Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1696.30ON1221226384e-87
Skud_15.1576.30ON1221226384e-87
YOL005C (RPB11)6.30ON1201206221e-84
Smik_15.1656.30ON1201206184e-84
CAGL0E02453g6.30ON1201206021e-81
KAFR0A051106.30ON1221225863e-79
TDEL0G043906.30ON1221225821e-78
ZYRO0C07502g6.30ON1221225803e-78
NCAS0D021206.30ON1221185777e-78
KNAG0F029106.30ON1221205761e-77
Kpol_1037.216.30ON1201205715e-77
NDAI0C026706.30ON1221225639e-76
TBLA0E031506.30ON1181185542e-74
ACL005C6.30ON1221225543e-74
Kwal_56.224726.30ON1221225412e-72
TPHA0J004106.30ON1201205413e-72
SAKL0E01562g6.30ON1221225413e-72
KLTH0C10934g6.30ON1221225394e-72
KLLA0C06160g6.30ON1211185282e-70
CAGL0L03872g2.163ON137911314e-10
TPHA0B029202.163ON1301061306e-10
TDEL0F011802.163ON129901192e-08
Kpol_165.22.163ON128921183e-08
KAFR0B045702.163ON131901141e-07
ZYRO0B09878g2.163ON130901122e-07
KNAG0I020602.163ON134901123e-07
TBLA0B012902.163ON102861103e-07
SAKL0E10692g2.163ON131901096e-07
YNL113W (RPC19)2.163ON1421021107e-07
Smik_14.2142.163ON1421021081e-06
Ecym_54232.163ON127901071e-06
Suva_14.2252.163ON1421041071e-06
Skud_14.2182.163ON1561041063e-06
NCAS0G025502.163ON150621045e-06
AFL220C2.163ON135901027e-06
KLTH0D09350g2.163ON146711028e-06
KLLA0F23760g2.163ON12788992e-05
NDAI0F027502.163ON14990983e-05
Kwal_26.84732.163ON15071983e-05
TBLA0J007305.604ON72691760.058
TPHA0J016707.327ON83269690.50
Kwal_23.58927.257ON67859661.4
TPHA0B015207.441ON115070651.8
YDL148C (NOP14)7.327ON81069643.1
NCAS0D022805.9ON80850633.3
CAGL0J08844g7.327ON79969625.4
YHL030W (ECM29)4.15ON186863625.8
CAGL0L07810g1.423ON59640608.4
SAKL0F13618g7.441ON117570609.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.169
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   250   4e-87
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   250   4e-87
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   244   1e-84
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   242   4e-84
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   236   1e-81
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   230   3e-79
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   228   1e-78
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   228   3e-78
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   226   7e-78
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   226   1e-77
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   224   5e-77
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   221   9e-76
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   218   2e-74
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   218   3e-74
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   213   2e-72
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   213   3e-72
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   213   3e-72
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   212   4e-72
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   207   2e-70
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    55   4e-10
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    55   6e-10
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    50   2e-08
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    50   3e-08
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    49   1e-07
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    48   2e-07
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    48   3e-07
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    47   3e-07
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    47   6e-07
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    47   7e-07
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    46   1e-06
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    46   1e-06
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    46   1e-06
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    45   3e-06
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    45   5e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    44   7e-06
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    44   8e-06
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    43   2e-05
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    42   3e-05
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    42   3e-05
TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5....    34   0.058
TPHA0J01670 Chr10 (384560..387058) [2499 bp, 832 aa] {ON} Anc_7....    31   0.50 
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    30   1.4  
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    30   1.8  
YDL148C Chr4 complement(188154..190586) [2433 bp, 810 aa] {ON}  ...    29   3.1  
NCAS0D02280 Chr4 complement(427826..430252) [2427 bp, 808 aa] {O...    29   3.3  
CAGL0J08844g Chr10 complement(873456..875855) [2400 bp, 799 aa] ...    28   5.4  
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    28   5.8  
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    28   8.4  
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    28   9.6  

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  250 bits (638), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 NM 122
           NM
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  250 bits (638), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 NM 122
           NM
Sbjct: 121 NM 122

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  244 bits (622), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 119/120 (99%), Positives = 120/120 (100%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  242 bits (618), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 119/120 (99%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA DDAF
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  236 bits (602), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTKAPNAVVITFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFARFKLRIQT EGYDPKDAL+NAC+SIINKLGALK+NFETEWNLQTLAADDAF
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  230 bits (586), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 117/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTK+PNAVVITFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFARFKLR+QT EGYDPK+ALKNACNSIINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 NM 122
            +
Sbjct: 121 GI 122

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  228 bits (582), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKL  LKTNFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 NM 122
            +
Sbjct: 121 GI 122

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  228 bits (580), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKL+++PDTKAPNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 NM 122
            +
Sbjct: 121 GI 122

