Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1726.28ON39839820700.0
Smik_15.1676.28ON37837816070.0
Skud_15.1596.28ON37937916020.0
YOL003C (PFA4)6.28ON37837815490.0
TDEL0G044106.28ON38137811811e-161
Kpol_1037.236.28ON37837911801e-161
ZYRO0C07546g6.28ON37737811651e-159
TPHA0J003906.28ON38038111541e-157
SAKL0E01518g6.28ON37938011541e-157
NDAI0C026506.28ON38938911281e-153
CAGL0E02497g6.28ON37637811261e-153
NCAS0D021406.28ON37637911171e-151
Ecym_30326.28ON37737810841e-146
KLTH0C10978g6.28ON37737910301e-138
KLLA0C06204g6.28ON37737810281e-138
Kwal_56.224596.28ON3833819931e-132
ACL003C6.28ON3753809851e-131
KAFR0A051306.28ON3963979811e-130
KNAG0F029306.28ON3863859441e-125
TBLA0B004806.28ON3774114546e-52
TPHA0P015603.12ON331981983e-16
KAFR0A085903.12ON331501957e-16
KNAG0K025703.12ON328851957e-16
SAKL0C13596g3.12ON333591957e-16
TDEL0A003103.12ON329511958e-16
Kpol_1014.293.12ON326501912e-15
NDAI0G013403.12ON335621913e-15
Kwal_55.221263.12ON360601904e-15
CAGL0D02508g3.12ON332621894e-15
NCAS0C029208.389ON374711905e-15
NCAS0E013003.12ON327531885e-15
TBLA0H001503.12ON345661887e-15
KLLA0D18370g8.389ON355891888e-15
Ecym_20143.12ON339811833e-14
KLLA0E02069g3.12ON325491824e-14
SAKL0H16434g8.286ON555921844e-14
KLTH0F19580g3.12ON342621815e-14
KNAG0A027108.389ON354721772e-13
Smik_14.63.12ON334611753e-13
Suva_14.153.12ON330611753e-13
Skud_14.153.12ON336611744e-13
NCAS0B035908.286ON329481734e-13
ZYRO0C03410g3.12ON327591735e-13
ADL197C3.12ON390761745e-13
ZYRO0D06600g8.286ON330591727e-13
Skud_12.3218.389ON356601728e-13
TPHA0C023608.389ON404601738e-13
YNL326C (PFA3)3.12ON336611719e-13
Ecym_41788.389ON368711702e-12
KLTH0G13112g8.286ON3491751692e-12
Kpol_1033.168.286ON3211581692e-12
KAFR0B053708.286ON329661682e-12
Smik_12.3068.389ON359601674e-12
AGL125C8.389ON367891664e-12
YLR246W (ERF2)8.389ON359601664e-12
NDAI0G022508.389ON389711665e-12
SAKL0H13860g8.389ON352811656e-12
TPHA0C010708.286ON3332711656e-12
CAGL0B01991g8.286ON330481648e-12
Suva_10.3428.389ON356601648e-12
Suva_2.2898.286ON335681639e-12
TDEL0F051308.389ON359811631e-11
Skud_4.3878.286ON336591621e-11
NDAI0J010008.286ON339821621e-11
ZYRO0C04092g8.389ON366791621e-11
TBLA0D040408.286ON329491621e-11
Kwal_23.33028.389ON353641612e-11
KAFR0H019808.389ON361751603e-11
KLTH0F08668g8.389ON358621594e-11
TDEL0F041308.286ON3282001575e-11
TBLA0E028305.579ON3861051585e-11
TBLA0H009208.389ON360791576e-11
CAGL0G08217g8.389ON326571567e-11
YDR126W (SWF1)8.286ON336591568e-11
Smik_4.3728.286ON335671541e-10
KAFR0I011105.579ON370731542e-10
NDAI0H018905.579ON406661532e-10
NCAS0F013905.579ON374661523e-10
Kwal_47.183665.579ON356701513e-10
Ecym_41145.579ON372841514e-10
KLLA0F19690g8.286ON324661487e-10
KLTH0G04972g5.579ON367811497e-10
Skud_4.7345.579ON380631471e-09
Ecym_42828.286ON340491462e-09
KNAG0C028305.579ON354741452e-09
Smik_4.7375.579ON378621452e-09
YDR459C (PFA5)5.579ON374621443e-09
CAGL0K06347g5.579ON352611416e-09
AGR065W8.286ON326441416e-09
SAKL0G06160g5.579ON364921417e-09
TDEL0A044405.579ON365841382e-08
ZYRO0D13860g5.579ON3651661382e-08
Kpol_1004.575.579ON3621101382e-08
Suva_2.6345.579ON388631363e-08
KNAG0H031108.286ON331931353e-08
Kwal_56.236978.286ON338691336e-08
KLLA0D06149g5.579ON3491001255e-07
ABR203W5.579ON359821222e-06
TPHA0C003705.626ON759901171e-05
NDAI0H008505.626ON786551142e-05
KAFR0H005705.626ON757711133e-05
Skud_4.5275.626ON764661115e-05
Suva_2.4325.626ON763501106e-05
Smik_4.5155.626ON764501081e-04
NCAS0C052805.626ON757661062e-04
YDR264C (AKR1)5.626ON764501062e-04
Suva_8.875.626ON730781062e-04
Kpol_526.325.626ON777541062e-04
ZYRO0C11132g5.626ON759531053e-04
YOR034C (AKR2)5.626ON749781034e-04
KNAG0C062305.626ON7521031034e-04
Smik_15.2135.626ON744951034e-04
KLTH0E02420g5.626ON734661018e-04
CAGL0M08712g5.626ON76351990.001
TBLA0J008305.626ON739100980.002
Ecym_13305.626ON73963960.003
TDEL0A049205.626ON75050960.003
AER388C5.626ON72439890.020
SAKL0G07326g5.626ON73761890.025
NCAS0A017304.97ON78498870.034
Skud_15.1995.626ON74153860.053
KNAG0B031405.626ON68259850.069
Smik_5.256.17ON61570770.66
KLLA0E16721g5.626ON75240722.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.172
         (398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   801   0.0  
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   623   0.0  
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   621   0.0  
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   601   0.0  
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   459   e-161
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   459   e-161
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   453   e-159
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   449   e-157
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   449   e-157
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     439   e-153
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   438   e-153
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   434   e-151
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   422   e-146
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   401   e-138
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   400   e-138
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   387   e-132
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   384   e-131
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   382   e-130
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   368   e-125
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   179   6e-52
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    81   3e-16
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    80   7e-16
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    80   7e-16
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    80   7e-16
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    80   8e-16
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    78   2e-15
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      78   3e-15
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    78   4e-15
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    77   4e-15
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     78   5e-15
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    77   5e-15
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    77   7e-15
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    77   8e-15
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    75   3e-14
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    75   4e-14
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    75   4e-14
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    74   5e-14
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    73   2e-13
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    72   3e-13
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    72   3e-13
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    72   4e-13
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      71   4e-13
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    71   5e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    72   5e-13
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    71   7e-13
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    71   8e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    71   8e-13
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    70   9e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    70   2e-12
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    70   2e-12
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    70   2e-12
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    69   2e-12
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    69   4e-12
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    69   4e-12
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    69   4e-12
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     69   5e-12
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    68   6e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    68   6e-12
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    68   8e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    68   8e-12
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    67   9e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    67   1e-11
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    67   1e-11
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    67   1e-11
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    67   1e-11
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    67   1e-11
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    67   2e-11
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    66   3e-11
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    66   4e-11
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    65   5e-11
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    65   5e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    65   6e-11
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    65   7e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    65   8e-11
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    64   1e-10
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    64   2e-10
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    64   2e-10
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    63   3e-10
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    63   3e-10
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    63   4e-10
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    62   7e-10
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    62   7e-10
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    61   1e-09
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    61   2e-09
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    60   2e-09
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    60   2e-09
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    60   3e-09
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    59   6e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    59   6e-09
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    59   7e-09
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    58   2e-08
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    58   2e-08
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    58   2e-08
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    57   3e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    57   3e-08
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    56   6e-08
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    53   5e-07
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    52   2e-06
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    50   1e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    49   2e-05
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    48   3e-05
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    47   5e-05
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    47   6e-05
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    46   1e-04
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    45   2e-04
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    45   2e-04
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    45   2e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   2e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    45   3e-04
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    44   4e-04
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    44   4e-04
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    44   4e-04
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    44   8e-04
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    43   0.001
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    42   0.002
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    42   0.003
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    42   0.003
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    39   0.020
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    39   0.025
NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97      38   0.034
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    38   0.053
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    37   0.069
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...    34   0.66 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    32   2.7  

