Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1716.29ON1561101849870.0
Skud_15.1586.29ON1555101444470.0
Smik_15.1666.29ON1566101543880.0
YOL004W (SIN3)6.29ON1536101243790.0
TDEL0G044006.29ON149096230640.0
ZYRO0C07524g6.29ON167085130590.0
KAFR0A051206.29ON147999429390.0
Kpol_1037.226.29ON149698229310.0
NCAS0D021306.29ON143496329260.0
KNAG0F029206.29ON149296229140.0
Ecym_30336.29ON147494728150.0
CAGL0E02475g6.29ON149395128030.0
ACL004W6.29ON137796728020.0
SAKL0E01540g6.29ON141596927960.0
TPHA0J004006.29ON151282927690.0
TBLA0E031606.29ON173985027480.0
KLTH0C10956g6.29ON143391827450.0
NDAI0C026606.29ON165781427150.0
KLLA0C06182g6.29ON151995327000.0
Kwal_56.224626.29ON154190326970.0
CAGL0J11594g6.29ON9373616245e-66
Kpol_1064.538.403ON48969850.36
ABR197W8.450ON46839801.3
YFR025C (HIS2)1.351ON33546745.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.171
         (1561 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1925   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1717   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1694   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1691   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1184   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1182   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1136   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1133   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1131   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1127   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1088   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1084   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1083   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1081   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1071   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1063   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1061   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1050   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1044   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1043   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   244   5e-66
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    37   0.36 
ABR197W Chr2 (774956..776362) [1407 bp, 468 aa] {ON} Syntenic ho...    35   1.3  
YFR025C Chr6 complement(203743..204750) [1008 bp, 335 aa] {ON}  ...    33   5.3  

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1925 bits (4987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 942/1018 (92%), Positives = 942/1018 (92%)

Query: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603
            FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ
Sbjct: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603

Query: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPVRPEI 663
            QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNF                 YGDVPVRPEI
Sbjct: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPVRPEI 663

Query: 664  DLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 723
            DLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL
Sbjct: 664  DLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 723

Query: 724  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLP 783
            DDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLP
Sbjct: 724  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLP 783

Query: 784  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 843
            KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF
Sbjct: 784  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 843

Query: 844  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 903
            YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI
Sbjct: 844  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 903

Query: 904  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQAD 963
            IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQAD
Sbjct: 904  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQAD 963

Query: 964  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHT 1023
            KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHT
Sbjct: 964  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHT 1023

Query: 1024 TAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXTPRKRPY 1083
            TAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNL            TPRKRPY
Sbjct: 1024 TAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSSTPRKRPY 1083

Query: 1084 QQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLTGN 1143
            QQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLD                KNPWLTGN
Sbjct: 1084 QQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLTGN 1143

Query: 1144 LVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVT 1203
            LVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVT
Sbjct: 1144 LVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVT 1203

Query: 1204 FAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKL 1263
            FAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKL
Sbjct: 1204 FAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKL 1263

Query: 1264 YTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTEN 1323
            YTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTEN
Sbjct: 1264 YTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTEN 1323

Query: 1324 MFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPF 1383
            MFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPF
Sbjct: 1324 MFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPF 1383

Query: 1384 LERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYP 1443
            LERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYP
Sbjct: 1384 LERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYP 1443

Query: 1444 TVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDK 1503
            TVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDK
Sbjct: 1444 TVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDK 1503

Query: 1504 ITVXXXXXXXXXXXXXXXXLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDKETNNKI 1561
            ITV                LPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDKETNNKI
Sbjct: 1504 ITVAKNEKAIEAKEEQQENLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDKETNNKI 1561

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/330 (90%), Positives = 300/330 (90%)

Query: 1   MNALGRTEDRKSFNGLPEEEKANQPVQDHKRXXXXXXXXXXXEVSNVYADTKDEINAENT 60
           MNALGRTEDRKSFNGLPEEEKANQPVQDHKR           EVSNVYADTKDEINAENT
Sbjct: 1   MNALGRTEDRKSFNGLPEEEKANQPVQDHKRAPAAVQPADAAEVSNVYADTKDEINAENT 60

Query: 61  NDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTL 120
           NDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTL
Sbjct: 61  NDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTL 120

Query: 121 FRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPS 180
           FRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPS
Sbjct: 121 FRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPS 180

Query: 181 SLPEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPIPQSQ 240
           SLPEADGSTIPQSHNVPMVPSNVYH                   GLPSIHQPELPIPQSQ
Sbjct: 181 SLPEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIPQSQ 240

Query: 241 PLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 300
           PLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ
Sbjct: 241 PLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 300

Query: 301 VTHLFQNAPDLLEDFKKFLPDSSASANEQV 330
           VTHLFQNAPDLLEDFKKFLPDSSASANEQV
Sbjct: 301 VTHLFQNAPDLLEDFKKFLPDSSASANEQV 330

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1717 bits (4447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 826/1014 (81%), Positives = 886/1014 (87%)

Query: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603
            FLYPAS+YY+HSTN G+PQQNLPPIGSFSPPTNGST H+ +QDQQHMQPPHL+PLPSMVQ
Sbjct: 538  FLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ 597

Query: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPVRPEI 663
             GPNMVHQGI NEN+P+SDLRTSLTDQYAPS F                 YGDVPVRPEI
Sbjct: 598  HGPNMVHQGIANENLPISDLRTSLTDQYAPSTFQQQQQNPPSISPITDLQYGDVPVRPEI 657

Query: 664  DLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 723
            DLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL
Sbjct: 658  DLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 717

Query: 724  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLP 783
            DDLVEKVDFYLGSNKELFSWFKNFVGYQEK K IEN+VHEKHRLDLDLCEAFGPSYKRLP
Sbjct: 718  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 777

Query: 784  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 843
            KSDTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF
Sbjct: 778  KSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 837

Query: 844  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 903
            YIESNLRTIQCLETIVNKIENMTE+EK++FKLPPGLGHTSMTIYKKVIRKVYDKERGFEI
Sbjct: 838  YIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 897

Query: 904  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQAD 963
            IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQAD
Sbjct: 898  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 957

Query: 964  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHT 1023
            KKLLTTKQLISEI+SIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFI+HT
Sbjct: 958  KKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHT 1017

Query: 1024 TAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXTPRKRPY 1083
            TAYSNPDKERLKDLL YFISLFFSIPLEKIE+ALQ +K+N+            T RKRPY
Sbjct: 1018 TAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVSESSGSDDGGSSTSRKRPY 1077

Query: 1084 QQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLTGN 1143
            QQEMSLLDILHR++YQKLKRSNDE+GK+PQLSEPLD                +NPWLTGN
Sbjct: 1078 QQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGN 1137

Query: 1144 LVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVT 1203
            LVEEANSQGIIQNR+IFNLFAN+NIYIFFRHWTTIYERLLEIKQMN K+TKE++ RS VT
Sbjct: 1138 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVT 1197

Query: 1204 FAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKL 1263
            FAKDLDLLS+QL EMGLDF GEDAYKQVL+LSRRLING+LEHQWFEE LRQAYNNKAFKL
Sbjct: 1198 FAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1257

Query: 1264 YTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTEN 1323
            YTIDKV Q LVKHAHTLM D KTAEIMALFVKDRNA TTSAKDQIIYRLQ RSYMSN EN
Sbjct: 1258 YTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIEN 1317

Query: 1324 MFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPF 1383
            MFR+E ++R+LHVSVQYIALDDLTLKEP+ADEDKWKYYVTSY LPHPTEGISHEKLKIPF
Sbjct: 1318 MFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPF 1377

Query: 1384 LERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYP 1443
            LERLIE+GQDTDGREVDE+FSPEG+S+STL+IKIQP+TYKLHIE+GSYDVFTRKA NKYP
Sbjct: 1378 LERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYP 1437

Query: 1444 TVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDK 1503
            T+ANDD+HKEMVV+KT LIS+FL+NAIR RNDLNE  K  MQEKL  LKG T K + +++
Sbjct: 1438 TIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENE 1497

Query: 1504 ITVXXXXXXXXXXXXXXXXLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDKET 1557
            +                  LPTSD +V+ SSI+N PQ  N E   + GP +KET
Sbjct: 1498 VKELKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKET 1551

 Score =  471 bits (1211), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 244/330 (73%), Positives = 259/330 (78%), Gaps = 9/330 (2%)

Query: 1   MNALGRTEDRKSFNGLPEEEKANQP-VQDHKRXXXXXXXXXXXEVSNVYADTKDEINAEN 59
           +N    T+D KS+NG+ EEEKANQ  +QD +            E S+ Y DT   +N EN
Sbjct: 160 INTSVCTKDSKSYNGVQEEEKANQQQIQDQR---PAAHSANASEPSSNYVDTSYSVNNEN 216

Query: 60  TNDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVST 119
           +NDEDPDYRPLNVKDALSYLEQVKFQF+SRPDIYNLFLDIMKDFKSQAIDTPGVIERVST
Sbjct: 217 SNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVST 276

Query: 120 LFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEP 179
           LFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSP  R  ++ QEP
Sbjct: 277 LFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEP 336

Query: 180 SSLPEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELP---- 235
           SSL E DG+ I   HN+PMVPSNVY                    GL SIH PE+P    
Sbjct: 337 SSLSEPDGNAIQPFHNLPMVPSNVYR-SEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQ 395

Query: 236 IPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 295
           I Q Q L  QED KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN
Sbjct: 396 ILQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 455

Query: 296 EVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 325
           EVYAQVTHLFQNAPDLLEDFKKFLPDSSAS
Sbjct: 456 EVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 485

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1694 bits (4388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 825/1015 (81%), Positives = 876/1015 (86%), Gaps = 2/1015 (0%)

Query: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603
            FLYPAS+YY HS N GIPQQNLPPIGSFSPPTNGST HE +QDQQHMQPPHLMPLPSMVQ
Sbjct: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ 610

Query: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXX-XXXXXYGDVPVRPE 662
             G N+VHQGI NEN+PLSDLRTSLT+QYAPSN                   YGDVPVRPE
Sbjct: 611  HGANIVHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPVRPE 670

Query: 663  IDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 722
            IDLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD
Sbjct: 671  IDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 730

Query: 723  LDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRL 782
            LDDLVEKVDFYLGSNKELFSWFKNFVGYQE+ K IEN+VHEKHRLDLDLCEAFGPSYKRL
Sbjct: 731  LDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRL 790

Query: 783  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 842
            PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 791  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 850

Query: 843  FYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 902
            FYIESNLRTIQCLETIVNKIENMTENEK NFKLPPGLGHTSMTIYKKVIRKVYDKERGFE
Sbjct: 851  FYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 910

Query: 903  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQA 962
            IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQA
Sbjct: 911  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 970

Query: 963  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAH 1022
            DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IF DILYLADSFI+H
Sbjct: 971  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISH 1030

Query: 1023 TTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXTPRKRP 1082
            TTAYSNPDKERLKDLL YFISLFFSI LE+IEE+LQ+YKQ++              RKR 
Sbjct: 1031 TTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQAYKQSVSESSGSDDGGSSVSRKRS 1090

Query: 1083 YQQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLTG 1142
            YQQEM+LLDILHRS+YQKLKRS DEDGKVPQLSE  D                KNPWLTG
Sbjct: 1091 YQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTG 1150

Query: 1143 NLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMV 1202
            NLVEEANSQG+IQNR IFNLFAN+NIYIFFRHWTTIYERLLEIKQMNEKVTKEI+ RS V
Sbjct: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210

Query: 1203 TFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFK 1262
            TFAKDLDLLS+QLSEMGLDF GEDAYKQVLKLSRRLING+LEHQWFEE LRQAYNN+AFK
Sbjct: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270

Query: 1263 LYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTE 1322
            LYTIDKV Q LVKHAHTLMTDAKTAEIMALFVKDRN +TTSAK QIIYRLQ RS+MSNTE
Sbjct: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330

Query: 1323 NMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIP 1382
            NMFR+EFD+R LHVS+QYIALDDLTLKEP+ DEDKWKYYVTSYALPHPTEG+ HEKLKIP
Sbjct: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390

Query: 1383 FLERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKY 1442
            FLERLIE+GQD DG++VDEKFSPEG+SVSTLKIKIQP TYKL IE+GSYDVFTRK+ANKY
Sbjct: 1391 FLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKY 1450

Query: 1443 PTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDD 1502
            PTVANDD HKE+VV+K  LIS+FLD A+ LRNDLNE++K+SMQEK +SLK  T K +VD 
Sbjct: 1451 PTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVDG 1510