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  226 bits (577), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 108/118 (91%), Positives = 114/118 (96%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKL+I+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118
           YKVEHPFFARFKLRIQT EGYDPKDALKNACNSII+KLG LK NFETEWNLQTLAAD+
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  226 bits (576), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLG+GESKL I+PDTK+PNA+VITF KEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFARFKLRIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA DD F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  224 bits (571), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPD+FELFLLGEGESKL IEPDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FARFKLRIQT E YDPKDALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  221 bits (563), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLLGEGESKL I+PDTKAPNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHPFFA FKLRIQT EGYDPK ALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 NM 122
            +
Sbjct: 121 GI 122

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  218 bits (554), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFE FLLGEGESKL+IEPDTKAPN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118
           YKVEHP FARFK+RIQT EGYDPKDAL+ ACNSII KLG LKTNFETEWNLQTLA+DD
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  218 bits (554), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLL EGESKLKIEPDTKA NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACNSIINKL  LK+NFETEWNLQTLA++D F
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 NM 122
            +
Sbjct: 121 RL 122

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  213 bits (541), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLL EGE+KLKI+PDTKAPNAV++TFEKEDHTL NLIRAELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACN II+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 NM 122
            M
Sbjct: 121 AM 122

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  213 bits (541), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 104/120 (86%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLL EG+SKL+IE DTKA NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FARFKLRIQT E YDPKDALK ACN+IINKLG LKTNF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  213 bits (541), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLL EGESKL IEPDTKAPNAV+ITFEKEDHTLGNLIRAELL D++VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN+II KL  L++NFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 NM 122
            +
Sbjct: 121 GL 122

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  212 bits (539), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 111/122 (90%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLL EGE+KLKI+PDTKAPNAV++TFEKEDHTL NLIR ELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
           YKVEHP FA+FKLRIQT EGYDPKDALKNACN II+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 NM 122
            M
Sbjct: 121 AM 122

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  207 bits (528), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (90%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60
           MNAPDRFELFLL EGESKLK+E DTKA +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118
           YKVEHP FA+FK+RIQT EGYDPKDALKNACNSIINKL  L++NFETEWNLQTLA +D
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 55.1 bits (131), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 17  SKLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLR 74
           +K+K+ P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      LR
Sbjct: 41  TKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNLR 100

Query: 75  IQTTEGYDPKDALKNACNSIINKLGALKTNF 105
           IQT       DAL+   + +I+   A+K  F
Sbjct: 101 IQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 54.7 bits (130), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 2   NAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFA 59
           + P+  E+ +    E K+KI P+  +P+    +F+  +EDHTLGN +R  ++ + +V F 
Sbjct: 18  SVPEVDEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFC 77

Query: 60  AYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNF 105
            Y + HP      LRIQT       +AL+     +++    ++  F
Sbjct: 78  GYSIPHPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 50.4 bits (119), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+K+ P   + +    +F+  +EDHTLGN +R  ++ ++ V F  Y + HP      LRI
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       D L+     +++   A++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 16  ESKLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKL 73
           E K+KI P   + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTTEGYDPKDALKNACNSIINKLGALKTNF 105
           RIQT       +AL+     +++    ++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+KI P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       DALK     +++    ++  F
Sbjct: 95  QTYGEITAVDALKKGLADLMDLCDVVEETF 124

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+KI P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       D L      +++   A++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+KI P+    +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       DA K     +++    ++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%)

Query: 20  KIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTE 79
           ++ P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      LR+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  GYDPKDALKNACNSIINKLGALKTNF 105
                DAL      +++    ++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 46.6 bits (109), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+K+ P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKLLPQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNVRI 94

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       +AL+     +++   A++  F
Sbjct: 95  QTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 47.0 bits (110), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKV 63
           PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNF 105
            HP      +RIQT       DAL+     +++    +++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKV 63
           PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNF 105
            HP      +RIQT       DAL+     +++    +++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+++ P+  + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      LRI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       +AL      +++    ++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAY 61
           + PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ + +V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNF 105
            + HP      +RIQT       +AL+     +++    +++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAY 61
           + PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNF 105
            + HP      +RIQT       DAL+     +++    ++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+KI P+  + +    +F+   EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 54  KVKILPEGASEDGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGYSIPHPSENFLNVRI 113

Query: 76  QT 77
           QT
Sbjct: 114 QT 115

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+++ P   + +     F+   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       DAL      +++    ++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 43.9 bits (102), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSI 94
             +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   + L+     +
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  INKLGALKTNF 105
           ++   A++  F
Sbjct: 129 MDLCDAVEDKF 139

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%)

Query: 18  KLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQT 77
           KL  E  ++   +       EDHTLGN +R  ++ + +V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  TEGYDPKDALKNACNSIINKLGALKTNF 105
                  +AL      +++   A++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI 75
           K+KI     + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QTTEGYDPKDALKNACNSIINKLGALKTNF 105
           QT       +AL      +++    ++  F
Sbjct: 113 QTYGEITAVEALHKGLQDLMDLCDVVEEKF 142

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSI 94
             +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   + L+     +
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 95  INKLGALKTNF 105
           ++   A++  F
Sbjct: 133 MDLCDAVEDKF 143

>TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5.604
           YOR022C
          Length = 726