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/398 (96%), Positives = 384/398 (96%)

Query: 1   MIVCWVYHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQ 60
           MIVCWVYHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQ
Sbjct: 1   MIVCWVYHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQ 60

Query: 61  IAFESSLSMIWVSYYLAIYTNPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQC 120
           IAFESSLSMIWVSYYLAIYTNPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQC
Sbjct: 61  IAFESSLSMIWVSYYLAIYTNPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQC 120

Query: 121 VLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFK 180
           VLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFK
Sbjct: 121 VLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFK 180

Query: 181 KSELVFLTILTPXXXXXXXXXXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKK 240
           KSELVFLTILTP              RCLFNQIINGRSQIESWDMDRLESLFDSQRLIKK
Sbjct: 181 KSELVFLTILTPLNFFVLLTIVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKK 240

Query: 241 LIENTWRIYPEARSPQLERDAEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLW 300
           LIENTWRIYPEARSPQLERDAEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLW
Sbjct: 241 LIENTWRIYPEARSPQLERDAEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLW 300

Query: 301 PCGAPAGDGNSFQKNDISKYEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGG 360
           PCGAPAGDGNSFQKNDISKYEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGG
Sbjct: 301 PCGAPAGDGNSFQKNDISKYEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGG 360

Query: 361 EQVVRSRIAQHGRSATREKWYNDWGESLDDFGVDVDME 398
           EQVVRSRIAQHGRSATREKWYNDWGESLDDFGVDVDME
Sbjct: 361 EQVVRSRIAQHGRSATREKWYNDWGESLDDFGVDVDME 398

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 320/378 (84%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           MAVKL+WPWLGIAIPT LISFIGYGAHYFILSNFL ++KQI FE SLSMIW SYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG+P P YQP P  WPN+CKKCQNYKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHFLRF+FW+I TT  LFCIQ+KR+ FIWQ+R+ PGYLFKKSEL FLTIL+P        
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCLFNQI+NGRSQIESWDMDRLESLFDS+RLI+KLI NTWRIYPE+++ Q ERD
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           AE LL Q +  FE +VNFPYN DL TNA +YLGP+HLWLWP G P G+GN+F KNDIS Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380
           EV+S LEDI+LSLPWPPDGG+  T SN     IETCNEGGEQVVRSR+AQ+GRSA+REKW
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 381 YNDWGESLDDFGVDVDME 398
           +NDWGESLDDFGVDVDME
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/379 (77%), Positives = 324/379 (85%), Gaps = 1/379 (0%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLS+SKQ+ FE SLSMIWVSYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           N G+P P Y+P+P  WPN+CKKCQ+YKPERSHHCKACNQCVLMMDHHCPWTMNCVGF+NY
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHFLRF+FWVI TT  LFC+Q+KR+ FIWQQR LPGYLF+KSEL+FLTIL+P        
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCL NQIINGRSQIESWDMDRLESL DS +LI KLI+NTWRIYPEARS Q ERD
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 261 AEKLLTQH-KIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISK 319
           A+KLLTQ  + RF+E+V+FPYN +  TNA +YLGP+ LWLWP G PAGDGNSF KNDIS+
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 320 YEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379
           YEVNS LEDI+LSLPWPPDG K K  SNH+N  IET NEGGEQ+VRSR AQHG  A REK
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 380 WYNDWGESLDDFGVDVDME 398
           WYNDWGESLDDFGVDVDME
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/378 (73%), Positives = 316/378 (83%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VKL+WPWLGIAIPTFLISFIGYGAHYFILSNFLSV KQI FE  LSMIW+SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG+P P Y+P P+ W N+CKKCQ+YKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHFLRF+FW+I TT  LFCIQ KR+ FIWQQRHLPGY FKKSEL+FLTI +P        
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCLFNQI+NGRSQIESWDMDRLESLF+S RL +KLI+NTWRIYPE+RS Q ++D
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           AE+ LT+ + RF+E+VNFPY+ DL+TNA +YLGP+HLWLWP G P GDGN+F KN ISKY
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380
           E NSSLED +LSLPWPPDGGK  T  NH +  IE  NE GEQ++R+R+ Q+GR A+REKW
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 381 YNDWGESLDDFGVDVDME 398
           YNDWGESLDDFGVDVDME
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 214/378 (56%), Positives = 268/378 (70%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VKLKWPWLGIAIP  L+SFIGY  H+FILSNFLS SKQ+ F+ +L++IW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG+P P ++     W NYCKKCQNYKPER+HHCK CNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHFLRF+ WVI  T FL    + R+  +W+ R+LP Y+F +SELVFLTILTP        
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCL NQI NG SQIE+W+++RL++LFDS+RL+  LIE  W I+P  R    E  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           A +L    ++R E+VVNFPY++D ++NA   LG   LWLWP G P GDG SF KN+IS+Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380
              +S ED++LSLPWPPDGG+ +      + +IE+  + GEQ++R R         R +W
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360

Query: 381 YNDWGESLDDFGVDVDME 398
            NDWGE+L+DFGVDVD E
Sbjct: 361 QNDWGENLEDFGVDVDTE 378

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/379 (57%), Positives = 272/379 (71%), Gaps = 2/379 (0%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VKLK+PW+GIAIP FLISFI Y AHYFIL NFLS+ KQI FE S++MIW+SYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPGKP   Y P  N W NYCKKC  YKPER+HHCK C QCVLMMDHHCPWTMNCVG+KN+
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHFLRF+FWVI TT +L    + R+ F+W+ R+LP YLF KSE++FLTI TP        
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RC  NQ+++GR+QIE+W+ +RLESLF  +RL  +LI N W  +PE ++P  E  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           AEK++++ +IRF+ +V+FPY++ L  N T  LG    WLW  G P+GDG  F+KN+ S +
Sbjct: 241 AEKIVSK-RIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 321 EVNSSLEDIMLSLPWPPDGGKIK-TASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379
           E +S LED +LSLPWPPDGGK      N S  +IET  + GE V+R R        +R +
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 380 WYNDWGESLDDFGVDVDME 398
           WYNDWGE+L+DFGVD+D+E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  453 bits (1165), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 217/378 (57%), Positives = 271/378 (71%), Gaps = 1/378 (0%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M V+LKWP+LGIAIP FLISFIGY AHYFILSNFLS  KQI FE SL+MIW SYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
            PG+P P +QP+ N+W +YCKKC+NYKPER+HHCK CNQCVL MDHHCPWT NCVG+ N+
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHF+RF+FWVIATTG+L      R  FI    + P YL+ KSEL+FLTIL P        
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCL NQI  GR+QIE+W+ +RLE L+ S+RL+  L+ N W +YPE R+ +LE +
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           A +L T+ +I  + +VNFPY+ID ++N   +LG    WLWP G P GDG  F KNDIS++
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380
           E  ++L D++L+LPWPPDGGK K  S     A+ET    GEQV+R R+      ++R +W
Sbjct: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 381 YNDWGESLDDFGVDVDME 398
            N WGE+L+DFGVDVD E
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  449 bits (1154), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 206/381 (54%), Positives = 276/381 (72%), Gaps = 5/381 (1%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VK KWPW+GIAIP  LISFIGY +HY+IL   LS+ KQ  FE SL+MIWVSYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPGKP   ++P P+ W N+CKKC NYKPERSHHCK CNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHF+RF+ W++ATTGFL   Q+KR+ ++W  R+LP YLF++SE++ L + TP        
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCLFNQIING++QIE W+MDRLE+ F  ++L+ +LI N W +YPE +S + + +
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           AE+L+ +  IR++ +VNFPY++ +F N T  +G    WLWP G P+G+G +F+KN+I+ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 321 EVNSSLEDIMLSLPWPPDGGK---IKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATR 377
           + +SSL    L+LPWPPD G+    KT +  SN  +E     GEQVVR+R        +R
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSN--VEFITTDGEQVVRNRTHAKNPILSR 358

