Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_15.1596.45ON55055023480.0
Skud_15.1486.45ON54855419640.0
Smik_15.1576.45ON55055419140.0
YOL013C (HRD1)6.45ON55155619140.0
TDEL0G042506.45ON51754811641e-154
ZYRO0C07194g6.45ON55841611371e-149
SAKL0E01958g6.45ON5245489861e-127
KAFR0A052406.45ON5535789781e-126
CAGL0E02299g6.45ON5454209611e-123
TPHA0F024806.45ON6054259571e-122
TBLA0B005606.45ON4924109211e-118
NCAS0D020106.45ON5104349081e-116
NDAI0C027706.45ON6304559051e-114
Kpol_1035.506.45ON6014068791e-110
KLTH0C10604g6.45ON5154047895e-98
Kwal_56.225226.45ON5134137764e-96
KNAG0E027406.45ON5564447361e-89
KLLA0C05874g6.45ON5534055816e-67
ACL019C6.45ON5753984479e-48
Ecym_30486.45ON6704074156e-43
TPHA0C042602.545ON757781351e-07
KAFR0B014602.545ON761771261e-06
TDEL0B063402.545ON762781242e-06
Skud_11.1922.545ON758781224e-06
NCAS0A047602.545ON7611451215e-06
YKL034W (TUL1)2.545ON758761207e-06
Suva_11.1892.545ON758641208e-06
AFR275W2.545ON753771208e-06
ZYRO0E05632g2.545ON765641198e-06
Smik_11.2132.545ON759841172e-05
TBLA0I014902.545ON750641162e-05
Ecym_72412.545ON758641143e-05
KLLA0F25674g2.545ON757721135e-05
SAKL0A09812g2.545ON751571126e-05
KLTH0D07216g2.545ON747721117e-05
Kpol_1002.72.545ON754761119e-05
KNAG0A070902.545ON762641119e-05
CAGL0L01947g2.545ON757761101e-04
KLLA0E04071g8.317ON704331101e-04
Kwal_26.80992.545ON750641082e-04
KLTH0G12408g8.317ON603351054e-04
Kwal_27.105463.279ON10437965e-04
TDEL0D034603.279ON14438978e-04
AGR034W3.279ON15937979e-04
NDAI0K018102.545ON762771020.001
Ecym_42508.317ON657341010.001
Suva_2.3048.317ON624391010.001
TBLA0A096405.628ON32556990.001
NDAI0H008405.628ON34159980.002
CAGL0B05049g1.389ON147072980.004
KLTH0C05258g3.279ON15238920.004
NDAI0A074503.279ON17337920.004
CAGL0E01441g8.317ON71727960.005
NCAS0C033108.317ON57044950.006
ZYRO0C11176g5.628ON36852940.006
CAGL0H10274g3.279ON17580910.007
Skud_4.4028.317ON61235950.007
Kpol_526.345.628ON32856930.008
KAFR0B030708.317ON64327940.008
Kpol_1052.193.279ON10328860.009
NCAS0A113503.405ON42865930.009
Kwal_56.239008.317ON58987930.010
Smik_4.3878.317ON63435930.010
CAGL0M08690g5.628ON32856920.011
Suva_4.3023.279ON15027880.013
SAKL0H17116gsingletonON54440910.017
CAGL0K02563g2.542ON58630910.019
SAKL0G07370g5.628ON32152900.021
YDR143C (SAN1)8.317ON61035900.027
KAFR0H005605.628ON32773890.028
KLTH0E02464g5.628ON32957880.034
Skud_2.1863.279ON17834850.044
KNAG0G023908.317ON68827880.048
TBLA0I019603.279ON18466840.050
ZYRO0D05830g8.317ON78046870.059
Ecym_26583.279ON15938830.062
ABR104W3.405ON32829860.064
TPHA0A039903.279ON17528830.071
YDR265W (PEX10)5.628ON33725850.075
Smik_2.1963.279ON18534830.076
Kpol_1036.668.317ON66826860.076
SAKL0D03058g3.279ON15533820.084
NCAS0A082803.279ON11834800.090
KLTH0F18502gsingletonON26769840.095
NDAI0G026308.317ON66127850.099
YBR062C3.279ON18034820.100
TPHA0C008508.317ON78126850.11
Kwal_55.199995.628ON15225810.11
KNAG0J008503.279ON16228810.12
KAFR0A019902.542ON56030840.12
NCAS0A04680singletonON27439830.12
KNAG0I013801.389ON149326850.13
Ecym_13285.628ON32052830.14
CAGL0I04576g3.190ON14988800.14
TBLA0G023102.542ON67430840.15
AER390W5.628ON31652820.16
TPHA0C042502.542ON55626830.17
Skud_4.5285.628ON33725820.19
NCAS0C052905.628ON33025820.20
TDEL0F02870na 1ON26090810.21
KNAG0C056602.542ON50730820.21
Suva_2.4335.628ON33725810.21
TDEL0A049405.628ON32652810.21
KLLA0E16677g5.628ON30552810.23
Smik_4.5165.628ON33725810.23
TBLA0C013301.389ON145229820.23
KNAG0A012803.28ON11426760.24
TPHA0A033403.405ON38456810.26
NDAI0B018202.542ON62526820.26
Kpol_1002.82.542ON55826810.27
ZYRO0E05192g1.389ON152026820.28
ZYRO0B02244g2.542ON56326810.29
TPHA0C003505.628ON27825800.30
Ecym_54453.405ON32132800.30
Suva_8.422.542ON58526810.32
YHL010C (ETP1)2.542ON58526810.34
NCAS0A125502.542ON57226800.36
Smik_8.322.542ON58526800.36
ZYRO0E06996g3.279ON17238770.37
Kpol_1048.731.389ON154926810.37
Skud_8.352.542ON58526800.39
CAGL0K08052g3.405ON30556790.40
SAKL0D08272g1.389ON149127800.41
TDEL0A031802.542ON56726800.41
SAKL0H15686g8.317ON59935800.43
KLLA0F18458g3.279ON14024760.43
TDEL0F044408.317ON55426790.45
SAKL0C01760gsingletonON147427800.45
NDAI0G052001.389ON158652800.46
SAKL0C03586gsingletonON147427800.46
KLTH0D07150g2.542ON54026790.49
NCAS0A087801.389ON150227800.50
Suva_10.3441.389ON156068800.51
SAKL0A09746g2.542ON54826790.52
TDEL0B061701.389ON147026790.54
KLLA0F12166g1.389ON152868790.59
YPR093C (ASR1)3.405ON28827760.81
KLTH0G18150g1.389ON155453780.85
KLLA0F25740g2.542ON51725770.85
Kwal_56.231123.190ON13527730.96
Kwal_26.8030na 2ON66030770.99
TBLA0B087103.28ON12226720.99
KNAG0A074303.405ON10259711.00
SAKL0A09526gna 2ON66230771.0
Kwal_26.80902.542ON52026761.2
Kwal_55.220543.28ON11126711.2
CAGL0B02013g8.288ON112033761.3
Kwal_55.21206singletonON27566751.3
KLLA0E07151g3.28ON11057701.3
KLTH0D06886gna 2ON66430761.3
Smik_12.3201.389ON155368761.4
KLLA0E18503gna 2ON65030751.5
Kwal_14.12871.389ON151853751.6
KLTH0F19228g3.28ON11022701.6
CAGL0E01567g3.28ON10226691.6
KAFR0C004603.279ON15724721.7
YLR247C (IRC20)1.389ON155668751.7
SAKL0C13178g3.28ON13826711.7
NDAI0D02810na 1ON25292731.8
Kpol_1045.683.190ON17689721.8
KAFR0C017803.28ON11826701.9
KLLA0E17711g3.190ON16227711.9
Kpol_1014.163.28ON10726691.9
ZYRO0C03058g3.28ON11626702.0
NDAI0G038603.28ON12326702.0
Skud_15.203.28ON12126702.0
TDEL0A004703.28ON11826692.1
YOL133W (HRT1)3.28ON12126692.2
NCAS0C044803.28ON10926692.3
TDEL0A03090na 2ON58630742.3
KNAG0J015605.628ON30925732.4
Smik_15.203.28ON12126692.4
YOL138C (RTC1)3.22ON134125742.4
TPHA0P014703.28ON11126692.4
Suva_15.263.28ON12226692.4
TPHA0B036501.389ON157674742.4
KAFR0I020901.389ON146626742.5
TPHA0H006403.190ON18038712.6
KAFR0F028406.332ON44524732.8
TBLA0A039008.317ON69827732.9
AAL030C1.389ON153923733.0
Smik_5.2617.416ON269117713.6
ZYRO0C17424g3.405ON27328713.9
Skud_12.3281.389ON155768724.0
NDAI0I004006.332ON48126714.4
KNAG0I020902.157ON42779714.7
Suva_2.2918.288ON115133714.8
KLLA0C15697g3.405ON30428705.0
SAKL0B08976g3.405ON32241696.1
NDAI0G038103.22ON139357706.2
KLTH0F11044g3.405ON29129696.3
KLLA0C08756g6.332ON42724697.3
Ecym_7253na 2ON61730697.8
ZYRO0B02046gna 2ON44530698.0
Ecym_60682.402ON100267698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_15.159
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   909   0.0  
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   761   0.0  
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   741   0.0  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   741   0.0  
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   452   e-154