 Score = 33.9 bits (76), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query: 40  HTLGNLIRAELLNDRKVLFAAYKVEHPFF-----ARFKLRIQTTEGYDPKDALKNACNSI 94
           H+LGNLI  +LLN+ K     +KV + F        FKL IQ T      D + N     
Sbjct: 499 HSLGNLILFDLLNNTKKYSLNFKVGNYFCLGSPAGVFKL-IQRTN----IDGINNKAGKE 553

Query: 95  INKLGALKTNFETE---WNLQTLAADDAFNM 122
           + K   LK  ++ E   W  QTL   + +N+
Sbjct: 554 LGKRKKLKQKYQLEIDNWQTQTLPCKELYNI 584

>TPHA0J01670 Chr10 (384560..387058) [2499 bp, 832 aa] {ON} Anc_7.327
           YDL148C
          Length = 832

 Score = 31.2 bits (69), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 44  NLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKT 103
           N ++A+L  +RK      + +  F AR ++  Q  E  + +  + +  N+I  + GA K 
Sbjct: 761 NKVKAQLKKERKFTMKEIRKDSRFEARQRIEKQKKESDEYRSKMSHIINTINTEEGAEKN 820

Query: 104 NFETEWNLQ 112
            +E E  L+
Sbjct: 821 KYEREKRLR 829

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 30.0 bits (66), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 27/59 (45%)

Query: 41  TLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLG 99
           T G+L+R E  N  K    AY  EHP    +++   T + ++  DA     N I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

>TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1150

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPF 67
           L +LG+G   K+ +           I   K+DH + N   A    ++KV   A K +HPF
Sbjct: 826 LKVLGKGNFGKVLLSKSKNTGRVCAIKVLKKDHIIQNHDIASARAEKKVFLLATKTKHPF 885

Query: 68  FARFKLRIQT 77
                   QT
Sbjct: 886 LTNLYCSFQT 895

>YDL148C Chr4 complement(188154..190586) [2433 bp, 810 aa] {ON}
           NOP14Nucleolar protein, forms a complex with Noc4p that
           mediates maturation and nuclear export of 40S ribosomal
           subunits; also present in the small subunit processome
           complex, which is required for processing of pre-18S
           rRNA
          Length = 810

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 44  NLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKT 103
           N ++A+L  +RK      + +  F AR ++  +  E  D    + +  N+I  + GA K 
Sbjct: 738 NKMKAQLKKERKFTMKEIRKDAKFEARQRIEEKNKESSDYHAKMAHIVNTINTEEGAEKN 797

Query: 104 NFETEWNLQ 112
            +E E  L+
Sbjct: 798 KYERERKLR 806

>NCAS0D02280 Chr4 complement(427826..430252) [2427 bp, 808 aa] {ON}
           Anc_5.9 YMR309C
          Length = 808

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 71  FKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120
            +  + +T  Y P D  K + N I+N +  L  NF T + +  LAA   F
Sbjct: 305 MRFDVSSTLSYQPIDQWKASFNDIVNLMTILDNNFST-YQVSELAAPAEF 353

>CAGL0J08844g Chr10 complement(873456..875855) [2400 bp, 799 aa]
           {ON} similar to uniprot|Q99207 Saccharomyces cerevisiae
           YDL148c
          Length = 799

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 44  NLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKT 103
           N ++A+L  +RK +    + +  F AR ++  +  E       + N  N+I  + GA K 
Sbjct: 727 NKMKAQLKKERKFVMKELRKDTKFEARQRIDEKKKEAEAYHSKMSNIINTINTEEGAEKN 786

Query: 104 NFETEWNLQ 112
            +E E  L+
Sbjct: 787 KYEREKRLR 795

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 28.5 bits (62), Expect = 5.8,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 11  LLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRA--ELLNDR---KVLFAAYKVEH 65
           L  EG  KL++ P T A N  ++  + +  TLG++++   EL++D    + LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PFF 68
           P F
Sbjct: 457 PQF 459

>CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa]
           {ON} similar to uniprot|P25333 Saccharomyces cerevisiae
           YCR008w SAT4 serine/threonine-specific protein kinase
          Length = 596

 Score = 27.7 bits (60), Expect = 8.4,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 57  LFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNA-CNSII 95
           L+ A K + PF+ ++    +   GY+P ++LK A C ++I
Sbjct: 503 LWTAAKKDDPFYNKYLQGRRQKSGYEPIESLKRARCRNVI 542

>SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON}
           similar to uniprot|P24583 Saccharomyces cerevisiae
           YBL105C PKC1 Protein Kinase C
          Length = 1175

 Score = 27.7 bits (60), Expect = 9.6,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPF 67
           L +LG+G   K+ +       +   I   K+DH + N        ++KV   A K +HPF
Sbjct: 851 LKVLGKGNFGKVLLAKSKNTDSLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPF 910

Query: 68  FARFKLRIQT 77
                   QT
Sbjct: 911 LTNLYCSFQT 920

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,112,163
Number of extensions: 488504
Number of successful extensions: 1328
Number of sequences better than 10.0: 63
Number of HSP's gapped: 1328
Number of HSP's successfully gapped: 63
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)