Query: 378 EKWYNDWGESLDDFGVDVDME 398
           E+W+N+WGE+L+DFGVDV+ME
Sbjct: 359 EEWFNEWGENLEDFGVDVEME 379

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  449 bits (1154), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/380 (55%), Positives = 271/380 (71%), Gaps = 3/380 (0%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           MAVKLKWPWLGIAIP FLISFIGY AHYFILSNFL   KQ+ FE SL MIW+SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPGKP+P ++P+   W N+C KC NYKPER+HHCKACNQCVL MDHHCPWTMNCVG +N+
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
            HF+RF+FWVI TT FL    +KR+ F+W +RH+P Y   +SEL+FLTILTP        
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RC  NQI+ G +QIESW+MDR+E++F S +LI +++EN   I P + S Q + D
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ-DDD 239

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
             KLL+Q+++  +E+VNFPY+++ + NA   LG ++ W+ P G   G+G  F+KN++S Y
Sbjct: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLA--IETCNEGGEQVVRSRIAQHGRSATRE 378
           E    +ED +LSLPWPPDGG+ K     +N    +E+    GE+VVR R      +  R+
Sbjct: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359

Query: 379 KWYNDWGESLDDFGVDVDME 398
           KWYNDWGE+L DFGVD+D E
Sbjct: 360 KWYNDWGENLADFGVDLDEE 379

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  439 bits (1128), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/389 (53%), Positives = 274/389 (70%), Gaps = 13/389 (3%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           MA+KLK+PWLG+AIP+F+ISFIGY +HYFILSNFLS+ KQI F+ SLSMIWVSY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 81  NPGKPSPTYQP----NPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 136
           NPGKP    +P    +   W  +CKKC NYKPERSHHCK CNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 137 FKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXX 196
           +KN+PHF+RF+ W+I TTGFL    LKR   +W  RHLP Y+F ++E++FLTIL P    
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 197 XXXXXXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQ 256
                     RC  NQI+ G +QIE W+++RLE+LF +++L+  +I   W +YP  R+  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 257 LERDAEKLLTQH-KIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKN 315
            +  A+ LL++  K+RFE +VNFPY+ID++TN    +G    W+W  G P  +G  F+KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 316 DISKYEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSR------IA 369
           +IS YE  SS+ED++LSLPWPPD G  +   ++ + ++E+    GEQVVR+R      I+
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKG--RNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358

Query: 370 QHGRSATREKWYNDWGESLDDFGVDVDME 398
              +  +RE+W NDWGESL DFGVD++ E
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  438 bits (1126), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 211/378 (55%), Positives = 261/378 (69%), Gaps = 2/378 (0%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VKLKWPWLGIAIP+FLI+ IGY AHYFIL NFLS+ KQ+ ++   +MIW+SYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
            PGKP   ++P+ N W  YCKKC+ YKPERSHHCK CNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHF+RF+FWVI  T  L      R+  IW  R  P YL+ KSEL+FLTILTP        
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCLFNQI NGRSQIESW+MDRLE+L    +L+  LIEN W I+P  R+  +E  
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           AE LL + ++  +E+VNFPY++  F NA   LG   LWL+P   P  DG  FQKN+ S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380
           E  +SL DI+L LPWPPD  K   +++     ++  +E GEQV+R R  +  +  +R +W
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358

Query: 381 YNDWGESLDDFGVDVDME 398
            NDWGESL+DFGVDVD+E
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  434 bits (1117), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 274/379 (72%), Gaps = 4/379 (1%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VKLK+PW+G+ IP  L SFIGY AH F+L+NF+S   Q+ F+SSL+M+W+SY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG+P+ +++P    W ++CKKCQ +KPER+HHCK CNQCVLMMDHHCPWTMNCVGFKN+
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHFLRF+FWV+ TTGFL    LKR  ++W  + LP YLF+K+E+ FL IL P        
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RCL NQII G++QIESW+++RLE+L+  ++L+ +L+ N W IYP  ++P+ +  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 261 AEKLLTQ-HKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISK 319
           A+KL  +  K+RFE +V FPY++D+++NA   LG    WLW  G P  DG  F+KN+++ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 320 YEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379
           YE  +++ED++LSLPWPPDGG+       +N  +E+  E GEQV+R R  ++  S  R+ 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGTN--VESITENGEQVIRQRNFENDNSY-RKT 357

Query: 380 WYNDWGESLDDFGVDVDME 398
           W NDWGE+L+DFGVDVD+E
Sbjct: 358 WNNDWGENLEDFGVDVDVE 376

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  422 bits (1084), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 197/378 (52%), Positives = 262/378 (69%), Gaps = 2/378 (0%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VKLKWPWLGIAIP FLI+FIGY A  F+L  FLSV +QI F+ SL+MIW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG P P +QP  + W NYCKKCQN+KPER+HHCK C QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHF+RF+FW+I TT +L     KR  F+W  RH    L  K E++FLTILTP        
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RC+ NQ++NG +QIE+W+MDR+ES+F ++RL+ +L+ N   +YP +     + +
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGH-KGE 239

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
            +++L   KI FE++VNFPY+ D + N    +GP+  WL P G P G+G  F+KN++S Y
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380
           E  S+L D +LSLPWPPDG +   +SN S L +E+    GE ++R R  +   + +R +W
Sbjct: 300 EHGSTLTDKLLSLPWPPDGERAPNSSN-SRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358

Query: 381 YNDWGESLDDFGVDVDME 398
           YNDWGE+L  FGVDVD +
Sbjct: 359 YNDWGENLAHFGVDVDAD 376

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  401 bits (1030), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 255/379 (67%), Gaps = 4/379 (1%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M V+LKWPWLGIA+P+FLI++IGY +HYFIL NF S  +Q+ FE SL++IWVSY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG+P P ++P  + W NYCKKC NYKPER+HHCK C QCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHF+RF+ WV+ TT +L  +  +R    W  R+   ++   SEL FL +  P        
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RC+ NQ +NG +QIESW+ DR+E+LF ++RL+ +LI+N   ++PE      E  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFD--EGA 237

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
           A+KLL+  ++  E+++NFPY++D+  N    +GP++ W  PCG P  +G  F  ND+S Y
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTA-SNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379
           ++ +S+ED +LSLPWPPDGG+ K+  S      +ET + GGE  +R+R      S  R +
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 380 WYNDWGESLDDFGVDVDME 398
           W+NDWGE+L DFGVDVD E
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 185/378 (48%), Positives = 254/378 (67%), Gaps = 1/378 (0%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           MA+KLK  WLG+AIP FL++ IGYG+HYFILSNFLS ++QI +++  +MIWVSYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG P   ++P+   W NYCKKC+ YKPER+HHCK CNQCVL MDHHCPWT+NCVG  N+
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHF+RF+FWVI +T +L  + + R+  +W  RH   +    SE++F+ I+TP        
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RC++NQ ++G +QIESW+MDR++SL    RL+ ++I+      PE   P  + +
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEIL-PAKQHE 239