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   442   e-149
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   384   e-127
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   381   e-126
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   374   e-123
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   373   e-122
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   359   e-118
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   354   e-116
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   353   e-114
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   343   e-110
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   308   5e-98
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   303   4e-96
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   288   1e-89
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   228   6e-67
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   176   9e-48
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   164   6e-43
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    57   1e-07
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    53   1e-06
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    52   2e-06
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    52   4e-06
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    51   5e-06
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    51   7e-06
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    51   8e-06
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    51   8e-06
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    50   8e-06
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    50   2e-05
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    49   2e-05
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    49   3e-05
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    48   5e-05
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    48   6e-05
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    47   7e-05
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    47   9e-05
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    47   9e-05
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    47   1e-04
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    47   1e-04
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    46   2e-04
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    45   4e-04
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    42   5e-04
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    42   8e-04
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    42   9e-04
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    44   0.001
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    44   0.001
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    44   0.001
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    43   0.001
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    42   0.002
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    42   0.004
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    40   0.004
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    40   0.004
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    42   0.005
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     41   0.006
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    41   0.006
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    40   0.007
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    41   0.007
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    40   0.008
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    41   0.008
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    38   0.009
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    40   0.009
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    40   0.010
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    40   0.010
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    40   0.011
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    39   0.013
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    40   0.017
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    40   0.019
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    39   0.021
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    39   0.027
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    39   0.028
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    39   0.034
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    37   0.044
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    39   0.048
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    37   0.050
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    38   0.059
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    37   0.062
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    38   0.064
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    37   0.071
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    37   0.075
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    37   0.076
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    38   0.076
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    36   0.084
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    35   0.090
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    37   0.095
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     37   0.099
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    36   0.100
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    37   0.11 
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    36   0.11 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    36   0.12 
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    37   0.12 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      37   0.12 
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    37   0.13 
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    37   0.14 
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    35   0.14 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.15 
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    36   0.16 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    37   0.17 
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    36   0.19 
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    36   0.20 