Query: 1503 KITVXXXXXXXXXXXXXXXXLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDKET 1557
            ++                  L +SD  V  SS ++VPQDDN EV  +TG  D ET
Sbjct: 1511 QVVDTKIEEATKTKQEQQENLASSDASVF-SSTSDVPQDDNIEVMRSTGLSDTET 1564

 Score =  468 bits (1203), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 248/338 (73%), Positives = 266/338 (78%), Gaps = 12/338 (3%)

Query: 1   MNALGRTEDRKSFNGLPEEEKANQPVQDHKRXXXXXXXXXXXEVSNVYADTKDEINAENT 60
           +NA   TE  +S+N   EEEKA+Q  QDHK            + +N + DT D+ N  N+
Sbjct: 156 INAPVHTEGSQSYNCPQEEEKASQQTQDHKEVSAGAQPTDATKSANDHIDTNDDNNNNNS 215

Query: 61  NDED-------PDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGV 113
           N+ +       PDYRPLNVKDALSYLEQVKFQF+SRPDIYNLFLDIMKDFKSQAIDTPGV
Sbjct: 216 NNNNENFNEEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGV 275

Query: 114 IERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSA 173
           IERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN+SPP R  
Sbjct: 276 IERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGT 335

Query: 174 LEPQEPSSLPEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPE 233
           ++ QEPSSLPEADG+   +SHNVPMVPSNVYH                   GLPSI Q E
Sbjct: 336 IDAQEPSSLPEADGNGTQRSHNVPMVPSNVYH-SEQNQDQQQVLPLSATSTGLPSIQQSE 394

Query: 234 LP----IPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 289
           +P    IPQ QPL  QEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR
Sbjct: 395 IPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 454

Query: 290 EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 327
           EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN
Sbjct: 455 EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 492

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1691 bits (4379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 822/1012 (81%), Positives = 871/1012 (86%)

Query: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603
            FLYPAS YY H +N GIPQQNLPPIGSFSPPTNGST HE +QDQQHMQPPH MPLPS+VQ
Sbjct: 520  FLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQ 579

Query: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPVRPEI 663
             GPNMVHQGI NEN PLSDLRTSLT+QYAPS+                  YGD+PVRPEI
Sbjct: 580  HGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQHPQSISPIANTQYGDIPVRPEI 639

Query: 664  DLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 723
            DLD               +NISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL
Sbjct: 640  DLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 699

Query: 724  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLP 783
            DDLVEKVDFYLGSNKELF+WFKNFVGYQEK K IEN+VHEKHRLDLDLCEAFGPSYKRLP
Sbjct: 700  DDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 759

Query: 784  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 843
            KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF
Sbjct: 760  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 819

Query: 844  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 903
            YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI
Sbjct: 820  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 879

Query: 904  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQAD 963
            IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQAD
Sbjct: 880  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 939

Query: 964  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHT 1023
            KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IFYDIL LAD+FI HT
Sbjct: 940  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHT 999

Query: 1024 TAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXTPRKRPY 1083
            TAYSNPDKERLKDLL YFISLFFSI  EKIEE+L S+KQN+              RKRPY
Sbjct: 1000 TAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSSIASRKRPY 1059

Query: 1084 QQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLTGN 1143
            QQEMSLLDILHRS+YQKLKRSNDEDGKVPQLSEP +                KNPWLTGN
Sbjct: 1060 QQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGN 1119

Query: 1144 LVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVT 1203
            LVEEANSQGIIQNR+IFNLFAN+NIYIFFRHWTTIYERLLEIKQMNE+VTKEI+ RS VT
Sbjct: 1120 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVT 1179

Query: 1204 FAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKL 1263
            FAKDLDLLSSQLSEMGLDF GEDAYKQVL+LSRRLING+LEHQWFEE LRQAYNNKAFKL
Sbjct: 1180 FAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1239

Query: 1264 YTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTEN 1323
            YTIDKV Q LVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQ RS+MSNTEN
Sbjct: 1240 YTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTEN 1299

Query: 1324 MFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPF 1383
            MFR+EFD+R LHVS+QYIALDDLTLKEP+ADEDKWKYYVTSYALPHPTEGI HEKLKIPF
Sbjct: 1300 MFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPF 1359

Query: 1384 LERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYP 1443
            LERLIE+GQD DG EVDE+FSPEG+SVSTLKIKIQP+TY+LHIE+GSYDVFTRKA NKYP
Sbjct: 1360 LERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYP 1419

Query: 1444 TVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDK 1503
            T+AND+  K MV +K  LISKFLD A+ LRN+L+E +KLSMQ+K ++LK +  K    ++
Sbjct: 1420 TIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQ 1479

Query: 1504 ITVXXXXXXXXXXXXXXXXLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDK 1555
                               L +S   VLP+SI  VPQDDN E TGNT   DK
Sbjct: 1480 GIESETEKGKITKQEQSDNLDSSTASVLPASITTVPQDDNIETTGNTESSDK 1531

 Score =  447 bits (1150), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/326 (72%), Positives = 254/326 (77%), Gaps = 6/326 (1%)

Query: 7   TEDRKSFNGLPEEEKANQPVQDHKRXXXXXXXXXXXEVSNVYADTKDEINAENTNDE-DP 65
           TE+ KS+NGL EEEKA Q  QD K            + S+ +AD  D+ N    + + D 
Sbjct: 155 TEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADANDDNNNNENSHDEDA 214

Query: 66  DYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYP 125
           DYRPLNVKDALSYLEQVKFQF+SRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYP
Sbjct: 215 DYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYP 274

Query: 126 ILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSLPEA 185
           ILIQGFNTFLPQGYRIECS+NPDDPIRVTTPMGTTTVNNN+SP  R   + QE  S PE+
Sbjct: 275 ILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPES 334

Query: 186 DGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELP----IPQSQP 241
           DG+ + Q  NVPMVPS+VY                    GLPSI QPE+P    IPQSQ 
Sbjct: 335 DGNGVQQPSNVPMVPSSVY-QSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQS 393

Query: 242 LTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 301
           L  QED KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV
Sbjct: 394 LVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 453

Query: 302 THLFQNAPDLLEDFKKFLPDSSASAN 327
           THLFQNAPDLLEDFKKFLPDSSASAN
Sbjct: 454 THLFQNAPDLLEDFKKFLPDSSASAN 479

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/962 (60%), Positives = 721/962 (74%), Gaps = 32/962 (3%)

Query: 552  YSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ-------- 603
            Y + T+    +QNLPP+GSFSPP NG+  H  ++DQQ    P  + LP + Q        
Sbjct: 474  YYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ----PQTLGLPPVAQVENHIDQR 529

Query: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXX----XYGDVPV 659
              P++  QGI  E +P+S+LR+ +T Q +PS                       Y D+ V
Sbjct: 530  SPPHIATQGIAGEPMPVSNLRSQITAQ-SPSELAQLHQQQQIPSQPTANIPDGQYLDIAV 588

Query: 660  RPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQD 719
            RPEIDLD               D+++L EE +FF++AK++IGNK +YTEFLKILNL+SQD
Sbjct: 589  RPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQD 648

Query: 720  ILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSY 779
            +LD+D+LV +V+ YLG NKELF WFKNFVG+Q+K K IEN+VHEKHRLDLDLCEA GPSY
Sbjct: 649  LLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSY 708

Query: 780  KRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 839
            K+LPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH
Sbjct: 709  KKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 768

Query: 840  EYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKER 899
            EYDFYIESNLRTIQ LETI +KI NM+E EKA FKLPPGLGHTS+TIYKKVIRKVYDKER
Sbjct: 769  EYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKER 828

Query: 900  GFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTF 959
            GFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTF
Sbjct: 829  GFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTF 888

Query: 960  KQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSF 1019
            KQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLD+  PDK +F+DIL L D+F
Sbjct: 889  KQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTF 948

Query: 1020 IAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXTPR 1079
            I H ++YSNPDK RLKDL   F+SLFFSIP+ ++ EA+ S + NL            +  
Sbjct: 949  INHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAV-SRRGNLDDDKEDSTQKMESDN 1007

Query: 1080 ----KRPYQQEMSLLDILHRSKYQKLK-RSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXX 1134
                KRP + E+SL ++LHR+K Q+ K R+ DE  +                        
Sbjct: 1008 LNNSKRPREDEISLSEVLHRAKNQRFKSRAADETSEESAAEP----EPELNEEEETIRQE 1063

Query: 1135 XKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTK 1194
             K PWL GNLVEE N+QG+I NR  FN+FAN+NIY+FFRH TT+YERL E+K+MN+ VTK
Sbjct: 1064 AKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTK 1123

Query: 1195 EISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQ 1254
            EI+ R +V FAKDL+L+S QL EMGLDF G DAY+Q+  L +RLI G++EHQWFEE LRQ
Sbjct: 1124 EINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQ 1183

Query: 1255 AYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQA 1314
            AYNNKAFKLYT+DKVIQ LVKHAHT++TD+KT+EIM  F KDR    TSAKDQI+YRLQ 
Sbjct: 1184 AYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQV 1243

Query: 1315 RSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGI 1374
            RSYMS+TENMFR+E+++++ +V +Q+IA+DDLTL EPR+ E+KW+YYVTSY+L HPTEGI
Sbjct: 1244 RSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGI 1303

Query: 1375 SHEKLKIPFLERLIE----YGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGS 1430
            S E+L++PFLE+++E    YG D D   +D KFSPEG+S STLKIKI P TY L IE+GS
Sbjct: 1304 SQEELQLPFLEKVLETEEDYGSDVDNFSID-KFSPEGVSKSTLKIKIDPETYLLDIEAGS 1362

Query: 1431 YDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDS 1490
            YDVF+RK+ N++P + + + +     KK  ++ +FL++    + +L++ +  ++QEKL  
Sbjct: 1363 YDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLAR 1422

Query: 1491 LK 1492
            +K
Sbjct: 1423 VK 1424

 Score =  191 bits (485), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%)

Query: 64  DPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 123
           D  YRPLNVKDALSYLEQVK+QFNSRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+G
Sbjct: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

Query: 124 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNV 166
           YP LIQGFNTFLPQGYRIECS NPD+PIRVTTPMG+++V   +
Sbjct: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTI 290

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 43/77 (55%)

Query: 60  TNDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVST 119
           +ND+      +    A++Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ 
Sbjct: 370 SNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 429

Query: 120 LFRGYPILIQGFNTFLP 136
           LF+  P L+  F  FLP
Sbjct: 430 LFQNAPDLLDDFKKFLP 446

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1182 bits (3059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/851 (67%), Positives = 677/851 (79%), Gaps = 11/851 (1%)

Query: 654  YGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 713
            Y D+ VRPEIDLD               D++SL EE +FF+KAK++IGNK LYTEFLKIL
Sbjct: 760  YVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKIL 819

Query: 714  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCE 773
            NLYSQD+LD+D LVEKV+ YLG +KELF+WFKNFVGYQ++ K+IENV+HEKHRLDLD+CE
Sbjct: 820  NLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCE 879

Query: 774  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 833
            A GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 880  ASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFK 939

Query: 834  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRK 893
            +EEERHEYDFYIESNLRTIQ LETI +KI NMTE EKANFKLPPGLGHTS+TIYKKVIRK
Sbjct: 940  VEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRK 999

Query: 894  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 953
            VYDKERGFEIIDALHEHPAV  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD
Sbjct: 1000 VYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 1059

Query: 954  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDIL 1013
            HLGLTFKQADKKLLTTKQLISEISSIKVDQTNK+IHWLTPKPKSQLD+DFPD++IF DIL
Sbjct: 1060 HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDIL 1119

Query: 1014 YLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXX 1073
             L + F+ HT  YSN DKERLKD L  F+SLFFSIP+ ++ + L+    +          
Sbjct: 1120 SLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANKK 1179

Query: 1074 XXXTP---RKRPYQQEMSLLDILHRSKYQKLK-RSNDEDGKVPQLSEPLDXXXXXXXXXX 1129
               T     KRP + E+ L DILHR+KYQKLK RS+ E+G + Q  E LD          
Sbjct: 1180 ENGTALAHGKRPREIELPLRDILHRNKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEEE 1239

Query: 1130 XXXXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMN 1189
                  K PWL GN+VEEAN+QGII NR  FNLFAN++IY+FFRH TT+YERL+E+K ++
Sbjct: 1240 IIKQEAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSID 1299

Query: 1190 EKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFE 1249
            ++VT+EI+ R +  FAKDL+L+S QL  MGLDF G DAY+Q+L LS+RLI G++EHQWFE
Sbjct: 1300 QEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFE 1359