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
             KLL++  +  E+  NFPY+++ +TN    +GP +LWLWP   P   G SF KN++  Y
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380
           + NSS+ED+++SLPWPPDG    + +  S  +IET   GGEQV+R +         R  W
Sbjct: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359

Query: 381 YNDWGESLDDFGVDVDME 398
           YNDWGE L DFGVD ++E
Sbjct: 360 YNDWGEDLSDFGVDTELE 377

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  387 bits (993), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 257/381 (67%), Gaps = 8/381 (2%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M VKLKWPWLGIAIP+ LI+FIGYG+HYFIL NFLS+ +Q+ F+  LSMIW+SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPGKP   +QP P+ W N C+KC+ YKPER+HHCK C+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
           PHF+RF+ WVI TT +L  +  KR+   WQ RH   Y+ +K ELVF+ I TP        
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPE--ARSPQLE 258
                 RC  NQ + G +QIE W+ +R+E+ F++ RLI +L+EN   IY +    SP   
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSP--- 236

Query: 259 RDAEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDIS 318
            +A+KL+    ++ EE+VNFPY++++  N    +G L   + P  +P G+G  F KND+S
Sbjct: 237 -NAKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLS 295

Query: 319 KYEVNSSLEDIMLSLPWPPDGGKIK-TASNHSNLAIETCNEGGEQVVRSRIAQHGRSATR 377
            Y+   ++ED +LSLPWPPDGG+ + T  +  +  IE  +  GE V+R R+     +  R
Sbjct: 296 SYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQR 355

Query: 378 EKWYNDWGESLDDFGVDVDME 398
            +WYNDWGE+L DFGVDV+ E
Sbjct: 356 TEWYNDWGENLSDFGVDVESE 376

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  384 bits (985), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 192/380 (50%), Positives = 251/380 (66%), Gaps = 7/380 (1%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           MAV +KWPWLG+AIP FLISF GY AH+F+L+NFLS  + + F+ SLSMIW+SY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140
           NPG+P+  ++P    W NYC KC+ YKPER+HHCK CNQCVL+MDHHCPWTMNC+G +  
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXX 200
                   W+IATTG L    +KR+ F W  R+    L  K EL+FLTILTP        
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 201 XXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260
                 RC+ NQI+NGR+QIE+W+MDR+E+LF  QRL+ +L+ N   IYP +   Q E++
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239

Query: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320
            E+ L+     F+EV+NFPY+I+ + N    +G    WL P G P  DG  FQKN+IS Y
Sbjct: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299

Query: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSAT--RE 378
           +  +S++D +L+LPWPPD  +   A   S   +E   +GGEQVVR R   H   A   R 
Sbjct: 300 DEATSIQDKLLALPWPPDDTRHGIAFP-SVSHVEKDTQGGEQVVRRR---HVPIAVPPRN 355

Query: 379 KWYNDWGESLDDFGVDVDME 398
           +WYNDWGESL+ FGVDV++E
Sbjct: 356 EWYNDWGESLEHFGVDVEVE 375

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  382 bits (981), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 197/397 (49%), Positives = 249/397 (62%), Gaps = 20/397 (5%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           MA++LKWPWLGIAIPTFLISFIGY AHYFIL + LS   Q+ F+ SLSMIW+SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 81  NPGKPS-PTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKN 139
           +PG PS      +  T   YCKKC  YKP R+HHCK CN+C+LMMDHHCPWTMNCVGFKN
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 140 YPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXX 199
           YPHFLRF+FWVI TT FL     +R+ FIW   +    L ++ E+V LTILTP       
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 200 XXXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQR-----LIKKLIENTWRIYPEARS 254
                  RC  NQI +G SQIE W+M+RLES F S++      +  LI N + I+     
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 255 PQLERDAEKLLTQH---KIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNS 311
              + +   LL QH   ++ F  ++NFPY+ID+ TNAT  LGP   WL P GAP GDG  
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 312 FQKNDISKYEVNSSLEDIMLSLPWPPD--GGKIKTASNHSNLAIETCNEGGEQVVRSRIA 369
           F+ N+I+  E  S+L D++LSLPWPPD    K   + +     +ET  EGGE V+R+R  
Sbjct: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359

Query: 370 Q--------HGRSATREKWYNDWGESLDDFGVDVDME 398
                    +    +R+ W N+WGE+L  FGVD++ E
Sbjct: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  368 bits (944), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 190/385 (49%), Positives = 244/385 (63%), Gaps = 14/385 (3%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M V+LK PW GIAIP  LI FIGY AH+FIL N LS  +QI F+  L+MIW+SYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 81  NPGKP--SPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFK 138
           NPGKP      Q        YC KC  +KPERSHHCK C QCVLMMDHHCPWTMNC+GF 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 139 NYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLP--GYLFKKS--ELVFLTILTPXX 194
           N+P F+RF+ WVI TT  LF   L R++ IWQ R++P  G +   +  ELV L +LTP  
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 195 XXXXXXXXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARS 254
                       RC+ NQ+I G +QIESW+M+RL+++F S++L+  +IE  W  +P  ++
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 255 PQLERDAEKLL---TQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNS 311
           P+ E +AEKLL    Q  ++F  VVNFPY++DL TN    LG   L LWP     G+G +
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 312 FQKNDISKYEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLA--IETCNEGGEQVVRSRIA 369
           FQKNDIS YE N S+ D++L L WPPDGG+        + A  I+   E GE ++R R  
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358

Query: 370 QHGRSATREKWYNDWGESLDDFGVD 394
            +    +R  W N WGE+L+ FGVD
Sbjct: 359 -NSPIESRTTWENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  179 bits (454), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 132/411 (32%), Positives = 205/411 (49%), Gaps = 70/411 (17%)

Query: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80
           M ++   PW G+AIP+ +I  +   +++ IL + L+ ++ I + ++  MI  SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPE----------------RSHHCKACNQCVLMM 124
            P  P+P+         ++     N + +                R+HHCK CN CV+MM
Sbjct: 61  -PPTPAPSTLTQ-----SFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMM 114

Query: 125 DHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFK--KS 182
           DHHCPWTMNCVG+ NYPHF+RF+ WVI +T  L    +K+   ++  R+ P +L++  K 
Sbjct: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174

Query: 183 ELVFLTILTPXXXXXXXXXXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRLIK--- 239
           +++ LT+L P              + L NQI NG +QIE W  + +E+ +   +  K   
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAL 234

Query: 240 --KLIENTWRIYPEARSPQLERDAEKLLT--QHKIR----FEEVVNFPYNIDLFTNATIY 291
             +L+EN    Y +  S       +KL++  Q+  R    F  ++NFPY++ L  N T  
Sbjct: 235 QLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294

Query: 292 LGPL------HLWLWPCGAPAGDGNSFQKNDISKYEVNSSLEDIMLSLPWPPDGGKIKTA 345
           +G L      + W  P  A     N F   D +  E + +++D++L LPWP         
Sbjct: 295 MGSLNPLSWFNPWYTPLTASYNKINEFAIWDDN--ETHDNIKDMLLCLPWP--------- 343

Query: 346 SNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKWYNDWGESLDDFGVDVD 396
            N+SN    +  + GE VV+S               ND+GE+L DFGVD D
Sbjct: 344 LNYSN---NSTFQDGELVVKS---------------NDYGETLQDFGVDYD 376

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 53/98 (54%), Gaps = 1/98 (1%)