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      36   0.21 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    36   0.21 
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    36   0.21 
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    36   0.21 
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    36   0.23 
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    36   0.23 
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    36   0.23 
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    34   0.24 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    36   0.26 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     36   0.26 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    36   0.27 
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    36   0.28 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    36   0.29 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    35   0.30 
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    35   0.30 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    36   0.32 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    36   0.34 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    35   0.36 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.36 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    34   0.37 
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    36   0.37 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.39 
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    35   0.40 
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    35   0.41 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.41 
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    35   0.43 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    34   0.43 
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    35   0.45 
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    35   0.45 
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    35   0.46 
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    35   0.46 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.49 
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    35   0.50 
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    35   0.51 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    35   0.52 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    35   0.54 
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    35   0.59 
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    34   0.81 
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    35   0.85 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    34   0.85 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    33   0.96 
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    34   0.99 
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    32   0.99 
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    32   1.00 
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    34   1.0  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    34   1.2  
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    32   1.2  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    34   1.3  
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    33   1.3  
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    32   1.3  
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    34   1.3  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    34   1.4  
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    33   1.5  
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    33   1.6  
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    32   1.6  
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    31   1.6  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   1.7  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    33   1.7  
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    32   1.7  
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      33   1.8  
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...    32   1.8  
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    32   1.9  
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    32   1.9  
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    31   1.9  
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    32   2.0  
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    32   2.0  
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    32   2.0  
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    31   2.1  
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    31   2.2  
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       31   2.3  
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               33   2.3  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    33   2.4  
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    31   2.4  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    33   2.4  
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    31   2.4  
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    31   2.4  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    33   2.4  
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    33   2.5  
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...    32   2.6  
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    33   2.8  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    33   2.9  
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    33   3.0  
Smik_5.261 Chr5 complement(404258..405067) [810 bp, 269 aa] {ON}...    32   3.6  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    32   3.9  
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    32   4.0  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    32   4.4  
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    32   4.7  
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    32   4.8  
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    32   5.0  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    31   6.1  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   6.2  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    31   6.3  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    31   7.3  
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    31   7.8  
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    31   8.0  
Ecym_6068 Chr6 (126754..129762) [3009 bp, 1002 aa] {ON} similar ...    31   8.9  