Query: 1250 EGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQII 1309
            E LRQAYNN+AFK YT+DKV+Q LVKHAHT++TD K +EIM LF KDR  +TTSAKDQI+
Sbjct: 1360 ESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQIL 1419

Query: 1310 YRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPH 1369
            YR+QARS+MSNTENMFR+EF+R + HV +QYIA+DDLTL E ++ EDKWKYYVTSY+L H
Sbjct: 1420 YRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSH 1479

Query: 1370 PTEGISHEKLKIPFLERLI----EYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLH 1425
            PTEGISHE L++PFLE++I    EY +D  G   D KFSPEG+S S+L+IKI P TY L 
Sbjct: 1480 PTEGISHEDLQVPFLEKIIESEQEYDEDNGG---DPKFSPEGVSKSSLRIKIDPETYFLE 1536

Query: 1426 IESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQ 1485
            +E GS DVF+RKA NK+P   N + HK  V KK  LI  +LD+    + +L+     S++
Sbjct: 1537 VEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVE 1596

Query: 1486 EKLDSLKGATT 1496
            EKL+ +K   T
Sbjct: 1597 EKLNFVKNYGT 1607

 Score =  192 bits (488), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/96 (90%), Positives = 93/96 (96%)

Query: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126
           YRPLNVKDALSYLEQVKFQFNSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRGYP 
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV 162
           LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTV 372

 Score =  147 bits (372), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 79/91 (86%), Gaps = 2/91 (2%)

Query: 231 QPELPIPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 290
           QPE+P P  QP  A +  KK  DVEFSQAISYVNKIK RF+DQPDIYKHFLEILQTYQRE
Sbjct: 499 QPEVPAP-VQPQLADQ-TKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQRE 556

Query: 291 QKPINEVYAQVTHLFQNAPDLLEDFKKFLPD 321
           QKPINEVYAQVT LFQNAPDLL+DFKKFLPD
Sbjct: 557 QKPINEVYAQVTVLFQNAPDLLDDFKKFLPD 587

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 4/82 (4%)

Query: 548 ASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQD--QQHMQPP--HLMPLPSMVQ 603
           A+ Y  +  N  + +QNLPP+GSFSPP NG+   + +Q+  Q    PP  HL    + V 
Sbjct: 612 ATGYGYYGENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVT 671

Query: 604 QGPNMVHQGIVNENIPLSDLRT 625
               ++ QG+ N+ IPLS++R+
Sbjct: 672 PSHYVMTQGMSNDAIPLSNMRS 693

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344

Query: 319 LP 320
           LP
Sbjct: 345 LP 346

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 135 LP 136
           LP
Sbjct: 585 LP 586

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1136 bits (2939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/994 (57%), Positives = 703/994 (70%), Gaps = 64/994 (6%)

Query: 560  IPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQQ----------GPNMV 609
            + QQ+LPPIGSFSPP N      G       Q PH+M LPSM+Q            P + 
Sbjct: 474  VAQQSLPPIGSFSPPANT-----GISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVS 528

Query: 610  HQGIVNENIPLSDLRTSLTDQYAPSNFXX------------------------------X 639
             QGI N+ IP+SD+R +     A  ++                                 
Sbjct: 529  TQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQ 588

Query: 640  XXXXXXXXXXXXXXYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRY 699
                          Y + PVRPEIDLD                N +L EE +FF+KAK++
Sbjct: 589  QQQEQELLEQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKF 648

Query: 700  IGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIEN 759
            I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+GS+KELF WF+NFVGYQ   K IEN
Sbjct: 649  INNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIEN 708

Query: 760  VVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF 819
            +VHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF
Sbjct: 709  IVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF 768

Query: 820  IAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGL 879
            IAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LE IVNKI NM+E EK NFKL PGL
Sbjct: 769  IAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGL 828

Query: 880  GHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKV 939
            GHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ AP+VLKRLKQKDEEWRRAQREWNKV
Sbjct: 829  GHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKV 888

Query: 940  WRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQL 999
            WRELEQKVYFKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NK+IHWLTPKPKSQL
Sbjct: 889  WRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQL 948

Query: 1000 DFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEAL-- 1057
            +FD  D +I +DIL L+++FI H++ YS  DKERL D L  FISLFFS+PL +I  AL  
Sbjct: 949  NFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDK 1008

Query: 1058 -QSYKQNLXXXXXXXXXXXXTPRKRPYQQ-EMSLLDILHRSKYQKLKRSNDEDGKVPQLS 1115
              + K +               +KR     E+S+ DILHR+KYQK+K SN   G   Q  
Sbjct: 1009 RNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSN--RGSDSQEE 1066

Query: 1116 EPLDXXXXXXXXXXXXXXX------XKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIY 1169
              +D                      K PWL G+++++ N+QGII +R  FNLFAN+NIY
Sbjct: 1067 NNIDTIIDEESDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIY 1126

Query: 1170 IFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYK 1229
            +F RHWTT+YERLLE+K+MN +VTKEI+ R  V FA+DL L+S+QL  MGLDF  +D+Y+
Sbjct: 1127 VFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYE 1186

Query: 1230 QVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEI 1289
            ++L+LS+RLI  ++EHQWFEE LRQAYNN+AFKLYT+DKV+Q LVKH HTLMTD KT E+
Sbjct: 1187 ELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEV 1246

Query: 1290 MALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLK 1349
            M LF KDR +S TSAKDQI+YRLQARS+MSNTE MFR+E+++ + ++ +QYIALDDLTLK
Sbjct: 1247 MKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLK 1306

Query: 1350 EPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQ-----DTDGREVDEKFS 1404
            E   +E+KWKYYVTSY+LPHPTEGI HE L+IPFL++++E+ Q     + +  + + K+S
Sbjct: 1307 EGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYS 1366

Query: 1405 PEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISK 1464
            PEG+S S  KIKI P  Y L I++GS+D+F+RK+ NKYP   N+D     + KK  +++ 
Sbjct: 1367 PEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNT 1426

Query: 1465 FLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKA 1498
            FL++    +  L   K+LS+++     + A T+ 
Sbjct: 1427 FLESNNGWKKHLK--KQLSLKKNESEPESAETRT 1458

 Score =  299 bits (765), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 186/262 (70%), Gaps = 29/262 (11%)

Query: 62  DEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLF 121
           ++D  YRPLNVKDALSYLEQVK QFNSRPDIYN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264

Query: 122 RGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSS 181
           RGYP LIQGFNTFLP GYRI+C +NP+DPI+VTTP+G++T++       R+    Q+  +
Sbjct: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQA 324

Query: 182 LPEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPIPQSQP 241
           L +   + + Q   +P+                          G  S +       QS  
Sbjct: 325 LSQ---NNMMQQAQIPI--------------------------GSISNNANLNAAVQSVD 355

Query: 242 LTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 301
             A++  KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQV
Sbjct: 356 DQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQV 415

Query: 302 THLFQNAPDLLEDFKKFLPDSS 323
           T LFQNAPDLL+DFKKFLPDSS
Sbjct: 416 TILFQNAPDLLDDFKKFLPDSS 437

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1133 bits (2931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/982 (58%), Positives = 707/982 (71%), Gaps = 40/982 (4%)

Query: 545  LYPASNYYSHSTNGGIPQ--QNLPPIGSFSPPTNGSTT---HEGFQDQQHMQPPHLMPLP 599
            +Y  +N Y  +  G IP   QNLPP+G+FSPP+NG+      E   + QH    H+M LP
Sbjct: 453  MYGVNNGYYQA--GKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH----HMMALP 506

Query: 600  SMVQQGPNMVHQ--------GIVNENIPLSDLRTSLTDQ-----YAPSNFXXXXXXXXXX 646
            SM+Q  P    Q         + NE IP+SDLR+ + D      Y P             
Sbjct: 507  SMLQ-APTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQ 565

Query: 647  XXXX----------XXXYG-DVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEK 695
                             Y  +  VRPEIDLD               +++SL EE  FF+K
Sbjct: 566  QQQQQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDK 625

Query: 696  AKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIK 755
            AK++IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFVG+Q+K K
Sbjct: 626  AKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPK 685

Query: 756  SIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 815
             IENVVHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASE
Sbjct: 686  HIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASE 745

Query: 816  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKL 875
            DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKL
Sbjct: 746  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKL 805

Query: 876  PPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQRE 935
            P GLGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+EWRRAQRE
Sbjct: 806  PIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQRE 865

Query: 936  WNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKP 995
            WNKVWRELEQKV+FKSLDHLGLTFKQ+DKKLLTTKQL++EISSIKVDQTNK+IHWLTPKP
Sbjct: 866  WNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKP 925

Query: 996  KSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEE 1055
            KSQLD++  DK + +DIL LAD FI HT++YSNPDKERL+D L  +I LFFSIP+ +I++
Sbjct: 926  KSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKD 985

Query: 1056 ALQSYKQNLXXX-XXXXXXXXXTPRKRPYQQEMSLLDILHRSKYQKLKRSNDEDGKVPQL 1114
            A+++   N                 KRP   E+ L DIL+RS+YQ+LK S D        
Sbjct: 986  AVEAAIDNGKQLDENEQNSSKKNSNKRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGA 1045

Query: 1115 SEPLDXXXXXXXXXXXXXXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRH 1174
              P                  K PWL G+LVEEANSQG+IQNR I+N+FAN N+Y+F R+
Sbjct: 1046 VSP--GQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRN 1103

Query: 1175 WTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKL 1234
              TIY+RL E+K +N+ VTKEI+ R +V FAKDL+L+S+QL  MGLDF+G D+Y Q+L L
Sbjct: 1104 LITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLL 1163

Query: 1235 SRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFV 1294
            S+RLI G+LEHQWFEE LRQAY N+AFKLYTIDKVIQ LVKHAH +MTD+K++++MALF 
Sbjct: 1164 SKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFE 1223

Query: 1295 KDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRAD 1354
            KDR +S+T++KDQI+YRLQ RS+MS TE+MFR+E++ +   +S+QYIALDDLTL+EP+  
Sbjct: 1224 KDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTL 1283

Query: 1355 EDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQ-DTDGREVDEKFSPEGLSVSTL 1413
            EDKWKYY+TSY+L HPTEGI  E++KIPFL+++IE  Q   +  + + K+SPEG+S S L
Sbjct: 1284 EDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNL 1343

Query: 1414 KIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLR 1473
             IKI P TY+L +E GS+D+F+RK+ NK+P     + +K     +      FL+     +
Sbjct: 1344 MIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWK 1403

Query: 1474 NDLNETKKLSMQEKLDSLKGAT 1495
              L+      +++K + LK  T
Sbjct: 1404 RQLSSDAISKIEQKFNDLKNGT 1425

 Score =  187 bits (476), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/99 (85%), Positives = 92/99 (92%)

Query: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126
           YRPLNVKDAL+YLEQVK QFNSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN 165
           LIQGFNTFLPQGY IECS+NPDDPI+VTTP+G+  V N+
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219

 Score =  142 bits (359), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%)

Query: 248 VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 307
           ++K  DVEFSQA+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 355 IEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414

Query: 308 APDLLEDFKKFLPDSSASA 326
           APDLL+DFKKFLPDSS S 
Sbjct: 415 APDLLDDFKKFLPDSSPSV 433

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188

Query: 319 LP 320
           LP
Sbjct: 189 LP 190

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 68  RPLNVK--DALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYP 125
           +P +V+   A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P
Sbjct: 357 KPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAP 416

Query: 126 ILIQGFNTFLP 136
            L+  F  FLP
Sbjct: 417 DLLDDFKKFLP 427

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/963 (59%), Positives = 697/963 (72%), Gaps = 59/963 (6%)

Query: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMV- 602
            + YP +NYY    NG   QQNLPPIGSF+PP NG+ + E     Q + P  L   PSM+ 
Sbjct: 457  YGYP-NNYYP---NGTGTQQNLPPIGSFAPP-NGTASREYAPGNQFVGPGGL---PSMIP 508

Query: 603  -------QQGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXX-------XXXXX 648
                   QQ P +VH G  NE IP+S+LR+ LTDQ  P+                     
Sbjct: 509  NDQALQQQQQPGLVH-GYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAP 567

Query: 649  XXXXXYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTE 708
                   + P+RPEIDLD                N+SL EE  FFEKAK++IG K +YTE
Sbjct: 568  MAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTE 627