Query: 94  NTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIAT 153
           N  P  C+ C  +KP+RSHHC  CN+CVL MDHHCPW   C+GFKN   F++F+ +   T
Sbjct: 104 NGRPRVCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYN-TT 162

Query: 154 TGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILT 191
             ++  I   +  + W         F    L+FL IL 
Sbjct: 163 YAYVIAILTSKQMYNWFDDGSYENEFVNMYLLFLWILA 200

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFW 149
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+GFKN  +F++F+F+
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFY 155

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 5/85 (5%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF- 158
           C+ C+ +KP+R HHC +C++C+L MDHHCPW   CVGF+N   F++F+ +  A   F+  
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 159 --CIQLKRVSF--IWQQRHLPGYLF 179
              +QL R  +   +Q+  + GYL 
Sbjct: 163 MTSVQLYRWFYNDKFQEELISGYLL 187

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           C+ C+ +KP+RSHHC +CN+C L MDHHCPW  +C+GFKN   F++F+ +      F+F
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVF 163

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 39/51 (76%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWV 150
           C+ C  +KP+R HHC ACN+C+L MDHHCPW  +CVGF+N  +F++F+ + 
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYA 158

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFW 149
           C+ C  +KP+R HHC AC++C+L MDHHCPW   CVGFKN  +F++F+ +
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIY 155

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 40/62 (64%)

Query: 88  TYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           +Y    N     C+ CQ +KP+R HHC  CN+C+L MDHHCPW   C+GFKN   F++F+
Sbjct: 97  SYTMKRNGRYRLCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFL 156

Query: 148 FW 149
            +
Sbjct: 157 IY 158

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           +C+ C  +KP+R HHC  CN+C L MDHHCPW  +CVG++N  +F+ F+ +  A +  +F
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVF 191

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 88  TYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           +Y    N     CK C ++KP+R HHC  CN CVL MDHHCPW   CVG++N   F++F+
Sbjct: 94  SYTQKRNGRFRVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFL 153

Query: 148 FW 149
            +
Sbjct: 154 IY 155

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 43/71 (60%)

Query: 87  PTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRF 146
           PT+  + N    YCK C+ ++P RS HC  C  CVLM DHHC W  NCVG +NY +FL F
Sbjct: 171 PTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTF 230

Query: 147 IFWVIATTGFL 157
           +     T+ FL
Sbjct: 231 LTSSTLTSIFL 241

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (73%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIA 152
           C+ CQ +KP+R HHC  C++C+L MDHHCPW   C+GF+N  +F++F+ +  A
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCTA 153

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C+ C  +KP+R HHC +C++C+L MDHHCPW   C+GFKN+ +F+ F+ +      F+  
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVCL 165

Query: 160 IQLKRV 165
           I  K +
Sbjct: 166 ISSKEL 171

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 49/89 (55%)

Query: 87  PTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRF 146
           PT  PN +    YC+ C+ ++P RS HC  C+ CVL  DHHC W  NC+G +NY  FL F
Sbjct: 161 PTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEF 220

Query: 147 IFWVIATTGFLFCIQLKRVSFIWQQRHLP 175
           +     +   L  +   R+S+  Q R+ P
Sbjct: 221 LMASTISCILLILLSSFRLSYSPQVRYTP 249

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFW-VIATTGFL 157
           YC  C  +KP+RSHHC +CN+C L  DHHCPW  +C+GF N   F++F+ +  + +    
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 158 FCIQLKRVSFIWQQRHLPGYL 178
               L+ VS+   Q +   Y+
Sbjct: 169 IAATLQIVSWFRNQNYTTQYI 189

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (75%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           +C+ C+ +KP+R HHC  CN+C L MDHHCPW  +CVGF+N   F++F+
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFL 152

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 51/92 (55%), Gaps = 6/92 (6%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G  NY +F  F+   +    + F 
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF- 190

Query: 160 IQLKRVSFIWQQRHLPGYLFKKSELVFLTILT 191
           ++L  +  + Q  ++     K   ++ LTILT
Sbjct: 191 LRLTSIQLMSQTENI-----KTKPMLVLTILT 217

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 41/62 (66%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           +C+ C  +KP+R HHC AC +C L MDHHCPW  +CVG+ N  +F++F+ +    +  +F
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIF 164

Query: 159 CI 160
            +
Sbjct: 165 LL 166

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%)

Query: 87  PTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRF 146
           PT Q + +    YC  C+ ++P R+ HC+ C  CV   DHHC W  NCVG +NY +FL F
Sbjct: 173 PTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTF 232

Query: 147 IFWVIATTGFLF 158
           +    AT   LF
Sbjct: 233 LTATCATCTVLF 244

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C+ C  +KP+R HHC +C+ CVL MDHHCPW   C GFKN   F++F+ +   TT + F 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAFL 162

Query: 160 I 160
           +
Sbjct: 163 V 163

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GFKN   F++F+ +   TT + F 
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY---TTFYAFL 162

Query: 160 I 160
           +
Sbjct: 163 V 163

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GFKN   F++F+ +   TT + F 
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY---TTFYAFL 162

Query: 160 I 160
           +
Sbjct: 163 V 163

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (70%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           C+ CQ+YKP RS HC  C++CVL+ DHHC W  NCVG  NY +F  F+
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL 184

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           C+ C  +KP+R HHC  C++C+L MDHHCPW   C+GF N   F++++ +    +  +F
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIF 165

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
            YC KC+ +KP+R HHC AC++C L  DHHC W   C+G+ N+  FL F+ +  +   F 
Sbjct: 169 RYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYA-SVYAFW 227

Query: 158 FCIQLKRVSFIWQQRH 173
            CI       +W + H
Sbjct: 228 ICIITTWDLVVWFRAH 243

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 36/59 (61%), Gaps = 5/59 (8%)

Query: 89  YQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           + PN N     C+ CQ  KP RS HC  CNQCVL +DHHC W  NCVG  NY +F  F+
Sbjct: 129 FYPNIN-----CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 39/60 (65%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           YC+ C+ ++P R+ HC  CN CV++ DHHC W  NCVG +NY  FL F+   I ++ FL 
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           YC+ C+ ++P RS HC  C+ CV+ +DHHC W  NCVG +NY +FL F+   I T  FL 
Sbjct: 195 YCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFLL 254

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF+N   F++F+ +   TT + F 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY---TTLYAFL 162

Query: 160 I 160
           +
Sbjct: 163 V 163

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 40/71 (56%)

Query: 87  PTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRF 146
           P+   N      YC  C+ ++P R+ HC  CN C++  DHHC W  NCVG +NY +FL F
Sbjct: 176 PSSSTNSPIQLKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTF 235

Query: 147 IFWVIATTGFL 157
           I+  + T   L
Sbjct: 236 IYSAVLTIILL 246

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 78/175 (44%), Gaps = 25/175 (14%)

Query: 7   YHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYF-------ILSNFLSVSK 59
           Y+TR +  +  D+      ++ W   AIP F +S   Y    F       I S    V +
Sbjct: 33  YYTRVFHPIFEDVN-----RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVER 87

Query: 60  QIAFESSLSMIWVSYYLAIYTNPGKPSPTY-QPNPNTWPNY-------CKKCQNYKPERS 111
            +    +LS   ++  L I+    KP  TY  P  + +          C+ C+  K  R+
Sbjct: 88  LLIIPVALSAPIITGLLTIWI---KPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFART 144

Query: 112 HHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATT--GFLFCIQLKR 164
            HC  C+QCV + DHHC W  NC+G  NY +F  F+   +  T  GFL  + L+R
Sbjct: 145 KHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFLRLLFLQR 199

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 74/158 (46%), Gaps = 21/158 (13%)