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/550 (84%), Positives = 465/550 (84%)

Query: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFI     
Sbjct: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120
                     FGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDV 180
           FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDV
Sbjct: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDV 180

Query: 181 VSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXX 240
           VSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHI            
Sbjct: 181 VSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEVEDENEVD 240

Query: 241 SGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD 300
           SGEPHAEL        RQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD
Sbjct: 241 SGEPHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD 300

Query: 301 VVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQ 360
           VVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQ
Sbjct: 301 VVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQ 360

Query: 361 QAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFXXXXXXX 420
           QAW        RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPF       
Sbjct: 361 QAWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFTSNSTTT 420

Query: 421 XXXXXXXXXXXXXXXXXXQYISTNDTELIPTRTIPHDAGIXXXXXXXXXXXXXXXXXTWY 480
                             QYISTNDTELIPTRTIPHDAGI                 TWY
Sbjct: 421 RNNTSTTDTTRTATTATNQYISTNDTELIPTRTIPHDAGIASSQNMNMSASMSASSNTWY 480

Query: 481 TFPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGAQKRI 540
           TFPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGAQKRI
Sbjct: 481 TFPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGAQKRI 540

Query: 541 VIPDQFIQHI 550
           VIPDQFIQHI
Sbjct: 541 VIPDQFIQHI 550

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/554 (72%), Positives = 427/554 (77%), Gaps = 10/554 (1%)

Query: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           MVPENRRKQL+ FIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFI     
Sbjct: 1   MVPENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120
                     FGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDV 180
           FHWI+KDRLEALLQSINDSTT+K LI SRFSFNL LLA+ D+QI+ RCISSIYTN+NID+
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISSIYTNQNIDI 180

Query: 181 VSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXX 240
           +STSLYLMQVMEFTMLLIDLLNLFLQT LNFWEFY SQQSQSNE+NHI            
Sbjct: 181 ISTSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFE 240

Query: 241 SGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD 300
             E HA L        RQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMP+MLLKD
Sbjct: 241 --EAHAVL-NDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKD 297

Query: 301 VVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQ 360
           VVWDVLALYQS T+LWKIWRNNKQLDD LITVT EQ+QNSANEDNICIICMDEL+HS   
Sbjct: 298 VVWDVLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMHSQAD 357

Query: 361 QAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFXXXXXXX 420
           Q W        RLPCGHILHLSCLKNWMERSQTCPICRL VFDEKGNVVQ+         
Sbjct: 358 QTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLSVFDEKGNVVQS---TFTSNT 414