Query: 709  FLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLD 768
            FLKILNLYSQD+L  D+L  KV++YLGSN+ELF+WFKNFVG+QEK   IEN+VHEKH+LD
Sbjct: 628  FLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLD 687

Query: 769  LDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE 828
            LDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE
Sbjct: 688  LDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE 747

Query: 829  ETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYK 888
            E+LFK EEERHEYDF IESNLRTIQ LETI NKI NMT  EK NFKLPPGLGHTS TIYK
Sbjct: 748  ESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYK 807

Query: 889  KVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 948
            KVIRKVYDK+RGFEIID LHE PA+T PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY
Sbjct: 808  KVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 867

Query: 949  FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDI 1008
            +KSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK+IHWLTPKPKSQL+F F D DI
Sbjct: 868  YKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDI 927

Query: 1009 FYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXX 1068
            F DIL L   FI H++ YSNP+KER+KD L  F+SLFFSIPL+K+ EAL      L    
Sbjct: 928  FVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKE 987

Query: 1069 XXXXXXXXT-------------PRKRPYQQEMSLLDILHRSKYQKLKR----SNDEDGK- 1110
                                   +KRP   ++ L DIL + KYQK+++    SN+E+ + 
Sbjct: 988  KKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQE 1047

Query: 1111 ------VPQLSEPLDXXXXXXXXXXXXXXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFA 1164
                  V   +E L+                K PWL GN++E A++ G I NR +FN+FA
Sbjct: 1048 EDDENIVGDSNEELN----EQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFA 1103

Query: 1165 NSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNG 1224
            N+NIY+FFR WT IYERL E+KQ+NEKVTKE++ R +  FAKDL+L+S+QL +MGLDF G
Sbjct: 1104 NTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVG 1163

Query: 1225 EDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDA 1284
             ++Y+++L LS+RLI  ++EHQWFEE LRQA+NNKAFKLYT+DKVIQ LVKHAHT++ D 
Sbjct: 1164 VNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDV 1223

Query: 1285 KTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALD 1344
            KT+EIM LF KDR  S+TSAK+QI+YRLQ R++M+NTENMFR+EF+    HV +QYIAL+
Sbjct: 1224 KTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALE 1283

Query: 1345 DLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQDTDGREVDEKFS 1404
            DLT+K+P++ E  W+YYVTSY+LPHPTEG+  ++LKIPFLE+ +E   D +G   D K S
Sbjct: 1284 DLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEG---DNKSS 1340

Query: 1405 PEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISK 1464
            PEG+S S LKIKI P +Y L IE GS+D+F+RK+ N YPT +++   ++ + + T    K
Sbjct: 1341 PEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQMT----K 1396

Query: 1465 FLD 1467
            FLD
Sbjct: 1397 FLD 1399

 Score =  305 bits (782), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 161/265 (60%), Positives = 186/265 (70%), Gaps = 36/265 (13%)

Query: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122
           +D  YRPLNVKDALSYLEQVK+QF+ RPDIYN FLDIMKDFKSQ+IDTPGVIERVS LFR
Sbjct: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

Query: 123 GYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSL 182
           GYP+L+QGFNTFLPQGYRIEC+T+PD PIRVTTPMGT+T++   +  A S+ E    S+L
Sbjct: 263 GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSE----SNL 318

Query: 183 PEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPIPQSQPL 242
            +       Q H  P +PS                             QPE         
Sbjct: 319 QQQ------QHHQSPTIPS--------------LAASTFQESNFQQTPQPE--------- 349

Query: 243 TAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 302
              +   KN +VEFSQAI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY+QVT
Sbjct: 350 ---DQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVT 406

Query: 303 HLFQNAPDLLEDFKKFLPDSSASAN 327
            LFQ+APDLL+DFKKFLP+SS + +
Sbjct: 407 VLFQHAPDLLDDFKKFLPESSGTTS 431

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 44  VSNVYADTKDEINAENT---NDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIM 100
           + ++ A T  E N + T    D+      +    A++Y+ ++K +F  +PDIY  FL+I+
Sbjct: 329 IPSLAASTFQESNFQQTPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEIL 388

Query: 101 KDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 138
           + ++ +      V  +V+ LF+  P L+  F  FLP+ 
Sbjct: 389 QTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPES 426

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/962 (58%), Positives = 693/962 (72%), Gaps = 52/962 (5%)

Query: 561  PQQNLPPIGSFSPPTNGSTTHEG----FQDQQHMQPPHLMPLPSMV----QQGPNMVHQG 612
            PQ NLPPIGSFSPP NG     G      D+QH+    +  +P+M     Q  P+M++  
Sbjct: 490  PQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHV----VAGVPAMAPHEQQHAPSMIN-- 543

Query: 613  IVNENIPLSDLRTSLT----DQY---APSNFXXXXXXXXXXXXXXXXXY----------- 654
              N+ I +S++R   T    +QY   +P ++                             
Sbjct: 544  --NDGIQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQY 601

Query: 655  --GDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKI 712
              GD+ VRPEIDLD               +N+SL+EE +FFEK K+ IGN+ +Y EFLK+
Sbjct: 602  GSGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKV 661

Query: 713  LNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLC 772
            LNL+SQD++ +D+LV KV+ YL    ELF WFKNFVGYQ+K K IENV+HEKHRLDLDLC
Sbjct: 662  LNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLC 721

Query: 773  EAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 832
            EA+GPSYK+LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF
Sbjct: 722  EAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 781

Query: 833  KIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIR 892
            KIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLPPGLGHTS+TIYKK+IR
Sbjct: 782  KIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIR 841

Query: 893  KVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSL 952
            KVYDKERGFEIID LHEHPA+T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSL
Sbjct: 842  KVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSL 901

Query: 953  DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDI 1012
            DHLGLTFKQADKKLLTTKQLISEISSIKVDQ NK++HWLTPKPK QLD+ F D DI +DI
Sbjct: 902  DHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDI 961

Query: 1013 LYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXX 1072
            + L D F+ H + YSNPDKERLKDL   FISLFF IP + I  AL + K +         
Sbjct: 962  VGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDT-KSDEGKSTDTKF 1020

Query: 1073 XXXXTPRKRPYQQ-EMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXX 1131
                  +KRP    E+SL DILHR+KYQKLK     +G+   +SE  D            
Sbjct: 1021 EKADDSKKRPRPDVELSLSDILHRAKYQKLK-----NGEGLGMSEDDDEEKLAKEAEEMS 1075

Query: 1132 XXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEK 1191
                  PWL G++VE ANS G++ +R ++NLF N+N+YIF RHW+T+Y RLLE+KQM+E+
Sbjct: 1076 EKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDER 1135

Query: 1192 VTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEG 1251
            VTKEI+ R +V FA+DL+LLS+QL +MGLDF+G++AY++ LKLS+RLI  ELEHQWFEE 
Sbjct: 1136 VTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEES 1195

Query: 1252 LRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYR 1311
            LRQAYNNKAFKLYT+DKV+  LVKHAHTLMTD K++E+M LF KDR  S+T  KDQI+YR
Sbjct: 1196 LRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYR 1255

Query: 1312 LQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPT 1371
            L  RS+MS+TENMFR+++++   HVS+QYI LDD+TL++ + D ++W YY+TSYALPHPT
Sbjct: 1256 LLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPT 1315

Query: 1372 EGISHEKLKIPFLERLIEYGQDT-DGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGS 1430
            EGI  +KL +PFLER++E+  D  D     ++++P G S S LKI I P TYKL I+ GS
Sbjct: 1316 EGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGS 1375

Query: 1431 YDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNE--------TKKL 1482
            YD+F+R + N+YP   +   + +MV K+     KFLD     + DL++        TKK+
Sbjct: 1376 YDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKI 1435

Query: 1483 SM 1484
            ++
Sbjct: 1436 AL 1437

 Score =  305 bits (782), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 168/266 (63%), Positives = 186/266 (69%), Gaps = 26/266 (9%)

Query: 64  DPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 123
           D  YRPLNVKDALSYLEQVK QFNSRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 124 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSLP 183
           +P LIQGFNTFLPQGYRIECS+NP++PI+VTTPMG   V  NV     +A +      LP
Sbjct: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENVRGSDITADQQPAIGQLP 331

Query: 184 EADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPIPQSQPLT 243
                  P   ++P   S   H                    LPS       + QS  + 
Sbjct: 332 TTQS---PIQASLPPPQSAHLH--------------------LPSTVAAATTVQQSANVH 368

Query: 244 AQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 303
           A+ + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYAQVT 
Sbjct: 369 AENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTV 428

Query: 304 LFQNAPDLLEDFKKFLPDSSASANEQ 329
           LF NAPDLL+DFKKFLPDSSAS  +Q
Sbjct: 429 LFHNAPDLLDDFKKFLPDSSASNEQQ 454

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 67/156 (42%), Gaps = 31/156 (19%)

Query: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKF 443

Query: 135 LPQG------------YRIECSTNPDD-------------PIRVTTPMGTTTVNNNVSPP 169
           LP              Y  +  +  D              P +V  P        + SPP
Sbjct: 444 LPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSNLPPIGSFSPP 503

Query: 170 ARSALEPQEPSSLPEADGSTIPQSHNVPMVPSNVYH 205
           A + + P   +++P AD     + H V  VP+   H
Sbjct: 504 A-NGVAPTTGTAIPHAD-----EQHVVAGVPAMAPH 533

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 253 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 312
           ++  S+  S+  K+K    ++  IY  FL++L  + ++   ++E+  +V +     P+L 
Sbjct: 632 NLSLSEETSFFEKVKKNIGNR-QIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELF 690

Query: 313 EDFKKFL 319
           E FK F+
Sbjct: 691 EWFKNFV 697

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1088 bits (2815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/947 (58%), Positives = 690/947 (72%), Gaps = 50/947 (5%)

Query: 564  NLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSM-VQQG--PNMVHQGIVNENIPL 620
            NLPP+GSFS P           D   M  P L+  P+M + QG   +++ QG+ N+ IP+
Sbjct: 488  NLPPLGSFSTPG----------DHHPMNLP-LVQAPNMNLNQGHPAHIITQGMSNQKIPI 536

Query: 621  SDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPVRPEIDLDXXXXXXXXXXXXXX 680
            SDLRT+    Y P+ +                 Y +   RPEIDLD              
Sbjct: 537  SDLRTTADTSYRPAEYSQGQDTQ----------YMETNARPEIDLDPSLVPVIPEPIKPL 586

Query: 681  XDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKEL 740
             D ++L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  YL    EL
Sbjct: 587  EDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPEL 646

Query: 741  FSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWE 800
            F WFK+FVGYQEK K IEN+VHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCWE
Sbjct: 647  FDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWE 706

Query: 801  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVN 860
            VLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI N
Sbjct: 707  VLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIAN 766

Query: 861  KIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLK 920
            KI NMT  EKA FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+T P+VLK
Sbjct: 767  KIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLK 826

Query: 921  RLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIK 980
            RLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIK
Sbjct: 827  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIK 886

Query: 981  VDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNY 1040
            VDQ NK+IH LTPK KSQLD DF D ++FYDIL LA  F+ +   YS PDKERLKD    
Sbjct: 887  VDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKG 946

Query: 1041 FISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXT-------------PRKRPYQQEM 1087
            FISLF S P+ +IE+AL   K++             T             P+KR  +   
Sbjct: 947  FISLFCSYPVPQIEKALA--KRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSD 1004

Query: 1088 SLL-DILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXX-XXXXXKNPWLTGNLV 1145
             LL D+L R+K QK  R++      P+    +                  KNPWL G++V
Sbjct: 1005 RLLRDVLFRNKQQKGGRNS------PRGDSSISAEKESDMEEEEIIRQEAKNPWLLGSIV 1058

Query: 1146 EEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFA 1205
            +EA++ G ++NR  FNLFAN+NIY+FFRH  TIYERL+E+K+MN++VTKEI+ R +V FA
Sbjct: 1059 DEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFA 1118

Query: 1206 KDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYT 1265
            KDL+L+S+QL++MGLDF GEDAY+++L+LSR LI G+LEHQWFEE LRQAY NKAFK+YT
Sbjct: 1119 KDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYT 1178

Query: 1266 IDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMF 1325
            +DKVIQ LVKHAH ++TD KT EIM LF KDR + +TS KDQI+YRLQ RS MSN ENMF
Sbjct: 1179 VDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMF 1238

Query: 1326 RMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLE 1385
            R+E++R   HV +Q++A+DDLTL+EP++ +DKW+YY+TSY+L HPTEGISH+ L+ PFLE
Sbjct: 1239 RIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLE 1298