Query: 6   VYHTRFYTELVTDLAMAVKLKWPWLGIAIP-TFLISFIGYGAHYFILSNFLSVSKQIAFE 64
           +Y+T+FY     D     K ++ W    +P  +L  ++    +Y +  NF+       FE
Sbjct: 30  IYYTKFYRPFFLD-----KERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNPHLYWFE 84

Query: 65  SSLSM--IWVSY-YLAIYTNPGKPSPTYQPNPNT-----------WPNY-CKKCQNYKPE 109
             L +  ++ S  Y  + T   KP  + +   N+           +PN  CK C+  KP 
Sbjct: 85  KGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTCRKPKPA 144

Query: 110 RSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           RS HC  C++C+L+ DHHC W  NC+G  NY  F  FI
Sbjct: 145 RSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 93  PNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIA 152
           PNT   +C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY +F  F+     
Sbjct: 133 PNT---FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189

Query: 153 TTGFLF 158
             G+ F
Sbjct: 190 LLGYAF 195

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           YC+ C+ ++P RS HC  CN CV++ DHHC W  NC+G +NY  FL F+   + ++  L 
Sbjct: 174 YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILL 233

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 76  LAIYTNPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCV 135
           L  Y+    PSP    N      YC  C+ ++P R+ HC  C+ C+L  DHHC W  NC+
Sbjct: 165 LEYYSIITLPSPV--ANAPVRLKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCI 222

Query: 136 GFKNYPHFLRFIF-WVIATTGFLFCIQLK 163
           G +N+ +FL F+F  V+++   L C  LK
Sbjct: 223 GQRNHRYFLAFLFSSVLSSIWLLTCCALK 251

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           YC  C+ ++P RS HC  CN CV++ DHHC W  NC+G +NY  FL F+   I ++  L 
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILL 233

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 38/71 (53%)

Query: 87  PTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRF 146
           PT  P       YC  C+ ++P RS HC  C  C++  DHHC W  NC+G +NY  FL F
Sbjct: 204 PTGNPESTINIKYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTF 263

Query: 147 IFWVIATTGFL 157
           +     T+ FL
Sbjct: 264 LLSGTFTSIFL 274

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 87  PTYQP-NPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLR 145
           PT  P   N    YC  C+ ++P R+ HC  C  C++  DHHC W  NC+G +NY +F  
Sbjct: 158 PTGNPLIANIEVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFT 217

Query: 146 FIFWVIATTGFLFCIQLKRVS 166
           F+   +  T F+      RVS
Sbjct: 218 FLVSCVIATAFIIANCAIRVS 238

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 102/271 (37%), Gaps = 37/271 (13%)

Query: 6   VYHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAH-YFILSNFLSVSKQIAFE 64
           VY+ R Y   + D+       + W    +P F  S   Y  + Y+    +L V+    FE
Sbjct: 30  VYYRRLYVPYLKDVN-----SYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVNHLNLFE 84

Query: 65  SSLSM---IWVSYYLAIYTNPGKPSPTYQPN-------PNTWP---------NYCKKCQN 105
             + +   I ++    I T   KP   +           N +P         N C  C  
Sbjct: 85  RGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNVCSTCNI 144

Query: 106 YKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRV 165
            KP RS HC  C  C+L+ DHHC W  NC+G  NY +F  F+     +  + F   L+ +
Sbjct: 145 EKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAF---LRLL 201

Query: 166 SFIWQQRHLPGYLFKKSELVFLTILTPXXXXXXXXXXXXXXRCLFNQIINGRSQIESWDM 225
                +  +P    K   ++ L ILT               +    Q+ NG +  E+   
Sbjct: 202 HITLSKPDVP----KSKNILALCILTGSFSVICGVFFYLQMK----QVNNGMTTNETDKW 253

Query: 226 DRLESLFDSQRLIKKLIENTWRIYPEARSPQ 256
             ++ L    +LIK   +N W       +P 
Sbjct: 254 YAVQELMREGKLIKSE-DNNWFALSTEDAPD 283

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           C+ C+  KP RS HC  CN C+ + DHHC W  NCVG  NY +F  F+
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL 183

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           YC  C+ ++P RS HC  CN CV++ DHHC W  NC+G +NY  FL F+   I ++  L 
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILLL 233

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C  C+  K  RS HC  CN+CVL+ DHHC W  NC+G  NY  F  F+F  I +  + F 
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF- 194

Query: 160 IQLKRVSF 167
           ++L  +SF
Sbjct: 195 LRLYFISF 202

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 79  YTNPGKPSPTYQPNPNTWPN--YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 136
           Y++   P+P    +P +  +  YC  C+ ++P R+ HC  C  CV+  DHHC W  NCVG
Sbjct: 158 YSSISLPTPKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVG 217

Query: 137 FKNYPHFLRFIFWVIATTGFL 157
            +NY +F+ F+   +    FL
Sbjct: 218 QRNYRYFIIFLIGTVLAELFL 238

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (57%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           C  C+  KP RS HC  CN+C+L+ DHHC W  NC+G  NY  F  F+   I +  + F
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAF 194

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 96  WPNY-CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATT 154
           +PN  C+ C   KP RS HC+ CN C+L+ DHHC W  NC+G  NY +F  F+     T 
Sbjct: 134 YPNIECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITM 193

Query: 155 GFLFCIQLKRVSFIWQQRHLPG 176
            + F     R+  ++ Q H P 
Sbjct: 194 TYSFI----RLFLMYCQGHAPS 211

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           YC  C+ ++P R+ HC  C  C+L  DHHC W  NC+G +NY +F+ F+   I ++ FL 
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFL- 238

Query: 159 CIQLKRVSF-IWQQRHLPG 176
              +   S  I+  R+LP 
Sbjct: 239 ---IANCSIHIYHHRNLPS 254

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIF 148
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G  N+ +F  F+F
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF 185

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIF--WVIATTG 155
            YC  C+ ++P R+ HC  C  C+L  DHHC W  NC+G +NY +FL F+   W+ A   
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVIC 230

Query: 156 FLFC 159
            + C
Sbjct: 231 IVSC 234

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 87  PTYQPNPN---TWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHF 143
           P  + NPN       YC+ C+ ++P R+ HC  C  CV+  DHHC W  NCVG +NY +F
Sbjct: 162 PITRGNPNGDSILMKYCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYF 221

Query: 144 LRFIFWVIATTGFLF 158
           + F+      + FL 
Sbjct: 222 VTFLISGTLASIFLL 236

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 87  PTYQPNPNTWP-NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLR 145
           P+  P   T    YC  C+ ++P R+ HC  C  CVL  DHHC W  NC+G +NY +FL 
Sbjct: 164 PSAHPEGKTVDVKYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLT 223

Query: 146 FI 147
           F+
Sbjct: 224 FL 225

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 87/200 (43%), Gaps = 26/200 (13%)

Query: 7   YHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESS 66
           Y+TR +  L+ +       ++ W    +P F +S   Y     I      +  ++     
Sbjct: 34  YYTRIFRPLLQE-----DQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLLSVEK 88

Query: 67  LSMI-----------WVSYYLAIYTNPG-KPSPTYQPNPNT---WPNY-CKKCQNYKPER 110
           L +I           W+S  +   T+ G +P    + + +    +PN  C+ C   KP R
Sbjct: 89  LCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPAR 148

Query: 111 SHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQ 170
           S HC  C +CVL+ DHHC W  NC+G  NY  F  F+   + +  + F     RV +I  
Sbjct: 149 SRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL----RVLWISV 204

Query: 171 QRHLPGYLFKKSELVFLTIL 190
            +     ++ +S L+F TIL
Sbjct: 205 MKDPSMVVYPRSILIF-TIL 223

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P  TYQ +P+ +P +C +CQ+ K ER+HH  A   CV   DH+C W    +G  NY  FL
Sbjct: 108 PPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFL 167