Query: 421 XXXXXXXXXXXXXXXXXXQYISTNDTELIPTRTIPHDAGIX----XXXXXXXXXXXXXXX 476
                             + + TN TEL+PTRT   D GI                    
Sbjct: 415 GTTSTNTTVTGATSATINRQVFTNQTELLPTRTTSPDVGIIPNHNINTLASRSTSTSTSS 474

Query: 477 XTWYTFPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGA 536
             WYTFPLQQT + S ESKCSTYEFL+++SNEK++ IPVKLTVESHE+NS QG EE QG 
Sbjct: 475 TMWYTFPLQQTDDDSNESKCSTYEFLMTNSNEKEDRIPVKLTVESHEVNSLQGGEEVQGT 534

Query: 537 QKRIVIPDQFIQHI 550
           QKRIVIPD+FIQHI
Sbjct: 535 QKRIVIPDKFIQHI 548

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/554 (70%), Positives = 420/554 (75%), Gaps = 10/554 (1%)

Query: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           MVPENRRKQLV FIV+TYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIF+     
Sbjct: 1   MVPENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNST 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120
                     FGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV
Sbjct: 61  LLWHLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDV 180
           FHWI+KDRLEALLQSINDSTT+KTLIFSRFS NL LLA  DYQII  CISSIYTN+ ID+
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSIYTNQKIDI 180

Query: 181 VSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXX 240
           VSTSLYLMQVMEFTMLLIDLLNLFLQT LNFWEFY SQQSQS++ NHI            
Sbjct: 181 VSTSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVD 240

Query: 241 -SGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLK 299
             G  HA          RQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLK
Sbjct: 241 FDGSQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLK 300

Query: 300 DVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSAN 359
           DV+WD+LALYQSAT LWKIWRNNKQLDD+L+TVT+EQ+QNSANEDNICIICMDELIHS N
Sbjct: 301 DVIWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELIHSTN 360

Query: 360 QQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFXXXXXX 419
           QQ W        RLPCGHILHLSCLKNWMERSQTCPICRLPVFD+KGNVVQT F      
Sbjct: 361 QQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDDKGNVVQTTFTSETNS 420

Query: 420 XXXXXXXXXXXXXXXXXXXQYISTNDTELIPTRTIPHDAGI----XXXXXXXXXXXXXXX 475
                                   N+TEL+PTRT   D  I                   
Sbjct: 421 SITMAATDNTRTIVNSQDF----ANETELLPTRTTSPDVRILPNQNTNTFASRATSTSTS 476

Query: 476 XXTWYTFPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQG 535
             TW  FPLQQT +   ES+ STYEFL++SS+EK++SIPVKLT+ESHE++  QG  E Q 
Sbjct: 477 STTWCKFPLQQTEDNDVESR-STYEFLMTSSDEKESSIPVKLTIESHEIDYLQGDGEGQT 535

Query: 536 AQKRIVIPDQFIQH 549
           AQK+IVIP +FIQH
Sbjct: 536 AQKKIVIPSKFIQH 549

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/556 (70%), Positives = 421/556 (75%), Gaps = 11/556 (1%)

Query: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           MVPENRRKQL  F+VVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFI     
Sbjct: 1   MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120
                     FGELRLIEHEHIFERLPFTIINTLFMSS+FHERYFFTVAFFGLLLLYLKV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDV 180
           FHWI+KDRLEALLQSINDSTT+KTLIFSRFSFNL LLA+ DYQIITRCISSIYTN+  D+
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI 180

Query: 181 VSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXX 240
            STSLYL+QVMEFTMLLIDLLNLFLQT LNFWEFY SQQS SNENNHI            
Sbjct: 181 ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVE 240

Query: 241 S--GEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL 298
           S   +P            RQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL
Sbjct: 241 SDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL 300

Query: 299 KDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSA 358
           KDVVWD+LALYQS T+LWKIWRNNKQLDDTL+TVT+EQ+QNSAN+DNICIICMDELIHS 
Sbjct: 301 KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSP 360