Query: 1386 RLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTV 1445
            ++IE  +D    + DEK+SPEG++ S LK+KI P+TY + +E GS+D+F+RKA NK+P  
Sbjct: 1299 KIIESEEDIIEDK-DEKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVR 1357

Query: 1446 ANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLK 1492
               DI K+   +    + +FL++    + DL+  +   ++++L+ +K
Sbjct: 1358 V--DIRKKKSSELKLELERFLNSNSGWKKDLSAKQIAEVEKRLEFVK 1402

 Score =  186 bits (471), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (95%)

Query: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126
           YRPLNVKDALSYLEQVKFQFNSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219

Query: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTT 160
           LIQGFNTFLPQGY IECS++P+DPI+VTTP GTT
Sbjct: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTT 253

 Score =  146 bits (368), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/95 (78%), Positives = 79/95 (83%), Gaps = 1/95 (1%)

Query: 236 IPQSQPLTA-QEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 294
           +PQ QP        KK  DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI
Sbjct: 333 MPQRQPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 392

Query: 295 NEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANEQ 329
           NEVYAQVT LFQNAPDLL+DFKKFLPD+SA   +Q
Sbjct: 393 NEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQAQQ 427

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L++ F  F
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227

Query: 319 LP 320
           LP
Sbjct: 228 LP 229

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 135 LP 136
           LP
Sbjct: 417 LP 418

 Score = 33.9 bits (76), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 13/98 (13%)

Query: 54  EINAENTNDEDPDYRPL------NVKDALSYLEQVKF-----QFNSRPDIYNLFLDIMKD 102
           E NA    D DP   P+       ++D L+ +E+  F     ++     IY  FL I+  
Sbjct: 562 ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNL 621

Query: 103 FKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR 140
           +    +D   ++E+V     G P L   F +F+  GY+
Sbjct: 622 YSQDLLDKERLVEKVGHYLSGCPELFDWFKSFV--GYQ 657

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/951 (56%), Positives = 670/951 (70%), Gaps = 52/951 (5%)

Query: 565  LPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQQGPNMVHQGI----------- 613
            LPPIGSFSPPTNG    +  Q         +M LPSM+     +  Q I           
Sbjct: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529

Query: 614  ---------------VNENIPLSDLRTSLTDQ-YAPSNFXXXXXXXXXXXXXXXXXYGDV 657
                            N++IP+S+LRT++ +Q Y P                    Y   
Sbjct: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGG--YVGT 587

Query: 658  P----VRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 713
            P    VRPEIDLD               ++++L EE  FFE+ K+ IGNK +Y EFLKIL
Sbjct: 588  PSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKIL 647

Query: 714  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCE 773
            NL+S D+L +D+LV+KV++Y+G+NKELF WFK FVGYQ+K K IEN+VHEKH+LDLDLCE
Sbjct: 648  NLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCE 707

Query: 774  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 833
            A+GPSYK+LPK+DTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 708  AYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 767

Query: 834  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRK 893
            IEEERHEYD+YIESNLRTIQ LETI NKI NMT+ EKA F+LPPGLGHTSMTIYKKVIRK
Sbjct: 768  IEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRK 827

Query: 894  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 953
            VYDKERGFEIIDALH +PA++ P++L+RLKQKDEEWRRAQREWNK+WR+LEQKVYFKSLD
Sbjct: 828  VYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887

Query: 954  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDIL 1013
            HLGLTFKQADKKLLTTKQLISEI+ IKVDQ +K+IHWLTPKPK+QLD+DFPD DI +DI+
Sbjct: 888  HLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDII 947

Query: 1014 YLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQ--------------- 1058
             L   F  +T  YSNPDKER+KD+L  F+S FFSIPL+++ +AL+               
Sbjct: 948  ALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKG 1007

Query: 1059 -SYKQNLXXXXXXXXXXXXTPRKRPYQQEMSLLDILHRSKYQKLKRSNDEDG-KVPQLSE 1116
                  +            + +KRP+  ++++ DILH++K QK K + + DG K P    
Sbjct: 1008 SGKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDL 1067

Query: 1117 PLDXXXXXXXXXXXXXXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWT 1176
              D                K  WL G++V+ AN +  + NRNI+NLFAN+NIYIFFRH  
Sbjct: 1068 GTDRNVGTIEDSGSLSEHRKQ-WLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126

Query: 1177 TIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSR 1236
            T+YERL E+KQ+N+++ KEI  R + TFAKDL L+S+QLSE+GLDFN  DAY+Q+L LS+
Sbjct: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186

Query: 1237 RLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKD 1296
            RLI G++EHQWFEE +RQAYNN+AFKLYTIDKV+Q  VKHAHTL++D+KT+EIM LF   
Sbjct: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246

Query: 1297 RNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADED 1356
            RN + T+ KDQI+YR+Q RS+MS+TENMFR+E+ R   H S+QYIALDDLTLK  ++ E+
Sbjct: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306

Query: 1357 KWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQD-TDGREVDEKFSPEGLSVSTLKI 1415
             W YYVTSY+L +PTEG+ HE L++PFLE++IE+ Q+ +     +  +S  G+S S L I
Sbjct: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHI 1366

Query: 1416 KIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFL 1466
             I    Y L ++ GS DV++R    KYP VA+D+     + +KT  I K L
Sbjct: 1367 DIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVL 1417

 Score =  313 bits (802), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 170/275 (61%), Positives = 190/275 (69%), Gaps = 50/275 (18%)

Query: 64  DP-DYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122
           DP  YRPLNVKDALSYLEQVKFQF++RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+
Sbjct: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 123 GYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSL 182
           GYP LIQGFNTFLPQGYRIECS NP+DPI+VTTPMG++T   N +P        + PS  
Sbjct: 241 GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAP-------QKSPS-- 291

Query: 183 PEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPIPQSQPL 242
                            PS++                        +I Q      Q+ P+
Sbjct: 292 -----------------PSDIQTNNQQTQ----------------AIAQEAQLQSQATPI 318

Query: 243 TAQEDV-------KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 295
             Q DV       KK  DVEFSQAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+
Sbjct: 319 PTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIH 378

Query: 296 EVYAQVTHLFQNAPDLLEDFKKFLPDSSASANEQV 330
           EVYAQVT LFQNAPDLL+DFKKFLPDSSAS +E+ 
Sbjct: 379 EVYAQVTILFQNAPDLLDDFKKFLPDSSASGSEET 413

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 82/200 (41%), Gaps = 11/200 (5%)

Query: 126 ILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSL-PE 184
           I++  F++   +  RI+ S NP  P  +TT   T     +V     S   P  P++  PE
Sbjct: 61  IILPSFSSLKTEDNRIDTSMNPIGPKSITTSSSTPA---SVGFSVASLDNPLPPATKKPE 117

Query: 185 ADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPIPQS----Q 240
                +PQ    P + +                       G  S    E    QS     
Sbjct: 118 IKLHPLPQQQQ-PRIYTQQQPQQQQILQQDQQEILQNQRQG--STGASETSTTQSPLVSG 174

Query: 241 PLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 300
           P   Q D      +    A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +
Sbjct: 175 PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIER 234

Query: 301 VTHLFQNAPDLLEDFKKFLP 320
           V+ LF+  P+L++ F  FLP
Sbjct: 235 VSSLFKGYPNLIQGFNTFLP 254

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/967 (56%), Positives = 684/967 (70%), Gaps = 60/967 (6%)

Query: 562  QQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQQGPN----------MVHQ 611
            QQNLPP+G+FS P +                 H M LPS+  QGPN          +V Q
Sbjct: 392  QQNLPPLGNFSTPGDH----------------HPMSLPSV--QGPNVGLSQGQSGHIVTQ 433

Query: 612  GIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPVRPEIDLDXXXXX 671
            G+ N++IP+SDLR +    +  S +                 Y +  VRPEIDLD     
Sbjct: 434  GVSNQHIPVSDLRGAPDASFRASEYNQVQDVQ----------YMEPTVRPEIDLDPSLVP 483

Query: 672  XXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVD 731
                      D ++L EE TFF+KAK++IGNK +YTEFLKILNLYSQD+L+ + LVE V 
Sbjct: 484  VIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVS 543

Query: 732  FYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPC 791
             YL  + ELF WFK+FVGYQE+ K IENV+HEKHRLDLDLCEA GPSYKRLPK+DTFMPC
Sbjct: 544  HYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPC 603

Query: 792  SGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRT 851
            SGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRT
Sbjct: 604  SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRT 663

Query: 852  IQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHP 911
            IQ LETI NKI NMT  EKA FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHEHP
Sbjct: 664  IQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHP 723

Query: 912  AVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQ 971
            A+T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQ
Sbjct: 724  AITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQ 783

Query: 972  LISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDK 1031
            LISEISSIKVDQ+NK+IH LTPK KSQL +DF + ++F DIL L   F+A+   YS  D 
Sbjct: 784  LISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDN 843

Query: 1032 ERLKDLLNYFISLFFSIPLEKIEEALQ---------SYKQNLXXXXXXXXXXXXTPRKRP 1082
            ERLKD    FISLFFS PL +IEE L          S+  +             + RKR 
Sbjct: 844  ERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRV 903

Query: 1083 YQQEMSLL-DILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLT 1141
                  LL DIL+R+K QK+ +    D    +  +  D                K PWL 
Sbjct: 904  RDDTEHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESD-----IEEKEIVRQEAKKPWLL 958

Query: 1142 GNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSM 1201
            G++V+EA++ G + +R  FN+FAN+NIY+FFRH TT+YERL+E+K++N +VTKEIS R +
Sbjct: 959  GSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKV 1018

Query: 1202 VTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAF 1261
            V FAKDL+L+S+QL++MGLDF G DAY+++L+LSR LI+GELEHQWFEE LRQAY NKAF
Sbjct: 1019 VQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAF 1078

Query: 1262 KLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNT 1321
            KLYTIDKVIQ LVKHAHT++ D KT EIM LF  DR +++TS KDQI+YRLQ RS MSN 
Sbjct: 1079 KLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNI 1138

Query: 1322 ENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKI 1381
            ENMFR+E++    H S+Q++A++DLTL EP++  DKW+YY+TSY+L HPTEGISH+ L+ 
Sbjct: 1139 ENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRT 1198

Query: 1382 PFLERLIEY--GQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAA 1439
            PFLE++IE   G   DG   DE++SPEG++ S +K+KI P+TY + +E G +D+F+RK+ 
Sbjct: 1199 PFLEKIIERDEGYIDDG---DERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSV 1255

Query: 1440 NKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKAD 1499
            NK+PT    D+ K+   +   ++  FL+     +  L   +    + +L+ +K   T  D
Sbjct: 1256 NKFPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDD 1313

Query: 1500 VDDKITV 1506
              ++I+ 
Sbjct: 1314 YAEEIST 1320

 Score =  298 bits (763), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/268 (61%), Positives = 179/268 (66%), Gaps = 52/268 (19%)

Query: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188

Query: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGT------TTVNNNVSPPARSALEPQEPS 180
           LIQGFNTFLP GY IEC ++P+DPI+VTTP GT      T    N +  A +  EP+   
Sbjct: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITGAGGNHAHGANT--EPR--- 243

Query: 181 SLPEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPIPQSQ 240
                    +  + NVP     VY                              P   + 
Sbjct: 244 ---------LQSTQNVP----TVYRSAEGS------------------------PAAIAT 266

Query: 241 PLTAQEDV----KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 296
           P T QE      KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINE
Sbjct: 267 PATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINE 326

Query: 297 VYAQVTHLFQNAPDLLEDFKKFLPDSSA 324
           VYAQVT LFQNAPDLL+DFKKFLPDSSA
Sbjct: 327 VYAQVTVLFQNAPDLLDDFKKFLPDSSA 354

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/278 (21%), Positives = 109/278 (39%), Gaps = 39/278 (14%)

Query: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 135 LPQGYRIECST--------------NPDDPIRVTTPMGTTTVNNNVSPPARSALEP--QE 178
           LP     +  +              +    ++   P     ++    PP  +   P    
Sbjct: 349 LPDSSAPQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHH 408

Query: 179 PSSLPEADGSTIPQS-----HNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIH--- 230
           P SLP   G  +  S     H V    SN +                     +  +    
Sbjct: 409 PMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQVQDVQYME 468

Query: 231 ---QPELPIPQS------QPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFL 281
              +PE+ +  S      +P+   ED     ++   +  ++ +K K +F     IY  FL
Sbjct: 469 PTVRPEIDLDPSLVPVIPEPIKPLED-----ELNLVEEATFFDKAK-KFIGNKQIYTEFL 522