Query: 145 RFIFWVIATTGFLFCIQLKRVSFIWQQR-HLPGYLFKKSELVFLT 188
           +F+ +       ++   +  +  I ++R + P + F  + ++ L 
Sbjct: 168 QFVAYYAINLSIIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIILV 212

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 79  YTNPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFK 138
           YTN  +  P    N +    YC  C  ++P R+ HC  C  C+ + DHHC W  NCVG +
Sbjct: 170 YTNTIRL-PVANKNHSIELKYCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNR 228

Query: 139 NYPHFLRFIFWVIATTGFL 157
           NY +F+ F+   I ++ F+
Sbjct: 229 NYRYFIIFLVGAILSSIFI 247

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 92  NPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIF 148
           N +    YC  C+ ++P R+ HC  C  CVL  DHHC W  NCVG +NY +FL F+ 
Sbjct: 152 NASVTLKYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLL 208

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 34/59 (57%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY  F  F+   I +  + F
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF 194

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRF----IFWVIATTG 155
           C  C   KP RS HC  CN+C+L+ DHHC W  NC+G  NY  F  F    IF ++    
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFL 195

Query: 156 FLFCIQL 162
            L+CI L
Sbjct: 196 RLWCISL 202

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P+  YQ + N +P +C  C+  K  RSHH    N C+   DH+C W    +G  NY  F+
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFV 163

Query: 145 RFIFWVIATTGFL 157
            F+F+   + G +
Sbjct: 164 IFLFYCTVSFGIM 176

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%)

Query: 84  KPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHF 143
           KP   YQ +PN +P +C  CQ+ K ER HH +    C+   DH+C W    +G  NY  F
Sbjct: 101 KPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLF 160

Query: 144 LRFIFW 149
           ++++F+
Sbjct: 161 IQYVFY 166

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%)

Query: 84  KPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHF 143
           KP   YQ + N +P +C  CQ+ K  RSHH K   +C+L  DH+C W    +   NY  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 144 LRFIFW 149
           L+++ W
Sbjct: 162 LQYVGW 167

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 37/70 (52%)

Query: 80  TNPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKN 139
           T   KP   YQ +P  +P +C  CQ+ K  R+HH      C+   DH+C W    VG KN
Sbjct: 105 TRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKN 164

Query: 140 YPHFLRFIFW 149
           Y  F++F F+
Sbjct: 165 YRLFVQFAFY 174

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +P  +P +C  CQ+ K ERSHH +    CV   DH+C W    +G KNY  F+
Sbjct: 112 PPDIYQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFM 171

Query: 145 RFIFWV---IATTGFLFCIQLKRV 165
           +++ +    + T      + +KR+
Sbjct: 172 QYVMYFTIYLVTASLTIALFMKRI 195

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 90  QPNPNTWPNY--------CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYP 141
           Q  P   P+Y        C+ C+  K  RS HC  C +C+ + DHHC W  NCVG+ NY 
Sbjct: 111 QAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYE 170

Query: 142 HFLRFI 147
           +F  F+
Sbjct: 171 YFYSFL 176

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +P  +P +C  CQ+ K  R+HH      C+   DH+C W    VG KNY  F+
Sbjct: 117 PPRIYQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFV 176

Query: 145 RF--------IFWVIATTGFL 157
           +F        IF +++T  FL
Sbjct: 177 QFAFYFWAFAIFVIVSTASFL 197

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +P+ +P +C  CQ+ K ER+HH      CV   DH+C W    +G  NY  F+
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 145 RFI 147
           +F+
Sbjct: 177 QFV 179

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIF 148
           C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G  NY +F  F+ 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 79  YTNP--GKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 136
           +T+P   KP   YQ + N +P +C  CQ+ K  R+HH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 137 FKNYPHFLRFIFWV 150
             NY  F++F+ ++
Sbjct: 163 AGNYLLFIQFLVYM 176

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +PN +P +C  CQ+ K ERSHH      C+   DH+C W    +G  NY  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 145 RF 146
           +F
Sbjct: 176 QF 177

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +P+ +P +C +CQ+ K ER+HH      C+   DH+C W    +G  NY  F+
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 145 RF 146
           +F
Sbjct: 176 QF 177

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 89  YQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIF 148
           YQ +P+ +P +C  CQ+ K  R+ H      CV   DH+C W    +GFKNY  F++F+F
Sbjct: 105 YQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVF 164

Query: 149 W 149
           +
Sbjct: 165 Y 165

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHF 143
           C+ C+  KP RS HC  C +CV + DHHC W  NCVG  NY  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +P  +P +C  CQ+ K ER+HH      CV   DH+C W    VG KNY  F+
Sbjct: 112 PPDIYQCDPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFI 171

Query: 145 RF---IFWVIATTGFLFCIQLKRVSFIWQQRH 173
           +F    F+         C  LK +  I   RH
Sbjct: 172 QFSMYFFFYFVIVLIPVCKYLKDI--IHHNRH 201

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ  P   P +C  C + K ER+HH      CV   DH C W    +G  NY  F+
Sbjct: 112 PPVCYQSCPRGNPIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFI 171

Query: 145 RFIFWVIATTGFLF---CIQLKRV 165
           +F+ ++   + F+F   C  ++R+
Sbjct: 172 QFVMYMAILSLFVFVPICAFIRRI 195

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 70/166 (42%), Gaps = 19/166 (11%)

Query: 79  YTNPGK--PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 136
           Y N G    S  YQ +PN +P +C  CQ+ K ER+HH +    CV   DH C +  + +G
Sbjct: 104 YQNHGSDGSSICYQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIG 163

Query: 137 FKNYPHFLRF-----IFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILT 191
             NY  F+++     I+  I  T  +  I+     +     HL G       L+ + ILT
Sbjct: 164 KDNYRLFVQYCVFMTIWLAIIWTSIVAYIRSITRDYRGHGSHLNG------NLIAILILT 217

Query: 192 PXXXXXXXXXXXXXXRCLFNQIINGRSQIESWDMDRLESLFDSQRL 237
                           C    I+  ++ IE   M+R    F ++++
Sbjct: 218 TLFWITVTSLLLTQLNC----IVKNKTSIEV--MERRRKAFSTRKM 257

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   Y+ + N +P +C  C++ K  R+HH K    C+   DHHC W    +G  NY  F 
Sbjct: 109 PPVFYECDINGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFT 168

Query: 145 RFIFWVIATTGFLFCIQLKRVSFIWQQRHLP--GYLFKKSELVFLTILTP 192
           +F+F+    +  L    +  VS+I +    P  GY    + +V L +  P
Sbjct: 169 QFVFYF---SCLLLIFWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVP 215

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +P+ +P +C  CQ+ K ER+HH      CV   DH+C W    +G  NY  F+
Sbjct: 122 PPRCYQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFV 181

Query: 145 RFI 147
           +F+
Sbjct: 182 QFV 184

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 42/93 (45%), Gaps = 12/93 (12%)

Query: 67  LSMIWVSYYLAIYTNP---GKPSPTYQPNPNTWP---------NYCKKCQNYKPERSHHC 114
           L+ I VS  L ++T P   G       P+   WP           C+ C   K  RS HC
Sbjct: 94  LAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHC 153

Query: 115 KACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
             C +C+ + DHHC W   C+G  N+ +F  F+
Sbjct: 154 SICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159
           C+ C+  K  RS HC  C +C  + DHHC W  NC+G  NY +F  F    +A+  FL  
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLF----LASNVFLTV 186

Query: 160 IQLKRVSFI 168
               R+ ++
Sbjct: 187 YGFTRLLYL 195

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 77  AIYTNPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 136
           A+  N   P   Y  +   +P +C  CQ+ K  R+HH      CV   DH+C W    +G
Sbjct: 105 AVPDNSIAPPDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLG 164