Query: 359 NQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFXXXXX 418
           NQQ W        RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQT F     
Sbjct: 361 NQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTF----T 416

Query: 419 XXXXXXXXXXXXXXXXXXXXQYISTNDTELIPTRTIPHDAGIXXX----XXXXXXXXXXX 474
                               Q    N+ +L+PTRT   D  I                  
Sbjct: 417 SNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTST 476

Query: 475 XXXTWYTFPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQ 534
              TWYTFPL +TG+ S  S  S YEFLI++S+EK+N IPVKLT+E+HE+NS  G   EQ
Sbjct: 477 PSPTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQ 536

Query: 535 GAQKRIVIPDQFIQHI 550
            A K+IVIPD+FIQHI
Sbjct: 537 IA-KKIVIPDKFIQHI 551

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  452 bits (1164), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 243/548 (44%), Positives = 326/548 (59%), Gaps = 61/548 (11%)

Query: 2   VPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXX 61
           + E R++Q + F +  Y LT Y VY+AT+TS+SFLQ  L+L EGFN++++++F       
Sbjct: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62

Query: 62  XXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121
                    FG LRLIE+EHIFERLPFTIINT+ MSSMF E  F TVA +GLLLL++KVF
Sbjct: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122

Query: 122 HWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVV 181
           HWI++DRLEALLQ+I +STTL  LIF+RF+FNL LLA+ DYQII+ C+S+   N      
Sbjct: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSF--GA 180

Query: 182 STSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXS 241
           S S++LM  MEF +LLIDLLN  L  +L F+EFY   QSQ++                  
Sbjct: 181 SASVHLMMGMEFALLLIDLLNTTLHAALCFYEFY---QSQTH------------------ 219

Query: 242 GEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 301
           G  +A           QF+GLEGKF+YE+ ID+ TRFLKT LH  +L+PFRMP+ML+KDV
Sbjct: 220 GRRNA---VNDDEDDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDV 276

Query: 302 VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQ 361
           +WD L L+Q+A  LWKIWRNNKQLDD L T++ +Q++N    DN+CIICMDELI   ++ 
Sbjct: 277 LWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNI---DNMCIICMDELIPEQDEG 333

Query: 362 AWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFXXXXXXXX 421
                     RLPCGH+LHL CLKNWMERSQTCPICRL VFDE GNVVQ+          
Sbjct: 334 HTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAE--- 390

Query: 422 XXXXXXXXXXXXXXXXXQYISTNDTELIPTRTIPHDAGIXXXXXXXXXXXXXXXXXTWYT 481
                              ++  D   +P   +                       +WY+
Sbjct: 391 -------------------VTPTDEINVPETVVERSQEQIQDNQQQMGEGQVAVLDSWYS 431

Query: 482 FPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGAQKRIV 541
           FP+++T          T+    S++NE   ++P  L +E    N+ +  +++    + I+
Sbjct: 432 FPVEETS-----ENLVTFSMKNSATNE---TVPASLLIE--RTNASERYDDDDDQVETII 481

Query: 542 IPDQFIQH 549
           IPD+ +  
Sbjct: 482 IPDEVVDQ 489

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  442 bits (1137), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 226/416 (54%), Positives = 282/416 (67%), Gaps = 25/416 (6%)

Query: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXX 63
           + RR+Q+  F +  Y LT Y VY++ +TSVSFLQ T+KL  GFN+++L++F         
Sbjct: 5   DTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLW 64

Query: 64  XXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123
                  FG L L+E+EHIFERLPFTIINT+FMSSMFHE+ FFTV  FGLLLLY+KVFHW
Sbjct: 65  KLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMKVFHW 124

Query: 124 IIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVVST 183
           I+KDRLEALLQSI++STTLK+LI +RFSFNL LLA+ DY+I++ CI++  +N      ST
Sbjct: 125 ILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSF--GAST 182