Query: 282 EILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 319
           +IL  Y ++     ++   V+H    +P+L + FK F+
Sbjct: 523 KILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFV 560

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1081 bits (2796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/969 (57%), Positives = 700/969 (72%), Gaps = 32/969 (3%)

Query: 547  PASNYYSHSTNGGI------PQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPS 600
            P S       NGG       PQQNLPP+GSFSP  +  +  EG    +H+  P + P PS
Sbjct: 410  PQSTTTPAPVNGGTFYPQAAPQQNLPPLGSFSP-PSSGSAREG----EHVGLPAVQP-PS 463

Query: 601  MVQQGP---NMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDV 657
            M   G    +++ QG+ N++IP+S++R +    Y                      Y + 
Sbjct: 464  MDISGQPQQHIITQGMSNDDIPISEVRNTADGAY-----------RSDLRNSGEVQYMEP 512

Query: 658  PVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYS 717
              RPEIDLD               + +SL EE +FF+KAK++IGNK +YTEFLKILNLYS
Sbjct: 513  VARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYS 572

Query: 718  QDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGP 777
            QD+LD D+LVEKV++YLG NKELF WFKNFVGY++K K IEN+VHEKHRLDLDLCEA GP
Sbjct: 573  QDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGP 632

Query: 778  SYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEE 837
            SYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEE
Sbjct: 633  SYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEE 692

Query: 838  RHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDK 897
            RHEYDFYIE+NLRTIQ LETI NKI NMT  EKA FKL PGLGHTS+TIYKKVIRKVYDK
Sbjct: 693  RHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDK 752

Query: 898  ERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGL 957
            +RGFEIIDALHE P++  P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGL
Sbjct: 753  DRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGL 812

Query: 958  TFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLAD 1017
            TFKQADKKLLTTKQL+SEIS+IKVDQ NK+IH LTPKPKSQLD+ F D+++ YDIL LA 
Sbjct: 813  TFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAK 872

Query: 1018 SFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXT 1077
             FI   T YSNPDKE++ D L  F+ LFFS P+ ++E A    + ++             
Sbjct: 873  VFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQEN 932

Query: 1078 ---PRKRPYQQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXX 1134
                RKR  ++E  L D+L R+KYQK  R+  E+  +P+ SE  +               
Sbjct: 933  SDLSRKRTREEENLLKDVLRRNKYQK-GRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQE 991

Query: 1135 XKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTK 1194
             K PWL G++V+EAN  G ++NR  FN+FAN+NIY+FFRH  T+Y RL E+K +NE VT+
Sbjct: 992  AKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTE 1051

Query: 1195 EISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQ 1254
            EI  R +V FAKDL+L+S+QLS+MGLDF G DAY QVL LS+RLI G++EHQWFEE LRQ
Sbjct: 1052 EIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQ 1111

Query: 1255 AYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQA 1314
            AY NKAFK+YTIDKV+Q LVKHAHT++TD KT EIM LF KDR    TSAK+QI+YRLQ 
Sbjct: 1112 AYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQV 1171

Query: 1315 RSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGI 1374
            RS+M+  ENMFR+E++R++ H S+Q++A+DDLTL+EP++ ED+WKYYVTSY+L HPTEGI
Sbjct: 1172 RSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGI 1231

Query: 1375 SHEKLKIPFLERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVF 1434
            SHE+L+ PFLE+++E  ++      + ++SPEG+S S LK+KI P TY L ++ GSYD F
Sbjct: 1232 SHEELQPPFLEKILEKEEEFQCE--NGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFF 1289

Query: 1435 TRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGA 1494
            +RK+ NK+P   N+D +K    +K   ++ +L+ A   +  L  +K L  Q +++ +K  
Sbjct: 1290 SRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTK 1349

Query: 1495 TTKADVDDK 1503
             T   ++ K
Sbjct: 1350 GTLVGLESK 1358

 Score =  306 bits (785), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 171/268 (63%), Positives = 189/268 (70%), Gaps = 18/268 (6%)

Query: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122
           +DP YRPLNVKDALSYLEQVKFQFN+RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+
Sbjct: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 123 GYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTT-TVNNNVSPPARSALEPQEP 179
           GYP LIQGFNTFLPQGY+IECS+NP+D  PI+VTTP GTT +V  N +P     LE + P
Sbjct: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAP-----LEQRYP 268

Query: 180 SS---LPEADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPI 236
           S+   L   D   + Q H+V                                 H P+   
Sbjct: 269 SNENVLLSPDHLQLQQHHSVLQQEQQQPQPQPQQQPQPQTQTQTQTQTQTQQQHYPD--- 325

Query: 237 PQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 296
            Q Q   A    KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINE
Sbjct: 326 QQDQHYLA----KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINE 381

Query: 297 VYAQVTHLFQNAPDLLEDFKKFLPDSSA 324
           VYAQVT LFQNAPDLL+DFKKFLPD+SA
Sbjct: 382 VYAQVTVLFQNAPDLLDDFKKFLPDASA 409

 Score = 57.0 bits (136), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 106/262 (40%), Gaps = 19/262 (7%)

Query: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 135 LPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSP----------PARSALEPQEPSSLPE 184
           LP     + +T P  P+   T         N+ P           AR       P+  P 
Sbjct: 404 LPDASAPQSTTTP-APVNGGTFYPQAAPQQNLPPLGSFSPPSSGSAREGEHVGLPAVQPP 462

Query: 185 A-DGSTIPQSHNVPMVPSN-----VYHXXXXXXXXXXXXXXXXXXXGLPSIHQPELPI-P 237
           + D S  PQ H +    SN                            +  + +PE+ + P
Sbjct: 463 SMDISGQPQQHIITQGMSNDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVARPEIDLDP 522

Query: 238 QSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEV 297
              P+  +       +V   +  S+ +K K +F     IY  FL+IL  Y ++    +E+
Sbjct: 523 SLVPVIPEPIEPMENEVSLVEETSFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLDRDEL 581

Query: 298 YAQVTHLFQNAPDLLEDFKKFL 319
             +V +      +L + FK F+
Sbjct: 582 VEKVEYYLGGNKELFDWFKNFV 603

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1071 bits (2769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/829 (63%), Positives = 635/829 (76%), Gaps = 10/829 (1%)

Query: 656  DVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNL 715
            D+ VRPEIDLD               D++SL EE  FF+KAK++I NK +Y EFLKILNL
Sbjct: 619  DISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678

Query: 716  YSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAF 775
            YSQ+IL++++LVEKV +YLGSNKELF WFK FVGYQ+K K IEN+VHEKH+LDLDLCEA+
Sbjct: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738

Query: 776  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 835
            GPSYK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798

Query: 836  EERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVY 895
            EERHEYDFYIESNLRTIQ LETI +KI NMTE E+ANFKLP GLGHTS+TIY+KVIRKVY
Sbjct: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858

Query: 896  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 955
             KERGFE+IDALHE+PAV  P++LKRLKQKDEEWRRAQREWNKVWREL+QKVY+KSLDHL
Sbjct: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918

Query: 956  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYL 1015
            GLTFKQADKKLLTTKQLISEISSIKVDQTNKK+HWLTPKPKSQLD+   D+ I YDIL L
Sbjct: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978

Query: 1016 ADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQ---SYKQNLXXXXXXXX 1072
             D FI HT+ YSNPDKERL+D L  FISLFF IPL  I+ A++                 
Sbjct: 979  TDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPLDDTKTDSEESSG 1038

Query: 1073 XXXXTPRKRPYQ-QEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXX 1131
                 P+KR  +  ++S  DIL + KYQK+K+  D++      S  +             
Sbjct: 1039 DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNET---FSNDISSATSVDDDELIR 1095

Query: 1132 XXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEK 1191
                K PWL G++V++ANS GIIQNR+ +N+F N+NIY+F RH  T+YERL E KQMN +
Sbjct: 1096 QEAQK-PWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAE 1154

Query: 1192 VTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEG 1251
            VT+EI  RS+V FAKDL+L+S+QL  MGLDF G D+YKQ+L LS RLI G LEH WFEE 
Sbjct: 1155 VTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEES 1214

Query: 1252 LRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYR 1311
            LRQA+ NKAFKLYTIDKV Q +VKHAHT+M+D KTAEIM L  KDR+ +TTS+KDQI+YR
Sbjct: 1215 LRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYR 1274

Query: 1312 LQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPT 1371
            LQARS+MS T+NMFR+EF++ + ++S+QYI +DDLTL EP+  E+KWKYY+TSYAL HPT
Sbjct: 1275 LQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPT 1334

Query: 1372 EGISHEKLKIPFLERLIEYGQDTDGRE--VDEKFSPEGLSVSTLKIKIQPVTYKLHIESG 1429
            EG+  E+++IPFLE+++E  +     E  +++K+SP+G+S S LKIKI P  Y L IE G
Sbjct: 1335 EGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEPG 1394

Query: 1430 SYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNE 1478
            S+D F+R + NKYP     D +K         ++ FL+     +  L+E
Sbjct: 1395 SFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSE 1443

 Score =  275 bits (704), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 161/324 (49%), Positives = 193/324 (59%), Gaps = 49/324 (15%)

Query: 44  VSNVYADTKDEINAENTNDEDPD--YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMK 101
           V+  Y+ T     + N + E  +  YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMK
Sbjct: 117 VNTTYSATAGTTASANDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMK 176

Query: 102 DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTT------ 155
           DFKSQ+IDTPGVIERVSTLFRGYP LIQGFNTFLPQGY IEC+ NP+DPI+VTT      
Sbjct: 177 DFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSET 236

Query: 156 -----PMGTTTVNNNVSPPARSALEPQEPSSLPEADGSTIPQSHNVPMVPSNVYHXXXXX 210
                P+ +   N NV P   ++  P   ++           +  +P +  N        
Sbjct: 237 IPYAKPIPSAATNTNV-PGPTTSTSPPTAATTTGTTTPVAANTTAIPNITRN-------- 287

Query: 211 XXXXXXXXXXXXXXGLPSIHQPELPIPQSQPLTAQEDV---------------------- 248
                           PS+  P L  P    +T  E V                      
Sbjct: 288 --KETNAIENVATAAQPSL-LPNLGTPSHTEVTKSESVIQSSANAPIQPNMHNMTQDTMK 344

Query: 249 --KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQ 306
             +K  DVEFSQA+SYVNKIK RF D+PDIYK FLEILQTYQ+EQKPI+EVY+QVT LFQ
Sbjct: 345 ITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404

Query: 307 NAPDLLEDFKKFLPDSSASANEQV 330
           NAPDLL+DFKKFLPD++ SA  + 
Sbjct: 405 NAPDLLDDFKKFLPDNNNSAGAET 428

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/850 (61%), Positives = 642/850 (75%), Gaps = 14/850 (1%)

Query: 654  YGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 713
            Y +  VRPEIDLD               D + L EE  FF+K K+YIGNK +Y EFLK+L
Sbjct: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884

Query: 714  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCE 773
            NLYS D+L++D+LVEK+ +YL  N+ELFSWFKNFVGY EK K IEN+VHEKH+LDLDLCE
Sbjct: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944

Query: 774  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 833
            A GPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004

Query: 834  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRK 893
            ++++ HEYDFYIESNLRTIQ LETI +KI NMTENEK NFKLP GLGHT+ TIYKKVIRK
Sbjct: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064

Query: 894  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 953
            VYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLD
Sbjct: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124

Query: 954  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDIL 1013
            HLGLTFKQADKKLLTTKQLISEISSIKVDQT+K++HWLTPKPKSQLDF+ PDKDI +DIL
Sbjct: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184

Query: 1014 YLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQS---YKQNLXXXXXX 1070
               + F+ HT+ YSNP+KERL D + YF SLFFSIPLE+I+EA+      ++N       
Sbjct: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244

Query: 1071 XXXXXXTPRKRPYQQ-EMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXX 1129
                    +KR  +   +SL DIL R+KYQ+LK  +D D      +   D          
Sbjct: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD--QKLLEEEE 1302

Query: 1130 XXXXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMN 1189
                  K PWL G LVEEAN+QG I +RNIFN+F+N+N+YIF RH TT+YERL EIKQMN
Sbjct: 1303 LLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMN 1362

Query: 1190 EKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFE 1249
            +KV++EIS R +  FAKDL+L+S+QL+EMGLDF+  D Y+Q+L L +RLI G+LEHQWFE
Sbjct: 1363 DKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFE 1422