Query: 137 FKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPG 176
             NY  F++F F++      L       +S   Q R + G
Sbjct: 165 RLNYKLFVQFTFYLDLVVLILM------ISIATQMRQMKG 198

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 85  PSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFL 144
           P   YQ +   +P +C  CQ+ K  R+HH      CV  +DH+C W    +G +NY  F 
Sbjct: 107 PPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFN 166

Query: 145 RFI--FWVIATTGFLFCIQLKR 164
           +F+  F + A   F+  + L+R
Sbjct: 167 QFLMCFLMHALIIFVSVVSLQR 188

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           N+C +    KP RS +    N  V   DH+CPW  N VG KN+  FL FI  +    G  
Sbjct: 462 NFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSMETGIGLF 521

Query: 158 --FCIQ-LKRVSFIWQQRHLPGYLFKKSEL 184
              C++   ++  ++    L   L    EL
Sbjct: 522 TSLCLEYFDQLEDLYDDDKLKCLLLGDDEL 551

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIA 152
           N+C +    KP RS +    N  V   DH CPW  N VG KN+ +F+ FI  V A
Sbjct: 472 NFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEA 526

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           N+C +    KP RS      N  V   DH+CPW  N +G KN+  F+ FI  V       
Sbjct: 461 NFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIGILIF 520

Query: 158 FCIQLKRVSFI 168
            C+ +K   F+
Sbjct: 521 VCLTMKYFDFL 531

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIAT--TG 155
           N+C +    KP RS      N  V   DH+CPW  N VG KN+  F+ FI  + +   T 
Sbjct: 470 NFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIALMESGIFTF 529

Query: 156 FLFCIQ 161
           F  C++
Sbjct: 530 FALCLE 535

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           N+C +    KP RS      N  V   DH+CPW  N VG KN+  F+ FI
Sbjct: 469 NFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           ++C +    KP RS +    N  V   DH+CPW  N VG KN+  F+ FI
Sbjct: 470 SFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           N+C +    KP RSH        V   DH CPW  N +G KN+ +F+ FI        F 
Sbjct: 455 NFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFF 514

Query: 158 FCIQLK 163
             + +K
Sbjct: 515 ISLTMK 520

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           N+C +    KP RS      N  V   DH+CPW  N VG KN+  F+ FI
Sbjct: 470 NFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           N+C +    KP RS +       V   +H+CPW  N +G KN+  F+ F F V     FL
Sbjct: 429 NFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSV-QYEMFL 487

Query: 158 F---CIQ-LKRVSFIWQQ 171
           F   C++  K+ + I++Q
Sbjct: 488 FMWLCLEYFKKTNHIYEQ 505

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVI 151
           N+C +    KP RS +    +  V   DH CPW  N +G KN+  F+ FI  ++
Sbjct: 477 NFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMV 530

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWV 150
           N+C +    KP RS      N  V   DH+CPW  N +G +N+  FL  I  V
Sbjct: 462 NFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           N+C +    KP RS +       V   DH+CPW  N VG KN+  F+ F    +    FL
Sbjct: 446 NFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFV-FFAVTVQYHMFL 504

Query: 158 F---CIQ-LKRVSFIWQQ 171
           F   C+   K+ ++I++Q
Sbjct: 505 FMWLCLAYFKKTNYIYEQ 522

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 13/103 (12%)

Query: 61  IAFESSLSMIWVSYYLAIYTNPG-------------KPSPTYQPNPNTWPNYCKKCQNYK 107
           I F + L  + + ++  +Y++PG             K S   +       N+C +    K
Sbjct: 408 ILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRK 467

Query: 108 PERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWV 150
           P R       ++ VL  DH+CPW  N VG  N+  F+ ++  V
Sbjct: 468 PLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 43/95 (45%), Gaps = 11/95 (11%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           N+C +    KP RS         V   DH CPW  N +G KN+  FL F    +    FL
Sbjct: 443 NFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFL-FFALTVQYHMFL 501

Query: 158 F---CIQ-LKRVSFIWQQRHLPGY----LFKKSEL 184
           F   C+   KR + I++Q  + GY    LFK   L
Sbjct: 502 FMWLCLAYFKRTNHIYEQ--VDGYARCALFKNETL 534

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTG-- 155
           ++C      KP RS   +     ++  DH CPW  N VG  N+  F+ F+  +++     
Sbjct: 452 HFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCF 511

Query: 156 FLFCIQ 161
           F+ CI+
Sbjct: 512 FIACIE 517

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIF 148
           ++C +    KP RS +    +  +L  DH+CPW  N VG KN+  F+ FI 
Sbjct: 454 SFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 13/100 (13%)

Query: 63  FESSLSMIWVSYYLAIYTNPGKPSPTY-------------QPNPNTWPNYCKKCQNYKPE 109
           F  S+  +   +Y  I +NPG+ +  +             +       ++C +    KP 
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPL 477

Query: 110 RSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFW 149
           RS         V   DH+CPW  N +G +N+  F+ FIF+
Sbjct: 478 RSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFF 517

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%)

Query: 108 PERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSF 167
           P RS +  A N  +   DH+CPW  N +GF N+  FL FI ++         + ++    
Sbjct: 464 PLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGVFIFVRLSIRYFEL 523

Query: 168 IWQ 170
            WQ
Sbjct: 524 EWQ 526

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           ++C +    KP RS         +   DH+CPW  N VG KN+  FL F+
Sbjct: 460 HFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFV 509

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 108 PERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRF 146
           P R+ + +  +  +L  DH+CPW  N +GF+N+  F+ F
Sbjct: 456 PLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           ++C      KP RS         V   DH CPW  N +G +N+  FL FI   + T  F+
Sbjct: 450 HFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL-CLETCIFV 508

Query: 158 F 158
           F
Sbjct: 509 F 509

>NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97
          Length = 784

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 43  GYGAHYFILSNFLS---VSKQIAFESSLSMIWVSYYLAIYT------NPGKPSPTYQP-N 92
           G   H  +LSN +    +S Q +  S+ S +  SY   I +      +  K  PT++   
Sbjct: 575 GSIPHQGVLSNAMDNLLLSSQSSVRSTTSSLVESYKSKIVSLFSHSNDSSKTEPTHEHWV 634

Query: 93  PNTWPNYCKKCQNYKP--ERSHHCKACNQ--CVLMMDH 126
           P++    C+KCQ      ER HHC+ C +  C L + H
Sbjct: 635 PDSERTSCRKCQKQFTFIERKHHCRHCGEIYCALHLRH 672

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%)

Query: 98  NYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWV 150
           N+C +    K  RS +       V   DH+CPW  N +G KN+   L F   V
Sbjct: 440 NFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFFAMTV 492

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 99  YCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFL 157
           +C K    KP R    K   Q V   DH+C W  N VG KN+     +IF++I    FL
Sbjct: 404 FCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHK---LYIFFLILLETFL 459

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 209 LFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEA-RSPQLERDAEKLLTQ 267
           LFN I +GR    S+DM +  SL   +  I KL ++  RI  E+ RS +       LL +
Sbjct: 536 LFNNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGK 595

Query: 268 HKIRFEEVVN 277
            K+  E  +N
Sbjct: 596 PKLEVENYLN 605

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 19/40 (47%)

Query: 108 PERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFI 147
           P RS + +     +   DH CPW  N +G  N+  F  F+
Sbjct: 476 PLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFV 515

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,646,781
Number of extensions: 1808937
Number of successful extensions: 6516
Number of sequences better than 10.0: 135
Number of HSP's gapped: 6559
Number of HSP's successfully gapped: 135
Length of query: 398
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 286
Effective length of database: 40,638,807
Effective search space: 11622698802
Effective search space used: 11622698802
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 67 (30.4 bits)