Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.170singletonON1611615154e-67
YOL004W (SIN3)6.29ON15361163716e-41
Skud_15.1586.29ON15551193602e-39
Smik_15.1666.29ON15661193583e-39
KAFR0I017502.566ON49273653.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.170
         (161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004...   202   4e-67
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...   147   6e-41
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...   143   2e-39
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...   142   3e-39
KAFR0I01750 Chr9 (355840..357318) [1479 bp, 492 aa] {ON} Anc_2.5...    30   3.3  

>Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004W
           (REAL)
          Length = 161

 Score =  202 bits (515), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 109/161 (67%), Positives = 109/161 (67%)

Query: 1   MSQVWHNPNSQSNEASTANDAASSNERTEKEPPLQGAQPSFVQPQQRITLPSLSALNAKD 60
           MSQVWHNPNSQSNEASTANDAASSNERTEKEPPLQGAQPSFVQPQQRITLPSLSALNAKD
Sbjct: 1   MSQVWHNPNSQSNEASTANDAASSNERTEKEPPLQGAQPSFVQPQQRITLPSLSALNAKD 60

Query: 61  EDRREXXXXXXXXXXXXXXXXPLASHSTRILGYPPAHSNVMPSITTDSALKQPHDYXXXX 120
           EDRRE                PLASHSTRILGYPPAHSNVMPSITTDSALKQPHDY    
Sbjct: 61  EDRREGNGNGNGNGQQQQQQQPLASHSTRILGYPPAHSNVMPSITTDSALKQPHDYHPHS 120

Query: 121 XXXXXXXXXXXTAAXXXXXXXXXXXXXXXXXXXXXTYYRRR 161
                      TAA                     TYYRRR
Sbjct: 121 NSSSSSSPSSNTAASGCCCSGSGSSSSSSSGSGSSTYYRRR 161

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}
           SIN3Component of the Sin3p-Rpd3p histone deacetylase
           complex, involved in transcriptional repression and
           activation of diverse processes, including mating-type
           switching and meiosis; involved in the maintenance of
           chromosomal integrity
          Length = 1536

 Score =  147 bits (371), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 83/116 (71%), Gaps = 11/116 (9%)

Query: 1   MSQVWHNPNSQSNEASTANDAASSNERTEKEPPLQGAQPSFVQPQQRITLPSLSALNAKD 60
           MSQVWHN NSQSN+ +T+NDA  SNER EKEP LQG +P FVQ QQRITLPSLSAL+ K+
Sbjct: 1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITLPSLSALSTKE 60

Query: 61  EDRREXXXXXXXXXXXXXXXXPLASHSTRILGYPPAHSNVMPSITTDSALKQPHDY 116
           EDRR+                 L SH+  ILGYPP HSN MPSI TDSALKQPH+Y
Sbjct: 61  EDRRDSNGQQA-----------LTSHAAHILGYPPPHSNAMPSIATDSALKQPHEY 105

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
           (REAL)
          Length = 1555

 Score =  143 bits (360), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/119 (64%), Positives = 89/119 (74%), Gaps = 14/119 (11%)

Query: 1   MSQVWHNPNSQSNEASTANDAASSNERTEKEPPLQGAQPSF---VQPQQRITLPSLSALN 57
           MSQVWHN NSQ N+ +T+NDAA+SNER++KEPPLQG QPSF    Q QQRITLPSLSALN
Sbjct: 1   MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPLQGRQPSFPGQQQQQQRITLPSLSALN 60

Query: 58  AKDEDRREXXXXXXXXXXXXXXXXPLASHSTRILGYPPAHSNVMPSITTDSALKQPHDY 116
           A DEDRR+                PLASH+T ILGY P HSN++PSI+TDSALKQ H+Y
Sbjct: 61  ANDEDRRD-----------YNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQSHEY 108

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
           (REAL)
          Length = 1566

 Score =  142 bits (358), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 84/119 (70%), Gaps = 14/119 (11%)

Query: 1   MSQVWHNPNSQSNEASTANDAASSNERTE---KEPPLQGAQPSFVQPQQRITLPSLSALN 57
           MSQVWHNPNSQSN+ +T+NDAA SNER E   KEP LQG Q SFVQ QQRITLPSLSALN
Sbjct: 1   MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLQGNQSSFVQQQQRITLPSLSALN 60

Query: 58  AKDEDRREXXXXXXXXXXXXXXXXPLASHSTRILGYPPAHSNVMPSITTDSALKQPHDY 116
            K+E+ R+                PLASH T ILGYPP H N++PSIT+DS  KQ H+Y
Sbjct: 61  NKEENGRD-----------SNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEY 108

>KAFR0I01750 Chr9 (355840..357318) [1479 bp, 492 aa] {ON}
          Anc_2.566 YKL045W
          Length = 492

 Score = 29.6 bits (65), Expect = 3.3,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 17/73 (23%)

Query: 7  NPNSQSNEASTANDAASSNERTEKEPPLQGAQPSFVQPQQRITLPS-------------- 52
          N +S  NE ST ND+A  NER   +  L   Q    QPQ  ITL                
Sbjct: 14 NYDSSFNEDSTINDSAIDNERGNLDGKLSFYQQ---QPQGEITLEQFEEWGIERLKVLLE 70

Query: 53 LSALNAKDEDRRE 65
          + ALNA+++  +E
Sbjct: 71 IEALNARNKSIKE 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.120    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,343,710
Number of extensions: 327254
Number of successful extensions: 1563
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1557
Number of HSP's successfully gapped: 22
Length of query: 161
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 60
Effective length of database: 41,900,133
Effective search space: 2514007980
Effective search space used: 2514007980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 61 (28.1 bits)