Query: 1250 EGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQII 1309
            E LRQA+NNKAFKLYT+DKV Q LVKHAHT+++D KT EIMALF KDR  ++TS+KDQI+
Sbjct: 1423 ESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQIL 1482

Query: 1310 YRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPH 1369
            YRLQ R+ M++ ENMFR+E++    H+ +QYIALDDLT+K+ +  E+KWKYY+TSYAL H
Sbjct: 1483 YRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSH 1542

Query: 1370 PTEGISHEKLKIPFLERLIEYGQDTDGREVDE--------KFSPEGLSVSTLKIKIQPVT 1421
            PTEGI  E ++IPFLER+IE  Q  +  E D+        K+SPEG+S STLKIKI P  
Sbjct: 1543 PTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQN 1602

Query: 1422 YKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKK 1481
            Y L+IE GS+D+F+RK+ N++P     D     + K    + KFL++ +  +  +++ + 
Sbjct: 1603 YCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQM 1662

Query: 1482 LSMQEKLDSL 1491
             S++ K D L
Sbjct: 1663 ESIESKWDHL 1672

 Score =  204 bits (519), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 144/336 (42%), Positives = 175/336 (52%), Gaps = 65/336 (19%)

Query: 56  NAENTNDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAI------- 108
           N +++  ED  YRPLNVKDALSYLEQVKFQFNSRPD+YN FLDIMKDFKSQAI       
Sbjct: 288 NTQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIA 347

Query: 109 -------DTPGVIERVSTLF-RGYPILIQG-----FNTFLPQG-------YRIECSTNPD 148
                  D P +I+  +T   +GY I              P G            + N +
Sbjct: 348 RVSSLFHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQN 407

Query: 149 DPIRVTTPMGTTTVN-NNVSPPARSALEPQEPSSLPEAD--------------GSTIPQS 193
             ++ + P  +TT + +NV     S      PS++ E                  + P S
Sbjct: 408 HQLQHSLPQPSTTASASNVDSKVSSISGIMGPSNITEQSQQQQRHHPQQLINVNDSAPIS 467

Query: 194 HNVP-MVPSNVYHXXXXXXXXXXXXXXXXXXXGLPSIHQPEL----PIPQ---------- 238
            ++   VPSNV                      LP+ + P+     PI            
Sbjct: 468 GSISSTVPSNV----EPTNMNAAANAAISAASALPNTNTPKSQTTPPIATAGTATQQFPM 523

Query: 239 ----SQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 294
               S PL    + ++  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPI
Sbjct: 524 VSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPI 583

Query: 295 NEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANEQV 330
           NEVY+QVT LFQ APDLLEDFKKFLPDSSA+ N  +
Sbjct: 584 NEVYSQVTVLFQEAPDLLEDFKKFLPDSSANNNGSI 619

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/918 (57%), Positives = 668/918 (72%), Gaps = 26/918 (2%)

Query: 554  HSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQQGPN-MVHQG 612
            + T  G PQ NLPP+GSFSPP NG        +   +QPP +      V   P+ +V Q 
Sbjct: 460  YQTQQGRPQ-NLPPLGSFSPPINGRENDPQL-NLPAVQPPAMEFASQQVPHHPSHVVPQV 517

Query: 613  IVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPVRPEIDLDXXXXXX 672
            I    +PLSDLR ++   +AP                    + +   RPEIDLD      
Sbjct: 518  IPGGTLPLSDLRGAMDGNFAPQPLQSQDVQ-----------FIEPTSRPEIDLDPSLVPV 566

Query: 673  XXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDF 732
                     ++++L EE +FF++AK+Y+GNK +YTEFLKILNL+SQD++  ++LV+KV+ 
Sbjct: 567  IPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEH 626

Query: 733  YLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCS 792
            YLG + ELF WFK+FV Y EK K IENV+HEKHRLDLDLCEA  PSYK+LPK+DTFMPCS
Sbjct: 627  YLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCS 686

Query: 793  GRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTI 852
            GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTI
Sbjct: 687  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTI 746

Query: 853  QCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPA 912
            Q LETI NKI NMT  EK  FKLPPGLGHTSMTIYKKVIRKVYDK+RGFEIIDALHE+PA
Sbjct: 747  QLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPA 806

Query: 913  VTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQL 972
            V+ P++LKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQL
Sbjct: 807  VSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQL 866

Query: 973  ISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKE 1032
            ISEISSIKVDQTNK+I+  TPKPKSQLD+D  DK + +DIL L ++FI H++ YSNPDKE
Sbjct: 867  ISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKE 926

Query: 1033 RLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXTPRKRPYQQEMSLLDI 1092
            +L      F+S+FFSI  ++IE +  +                  PRKR ++ E  L ++
Sbjct: 927  KLAAFFKGFLSVFFSISYQEIENSTPA---------DSDAVSNSNPRKRLWESEQPLKEL 977

Query: 1093 LH-RSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLTGNLVEEANSQ 1151
            L  + K+ K + ++ ED  +       +                K PWL GN+++EAN  
Sbjct: 978  LRSKHKHHKKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDH 1037

Query: 1152 GIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLL 1211
            G + NR IFNLFAN+N+Y+FFRH TT+Y+RL E+K MNE+VT+EI+ R++V FAKDL+L+
Sbjct: 1038 GYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLV 1097

Query: 1212 SSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQ 1271
            S+QLS+MGLDF G+DAY Q+L L +RLI  +++HQWFEE LRQAY NKAFK+YT+DKVIQ
Sbjct: 1098 STQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQ 1157

Query: 1272 LLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDR 1331
             LVKHAH+++TDAK+AEIM LF KDR  + TS K+QI+YRLQ RSYM  TENMFR+E ++
Sbjct: 1158 SLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINK 1217

Query: 1332 RNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYG 1391
             + HV +QY+A+DDLTLKEP + +D+W YY+TSYAL HPTEGI HE++K+PFLE+ ++  
Sbjct: 1218 DSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDD 1277

Query: 1392 QDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIH 1451
            ++ D  E  E+ SP G S+S L+I++ P +Y+L IE GS D+FTR A N++   + ++ +
Sbjct: 1278 EEAD--EGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSN 1335

Query: 1452 KEMVVKKTGLISKFLDNA 1469
             ++  +K   +   LD +
Sbjct: 1336 TDLKEEKRKTLMSQLDGS 1353

 Score =  286 bits (732), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 154/277 (55%), Positives = 183/277 (66%), Gaps = 23/277 (8%)

Query: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122
           +DP YRPLN KDALSYLEQVKFQFN+RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

Query: 123 GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTTTVNNNVSPPARSALEPQEPS 180
           GYPILIQG NTFLPQGY+IEC+ NP+DP  I+VTTP       N  +    + +    PS
Sbjct: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPS 257

Query: 181 SLPEAD-----------GSTIPQSHNVPM-VPSNVYHXXXXXXXXXXXXXXXXXXXGLPS 228
            +P  D            +  P+  N P  +P                         +P 
Sbjct: 258 LMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNQNLPQHEQQNQQHGSQSPAMPQ 317

Query: 229 IHQPELPIPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQ 288
             + +     ++P         + DVEFS AISYVNKIKTRFADQP+IYKHFLEILQTYQ
Sbjct: 318 QQRQDQQFMGNRP---------SGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQ 368

Query: 289 REQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 325
           REQKPI+EVYAQVT LFQNAPDLL+DFKKFLPD++A+
Sbjct: 369 REQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAA 405

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/814 (63%), Positives = 620/814 (76%), Gaps = 22/814 (2%)

Query: 655  GDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILN 714
             + P RPEIDLD               +NI+L EE +FFEK K++I +K +Y EFLK+LN
Sbjct: 712  SEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLN 771

Query: 715  LYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEA 774
            LYSQD+L  ++LV +VD+Y+GSNKELF WFK FVGY E   +IEN++HEKH+LDLDLCEA
Sbjct: 772  LYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEA 831

Query: 775  FGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 834
            +GPSYK+LPK+DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI
Sbjct: 832  YGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 891

Query: 835  EEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKV 894
            EEERHEYDF+IESNLRTIQ LETI NKI NMT  EK NFKLP GLGHTS TIYKKVIRKV
Sbjct: 892  EEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKV 951

Query: 895  YDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDH 954
            YDKERGFEIIDALHEHPA   P++L+RLK+KDEEWRRAQREWNKVWRELEQKVY+KSLDH
Sbjct: 952  YDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDH 1011

Query: 955  LGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILY 1014
            LGLTFKQADKKLLTTKQLISEISSI+VDQ NK+IHWLTPKPKSQLDF F D DI  DIL 
Sbjct: 1012 LGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILD 1071

Query: 1015 LADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYK----QNLXXXXXX 1070
            LA+ FI HT+ YSN +KERLKD L  FI LFFSIP  +I++ L        +        
Sbjct: 1072 LANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSS 1131

Query: 1071 XXXXXXTPRKRPYQQEMSLLDILHRSKYQKLKR---------SNDEDGKVPQLSEPLDXX 1121
                  + +KR  + ++ L D+L + KYQK+K          SN+ D +  +  E L   
Sbjct: 1132 TSNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQ 1191

Query: 1122 XXXXXXX-XXXXXXXKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYE 1180
                           K PWL G+++++ +  G+I+NR+IFNLFAN+NIY+FFRHWTTIYE
Sbjct: 1192 QQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYE 1251

Query: 1181 RLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLIN 1240
            RLLE+KQ+N+KVT+EI+ R +  FAKDL L+S+QL+ MGLDF   D+YK++L L++RLI 
Sbjct: 1252 RLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIK 1311

Query: 1241 GELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNAS 1300
             ++EHQWFEE LRQAYNNKAFKLYT DKVIQ LVKHA++++TD+K +EIMALF KDR  S
Sbjct: 1312 NDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRS 1371

Query: 1301 TTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKY 1360
            +T+ +DQIIYRLQ R++M+NTENMFR+EF+    HV +QYIA++DLTLK     ++ W+Y
Sbjct: 1372 STTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEY 1431

Query: 1361 YVTSYALPHPTEGISHEKLKIPFLER----LIEYGQD----TDGREVDEKFSPEGLSVST 1412
            YVTSYALPHPTEG+  E LK+PFLE+     +E  QD    T+  E  EK SPEG+S S 
Sbjct: 1432 YVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSK 1491

Query: 1413 LKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVA 1446
            LKIKI   TY L +E GS+DVF+RK+ NK+PT A
Sbjct: 1492 LKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDA 1525

 Score =  192 bits (488), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/114 (79%), Positives = 98/114 (85%), Gaps = 7/114 (6%)

Query: 62  DEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLF 121
           +EDP+YRPLNVKDALSYLEQVK QFNS+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324

Query: 122 RGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV-------NNNVSP 168
           +GYP+LIQGFNTFLPQGY I CS NPDDP+RVTTPMGT+T        N NVSP
Sbjct: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVSP 378

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 62/132 (46%), Gaps = 19/132 (14%)

Query: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134
           A++Y+ ++K ++  +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 135 LPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSLPEADGSTI-PQS 193
           LP+                 TP     V    + P    L+P+ PS   +   S + P S
Sbjct: 530 LPE-----------------TPANNQPVQQPHAHPQLQQLQPRIPSISQQQQPSQLYPFS 572

Query: 194 HNVPMVPSNVYH 205
           +N P VPS  Y 
Sbjct: 573 NNGP-VPSGFYQ 583

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 44/108 (40%), Gaps = 38/108 (35%)

Query: 545 LYPASNYYSHSTNG-------GIPQQNLPPIGSFS----------PPTNGSTTHEGFQDQ 587
           LYP SN      NG        IPQQNLPPIGSFS                T    F+  
Sbjct: 568 LYPFSN------NGPVPSGFYQIPQQNLPPIGSFSPPTATNANATTTPAAGTVVNNFRHG 621

Query: 588 QHMQPPHLMPLPSMVQQGPNMVHQGIVNENIPLSDLRTSLTDQYAPSN 635
             MQ      LPSM+             E IP+S+LR+   D + PS+
Sbjct: 622 ISMQ----TALPSMMTPD---------TEAIPISNLRS--VDGFPPSS 654

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/953 (55%), Positives = 666/953 (69%), Gaps = 36/953 (3%)

Query: 564  NLPPIGSFSPPTNGS---TTHEGFQDQQHMQPPHLMPLPSMVQQGPNMVHQGIVNENIPL 620
            NLPP+G+FS     S    +H      QH+   H++P         ++V QG+ N++IP+
Sbjct: 572  NLPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIP--------QHVVTQGMSNQDIPV 623

