETSSFVDTFK-------SLFYMHNESVNIYSHLIPAVGFLTV 106
           E+P   R+N  I++GY      F ++ K       + +  HNE+ NI++HL+  +  L +
Sbjct: 218 ELPFPWRENRCIINGY-----RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYL 272

Query: 107 LLLDKTTITVF--ETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSL-KIATLGNKLD 163
           +     +  VF  E       ++  +F   A  CL  S  +H F   SL ++      +D
Sbjct: 273 MFYQFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVD 332

Query: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223
           Y GI ILI  S+++  +   Y    A   +  ++ + GI    ++   KF + E RP R 
Sbjct: 333 YSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRI 392

Query: 224 GLFVCFGLSSIVPIFSGLYYYSFSE-IW-----NQIQLFWVLLGGALYIIGAVLYGMRFP 277
             F+      I+      +  S S   W      +  + W       Y++G V YG   P
Sbjct: 393 KFFILLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVW-------YLVGVVFYGSFIP 445

Query: 278 EKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIK 320
           E+    R DI     Q  H +     L     ++N  + +H +
Sbjct: 446 ER---WRTDI-----QYDHTIPTSHELSTNVDIINKEKHIHFR 480

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 101/245 (41%), Gaps = 34/245 (13%)

Query: 54  EIPEWQRDNDYILHGY------VKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVL 107
           ++P   R+N YI+ GY      VK   S V+ +      HNE++NI+SHL    GFLT+L
Sbjct: 118 QLPFPWRENRYIIKGYRFYDSNVKCLLSVVNYYG----WHNETLNIWSHL---GGFLTLL 170

Query: 108 LL-----DKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFK---SHSLKIATLG 159
            +       T +   E       M++ +F      C++ S  +H F    S++L+     
Sbjct: 171 YIAVFVYPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC 230

Query: 160 NKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWR 219
             +DY GI ILI  S+++  Y           ++  ++++ G     ++   KF   E R
Sbjct: 231 --VDYTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEAR 288

Query: 220 PYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLL-----GGALYIIGAVLYGM 274
           P R   FV       +     ++  S           W+L          Y+IG   YG 
Sbjct: 289 PLRIKFFVTLSAMGCLSFVHLIFTTSLR------HACWLLAPIISKSTIWYVIGVFFYGS 342

Query: 275 RFPEK 279
             PEK
Sbjct: 343 FIPEK 347

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 92/205 (44%), Gaps = 10/205 (4%)

Query: 119 TTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSI 178
           +TT  D++++++F   AF C        CF +      T G+ L  + +      S V++
Sbjct: 124 STTMTDYVLLNVFLATAFQCAACHM-VQCFTT------TAGSVLSTITMLNHWACSAVTL 176

Query: 179 LYYGYYDKFPAFCLFALITVSFGI---ACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIV 235
           LYY YYD    F L AL T ++ +   A ++ S      KR+W   R  L V   +   V
Sbjct: 177 LYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQWWSRRTLLLVYVVVLVSV 236

Query: 236 PIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLF 295
           P+  GL  +  +++  ++    +L   A+Y+I  V YG    + +    F +  H+  L 
Sbjct: 237 PLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGTEKDTLPKLPFYVAFHTASLI 296

Query: 296 HFLVVIASLCHMRGVLNSYELVHIK 320
           H  +++ +   MR   N   LV  K
Sbjct: 297 HLQLLLNAFHLMRAGTNKPTLVSFK 321

>Ecym_4111 Chr4 (222529..232323) [9795 bp, 3264 aa] {ON} similar to
           Ashbya gossypii AER304C
          Length = 3264

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 5/76 (6%)

Query: 53  DEIPEWQRDNDYILHGYVKETSSFVDTFKSLFY-MHNESVNIYSHLIPAVG---FLTVLL 108
           DEI + ++++D I    V+E+S  +D F  +FY M +E+V  ++ L   +G   FL V++
Sbjct: 710 DEIIDNEKNSDEIAFWEVQESSPIIDCFSGVFYSMASENV-TWADLTDKIGFQEFLRVVI 768

Query: 109 LDKTTITVFETTTWLD 124
            +K T     + T L+
Sbjct: 769 PEKPTFDYINSQTLLN 784

>Kwal_27.11066 s27 (625577..626785) [1209 bp, 402 aa] {ON} YER145C
           (FTR1) - Iron permease [contig 31] FULL
          Length = 402

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 10/74 (13%)

Query: 191 CLFALITVSF-------GIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYY 243
           CL A++ VS         +    V++  K RK+ W    AGLF+C    +I   F G YY
Sbjct: 20  CLEAVVIVSVLLSFLKQSVGSQDVAVYKKLRKQVWIGVAAGLFICL---AIGGGFIGAYY 76

Query: 244 YSFSEIWNQIQLFW 257
               +I+   +  W
Sbjct: 77  SLQKDIFGSAEDLW 90

>Skud_5.169 Chr5 complement(262759..264360) [1602 bp, 533 aa] {ON}
           YER056C (REAL)
          Length = 533

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 18/88 (20%)

Query: 168 CILIVTSMVSILYYGY-----YDKF---PAFCLFALITVSFGIACSIVSLKDKFRKREW- 218
           C++I+   V + ++GY     Y+K+   P F +F +I          +S   KF+  EW 
Sbjct: 206 CVIIIGGTVLVTFFGYRVIHTYEKWSWVPNFAVFLVIIAQ-------LSRSGKFKGGEWI 258

Query: 219 -RPYRAGLFVCFGLSSIVPIFSGLYYYS 245
             P  AG  + FG SSI    +G   Y+
Sbjct: 259 GGPTTAGSVLSFG-SSIYGFAAGWTTYA 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,154,497
Number of extensions: 1446999
Number of successful extensions: 5454
Number of sequences better than 10.0: 87
Number of HSP's gapped: 5502
Number of HSP's successfully gapped: 87
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)