Query: 184 SLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXSGE 243
           S++LM  MEF MLLIDLLNL + T LNF+EFY +Q         +             G+
Sbjct: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQ---------VDAHLSSVDTDTDGGD 233

Query: 244 PHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVW 303
              E           F GLEGKFMYE+ IDVFTRFLKT +H  MLIPFRM ++L+KDV W
Sbjct: 234 EENE---DEDVNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFW 290

Query: 304 DVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHS------ 357
           DVL L Q  ++LW+IW+NNKQLDD L T++  ++  +   DNICI+CMDEL         
Sbjct: 291 DVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELCADLEEVVQ 347

Query: 358 --ANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQT 411
               ++          RLPCGH+LHL CLKNWMERSQTCPICRLPVFDE GNVVQ+
Sbjct: 348 GPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQS 403

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  384 bits (986), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 216/548 (39%), Positives = 304/548 (55%), Gaps = 54/548 (9%)

Query: 2   VPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXX 61
           V +NRR Q + + V TY    + VY +  +SV+FLQ T+KL EG NL++L  F       
Sbjct: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62

Query: 62  XXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121
                    FGELRLIE+EH+FERL FTI+N++F+SSMF E+ F TV  F  +L++LKVF
Sbjct: 63  LWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 122

Query: 122 HWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVV 181
           HWI+KDRLE + Q+ N++T LK ++FSRF+FNL  LA  DYQ++  C+S+  +N      
Sbjct: 123 HWILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISNDQW--T 180

Query: 182 STSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXS 241
           S+S+YLM  ++F MLL+D L++ L   +NF E Y  Q   S+ +                
Sbjct: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYD---------------- 224

Query: 242 GEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 301
                           +F GLEGKFMYEK ID+  R LK  LH+++LIPFRMP+M++KD+
Sbjct: 225 ---------------EEFLGLEGKFMYEKLIDMGARLLKMLLHIALLIPFRMPIMIIKDI 269

Query: 302 VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQ 361
           +WD ++LYQ+AT+LWK W+N K+LD+ L  VT E++ N  N  N+CI+CMD+++ ++  +
Sbjct: 270 IWDAISLYQTATSLWKTWKNAKKLDEKLPDVTEEEL-NQGN--NMCIVCMDDMLPNSETR 326

Query: 362 AWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFXXXXXXXX 421
                     +LPCGHILHLSCLK+WMERSQTCPICRLPVFDE+GNV +           
Sbjct: 327 ---NANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLP 383

Query: 422 XXXXXXXXXXXXXXXXXQYISTNDTELIPTRTIPHDAGIXXXXXXXXXXXXXXXXXTWYT 481
                                T    + PT T P  A                    WY 
Sbjct: 384 HNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQAN-----RSVIMPQVPRVPQDWYA 438

Query: 482 FPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGAQKRIV 541
           FP++ T  T  +     ++ + S +NE   ++  K   +  ++       E  G Q RI 
Sbjct: 439 FPIEATQTTKDK---VVFKLVDSDNNEITANLLTKTRPQFQKVT------EVSGGQ-RIT 488

Query: 542 IPDQFIQH 549
           IP   I+ 
Sbjct: 489 IPQSCIEQ 496

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  381 bits (978), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/578 (40%), Positives = 319/578 (55%), Gaps = 65/578 (11%)

Query: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           M+ ++R++QLV F ++ YLLT   ++++ K+S +FLQ T+KL +G N+++L+IF      
Sbjct: 1   MIVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120
                     FGELRLIEHEHIFERLPFTIIN LFM S+F+E  FF    F L+L  LKV
Sbjct: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120

Query: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCI----------- 169
           FHWI+KDRLE+LLQSIND+T LK LIFSR+  NLA+ ++ D+ I +              
Sbjct: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNS 180

Query: 170 --------SSIYTNKN--IDVVSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQ 219
                   SS   NKN        +L+L+  MEF +L +DL+NL + T LNF+EFYCSQ+
Sbjct: 181 TNNNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240