Query: 621  SDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPV-RPEIDLDXXXXXXXXXXXXX 679
            S++R+++   Y  +                   Y + P+ RPEIDLD             
Sbjct: 624  SEMRSTMNGTY--NQVEYIQGAPGYPQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQP 681

Query: 680  XXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 739
              D I+L +EVTFFE+ KR+IGNK +Y EFLKILNLYSQD+L   +LV KV+FYL S+KE
Sbjct: 682  PEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741

Query: 740  LFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 799
            LF WFK+FVGYQEK K IEN+VHEKHRLDLDLCEA GPSYK+LPK DTFMPCSGRD+MCW
Sbjct: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801

Query: 800  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 859
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQ LETI 
Sbjct: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861

Query: 860  NKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 919
            NKI NMT  EK NFKLPPGLGHTS+TIYKKV+RKVYDK+RGFEIIDALHEHPAVT P+VL
Sbjct: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVL 921

Query: 920  KRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSI 979
            KRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISSI
Sbjct: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981

Query: 980  KVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLN 1039
            KVDQTNK+IH LTPKPKSQLDF+  D+++ YDIL L  +F+    +YSN DK +L     
Sbjct: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041

Query: 1040 YFISLFFSIPLEKIEEAL---QSYKQNLXXXXXXXXXXXXTPRKRPYQQEMSLL--DILH 1094
             FISLFFS P++ + EA+    S                    KR    E S L  DIL 
Sbjct: 1042 AFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDILR 1101

Query: 1095 RSKYQKLKRSNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLTGNLVEEANSQGII 1154
            R+K  K   S +        S   D                  PWL G+L++EAN+ GI+
Sbjct: 1102 RTKNAKTSNSEENQNSSSVKSNEEDETELLAKEAA-------KPWLLGSLIDEANNSGIV 1154

Query: 1155 QNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQ 1214
             +R+IFNLF N+ IY+FFRH  T+YERLLE+K+++ +VT EI  R +V FA DL+L+S+Q
Sbjct: 1155 SDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQ 1214

Query: 1215 LSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLV 1274
            L++MGL F    AY ++L+LS+RLI G+L+HQWFEE LRQAY NKAFK+YTIDKV+Q LV
Sbjct: 1215 LADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLV 1274

Query: 1275 KHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNL 1334
            KHAH+++TD K A +M LF +DR    T+AKDQI+YRL+ R+ M  +ENMFR+E++  + 
Sbjct: 1275 KHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSS 1334

Query: 1335 HVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEY-GQD 1393
            HVS+QY+A+DDLTLKEP+  ++KW YYVTSY+L HPTEGI+ E +  PFL ++IE   + 
Sbjct: 1335 HVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEY 1394

Query: 1394 TDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKE 1453
             D  E ++KFSPEG+S S LK+ I P TY+L  E GS DVFTRK+ NK+P+  +     +
Sbjct: 1395 LDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQPASK 1454

Query: 1454 MVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDKITV 1506
            M         KFL+++   + +L+       + K+  LK    K ++D  +T+
Sbjct: 1455 M--------DKFLNSSKGWKKNLSTEIIGRAESKMKILK-EQGKLEIDQTLTI 1498

 Score =  184 bits (467), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 1/110 (0%)

Query: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+P 
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEP 176
           LIQGFNTFLP GY+IECSTNP+DPI+VTTP GTT    +  PP +  L P
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTG-EVSAGPPTQYQLAP 309

 Score =  135 bits (340), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/84 (80%), Positives = 72/84 (85%)

Query: 242 LTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 301
           L A    +K  +VEFS AISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQV
Sbjct: 413 LGALPGQQKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQV 472

Query: 302 THLFQNAPDLLEDFKKFLPDSSAS 325
           T LFQN PDLL+DFKKFLPDSS S
Sbjct: 473 TILFQNNPDLLDDFKKFLPDSSVS 496

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268

Query: 319 LP 320
           LP
Sbjct: 269 LP 270

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 135 LP 136
           LP
Sbjct: 490 LP 491

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/903 (58%), Positives = 647/903 (71%), Gaps = 30/903 (3%)

Query: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHL-MPLPSMV 602
            F +PAS +Y H        QNLPP+G+FSPP NG   +E   +   +QPP L  P     
Sbjct: 563  FNHPAS-FYQHQQARA---QNLPPLGNFSPPINGRD-NEAQVNLPAVQPPALDFPPQQQS 617

Query: 603  QQGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFXXXXXXXXXXXXXXXXXYGDVPVRPE 662
            Q   ++V QG+ N ++P+SD+R  +   +AP                    Y +   RPE
Sbjct: 618  QSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQDVQ-----------YMEPTSRPE 666

Query: 663  IDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 722
            IDLD               ++ +L EE +FF+KAK+Y+GNK +YTEFLKILNL+SQD++D
Sbjct: 667  IDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLID 726

Query: 723  LDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRL 782
             D+LV+KV+ YLG N ELF WFK+FV Y E+ K IENVVHEKHRLDLDLCEA  PSYK+L
Sbjct: 727  TDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKL 786

Query: 783  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 842
            PK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 787  PKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 846

Query: 843  FYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 902
            +YIE+NLRTIQ LETI NKI NMT  EK  FKLPPGLGHTS TIYKKVIRKVYDK+RGFE
Sbjct: 847  YYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFE 906

Query: 903  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQA 962
            IIDALHE+PAV+ P+VL+RLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQA
Sbjct: 907  IIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQA 966

Query: 963  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAH 1022
            DKKLLT KQLISEISSIK+DQ NK+I+  T KPKSQLDFD  DK + +DIL L D+FI H
Sbjct: 967  DKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDH 1026

Query: 1023 TTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLXXXXXXXXXXXXTPRKRP 1082
            +T YSNPDKE+L      F+S+FFSIPL  ++   + +K               + RKR 
Sbjct: 1027 STTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHK----------VENGDSTRKRS 1076

Query: 1083 YQQEMSLLDILHRSKYQKLKR-SNDEDGKVPQLSEPLDXXXXXXXXXXXXXXXXKNPWLT 1141
               +    D+L     Q  K+ S  ED       +                   K PWL 
Sbjct: 1077 RDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLL 1136

Query: 1142 GNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSM 1201
            GN+++EAN+ G + NR  +N+FAN+NIY+FFRH TT+Y+RL E K +NE+VTKEI+ R +
Sbjct: 1137 GNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKV 1196

Query: 1202 VTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAF 1261
            V FAKDL+L S+QLS+MGLDF G DAY+Q+L L +RLI  ++EHQWFEE LRQAY NKAF
Sbjct: 1197 VQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAF 1256

Query: 1262 KLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNT 1321
            K+YT+DKVIQ LVKHAH+++TDAKTAEIM LF KDR A TTS ++QI+YRLQ RS M  T
Sbjct: 1257 KIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLT 1316

Query: 1322 ENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKI 1381
            ENMFR+E +  + HVS+Q++A+DDLTL +P + +D+W+YY+TSY+L HPTEG+ HE++K 
Sbjct: 1317 ENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKA 1376

Query: 1382 PFLERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANK 1441
            PFLE+ +    D+   E  E +SP G SVS L+I+I P +Y L IE  S D+FTR   NK
Sbjct: 1377 PFLEKTLRDDGDS--DEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNK 1434

Query: 1442 YPT 1444
            +PT
Sbjct: 1435 HPT 1437

 Score =  283 bits (724), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 156/279 (55%), Positives = 183/279 (65%), Gaps = 28/279 (10%)

Query: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122
           +D  YRPLN KDALSYLEQVKFQFN+RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

Query: 123 GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTT------------TVNNNVSP 168
           GYP+LIQG NTFLPQGY+IEC++NP DP  I+VTTP  TT             V  +++ 
Sbjct: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAG 364

Query: 169 PARSALEPQEPSSLP--EADGSTIPQSHNVPMVPSNVYHXXXXXXXXXXXXXXXXXXXGL 226
           PA  +     PS +P  E   S   Q      +P++                        
Sbjct: 365 PATVST---SPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIQKSAQ 421

Query: 227 PSIHQPELPIPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQT 286
               Q +     ++P         N DVEFS AISYVNKIKTRFADQPDIYKHFLEILQT
Sbjct: 422 LQQSQQDQQYATNRP---------NGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQT 472

Query: 287 YQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 325
           YQREQKPI+EVY QVT LFQNAPDLL+DFKKFLPD++A+
Sbjct: 473 YQREQKPIHEVYTQVTSLFQNAPDLLDDFKKFLPDATAA 511

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  244 bits (624), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 143/361 (39%), Positives = 209/361 (57%), Gaps = 29/361 (8%)

Query: 700  IGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQEKIKSIE 758
            + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+  L + F N +  Y++  + ++
Sbjct: 214  VYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMK 273

Query: 759  NVVHEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDS 817
              +      D+ D     GPSYKRL   +T   C GRD +C EVLNDEWVGHPVWASE+ 
Sbjct: 274  PTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEV 333

Query: 818  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKA------ 871
            GFIAH+KNQYEETLFK+EEERHEYDF++ S       +E ++ K    TE EK+      
Sbjct: 334  GFIAHKKNQYEETLFKVEEERHEYDFFLLS-------VEHLIVK---FTEYEKSLQLSKD 383

Query: 872  -----NFKLPPGLGHTSM-TIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQK 925
                 N    P     S+ +I +KVIR++Y  E G  +IDA+  +P    P +LK  K+K
Sbjct: 384  DGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEK 443

Query: 926  DEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTN 985
             ++W  A+ EWNK WRE+EQK Y+KSLDHLGL FK A+K+ L  KQL+ E  S K D+  
Sbjct: 444  YQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLL 503

Query: 986  KKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLF 1045
            K+ H+       +  ++F DK + YD+  +    +   ++ S   K     +   F  L 
Sbjct: 504  KE-HY----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLL 558

Query: 1046 F 1046
            F
Sbjct: 559  F 559

 Score =  124 bits (311), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 95/316 (30%), Positives = 149/316 (47%), Gaps = 13/316 (4%)

Query: 1156 NRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEI--SKRSMVTFAKDLDLLSS 1213
            NR   N+F + NI   F +  T+YER  ++K     + K++   KR     AK L LL  
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1214 QLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLL 1273
            QLS+ GL+   +D Y+ +   S++ ++G L+HQWFEE LR  + NKA+KLYTID+VI+ +
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1274 VKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRN 1333
            +    T+       +I+ L V +    TT+   Q+ YR + R  M    +MFR+E  R +
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1334 LHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQD 1393
              +  QYI +DDL   +   ++ +   Y   Y     T+ +  + L  P+      Y  +
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPY------YSLN 852

Query: 1394 TDGREVDE-KFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHK 1452
               RE     F    +    L + I P+ Y + I  GS D+ +     K  +        
Sbjct: 853  LLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRKT 912

Query: 1453 EMVVKKTGLISKFLDN 1468
            +M      LISK   N
Sbjct: 913  QMA----SLISKIAKN 924

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 37.4 bits (85), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 699 YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQ---EKIK 755
           Y G K++Y ++LK+LN   QD   + D VE  D     + ++  +  N + YQ   E+ K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 756 SIENVVHEK 764
            I+N +H K
Sbjct: 140 YIDNFIHSK 148

>ABR197W Chr2 (774956..776362) [1407 bp, 468 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR229W
          Length = 468

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 737 NKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAF 775
           N+ LFS+ +N +  Q+++ SIE + H+ ++   DL EAF
Sbjct: 218 NRNLFSYRENLMNMQQQLDSIEALKHDYYQESYDLVEAF 256

>YFR025C Chr6 complement(203743..204750) [1008 bp, 335 aa] {ON}
           HIS2Histidinolphosphatase, catalyzes the eighth step in
           histidine biosynthesis; mutations cause histidine
           auxotrophy and sensitivity to Cu, Co, and Ni salts;
           transcription is regulated by general amino acid control
          Length = 335

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 237 PQSQPLTAQ-EDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFL 281
           P+ Q L    E+V   ++  F   +S+  +IKTR+AD+PD+   F+
Sbjct: 50  PEEQSLGKNPEEVITKLETSFKNFMSHAQEIKTRYADRPDVRTKFI 95

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 147,110,437
Number of extensions: 6788087
Number of successful extensions: 24073
Number of sequences better than 10.0: 58
Number of HSP's gapped: 24585
Number of HSP's successfully gapped: 136
Length of query: 1561
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1438
Effective length of database: 39,377,481
Effective search space: 56624817678
Effective search space used: 56624817678
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 73 (32.7 bits)