Query: 220 SQSNENNHIXXXXXXXXXXXXSGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFL 279
           + ++ N                 +  +E           F GLEGKFMYEK IDV T+F 
Sbjct: 241 ATAHHN------------VNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFF 288

Query: 280 KTALHLSMLIPFRMPMMLLKDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQN 339
           KT +H+ +LI  ++ +M+LKDVVWD L LYQ + +LWKI++NNKQLDD L T+++  ++N
Sbjct: 289 KTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVEN 348

Query: 340 SANEDNICIICMDELIHSAN-------QQAWXXXXXXXXR---LPCGHILHLSCLKNWME 389
             + DNICI+CMD+L+ S +        QA         R   LPCGH+LHLSCLKNWME
Sbjct: 349 --DNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWME 406

Query: 390 RSQTCPICRLPVFDEKGNVVQTPFXXXXXXXXXXXXXXXXXXXXXXXXXQYISTNDTELI 449
           RSQTCPICRLPVFDE GNV   PF                         +  ++     +
Sbjct: 407 RSQTCPICRLPVFDENGNV--KPFLHTTTNNNMQPNNDADVTSTTATNSRTDTSTPMTDV 464

Query: 450 PTRTIPHDAGIXXXXXXXXXXXXXXX---XXTWYTFPLQQTGNTSGESKCSTYEFLISSS 506
           PT T    + +                     WY F +    +   E K     F + ++
Sbjct: 465 PTPTRTSASALTTSSIITQDFKNGITPIDSVEWYAFEIDSISDARNEVK-----FNVRNA 519

Query: 507 NEKDNSIPVKLTVESHELNSEQGREEEQGAQKRIVIPD 544
           +  + SIP+KL +E            E+ A+ +IVIPD
Sbjct: 520 SSNNRSIPMKLLIE----------RMEETAEGQIVIPD 547

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  374 bits (961), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 197/420 (46%), Positives = 266/420 (63%), Gaps = 30/420 (7%)

Query: 6   RRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXX 65
            +++ + F  +TY+LT YCV SA ++SVSFLQ+ LKL+EGFN++++++F           
Sbjct: 6   HKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQF 65

Query: 66  XXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHWII 125
                FGELR+IEHEHIFERLPF +INT+FM S F+E+YFFT+A   L+LLY+KVFHWI+
Sbjct: 66  LTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWIL 125

Query: 126 KDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCI-------SSIYTNKNI 178
           +DRL+ LLQ IN+ T  K L+ +R+  NL LL + D  +I+ C+       SSI+T    
Sbjct: 126 RDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTN 185

Query: 179 DVVSTS---------LYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIX 229
            +V            +Y+MQ MEFT L+IDL+NL L T L F+EF+ S++   N      
Sbjct: 186 SIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNNPTFNS 245

Query: 230 XXXXXXXXXXXSGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLI 289
                       G+              QF GLEGKFMYEK IDV TRFL+T +H+ M +
Sbjct: 246 ISAEDADTESEDGD-------------SQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAM 292

Query: 290 PFRMPMMLLKDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICII 349
              +P+ML+KD+  DV  LY ++ +L  IW+N+KQLD  L T+T + + N  N DN+CI+
Sbjct: 293 VLNLPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIV 352

Query: 350 CMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVV 409
           CMDEL+ S N            +LPCGH+LHLSCLKNWMERSQTCPICRLPVFDE G ++
Sbjct: 353 CMDELV-SENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEIL 411

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  373 bits (957), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 275/425 (64%), Gaps = 42/425 (9%)

Query: 6   RRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXX 65
           R+ QL     V Y  T +  Y A ++S S+LQVT+KL +G N+++L +F           
Sbjct: 8   RKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKG 67

Query: 66  XXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHER-YFFTVAFFGLLLLYLKVFHWI 124
                F  LRLIE+EHI ERLPFTIIN   +SSMF+ER    +++ +G++L+++KV HW+
Sbjct: 68  LMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWV 127

Query: 125 IKDRLEALLQSINDSTTLKTLIFS-RFSFNLALLALTDYQIITRCISSIYTNKNIDVVST 183
           +KDRLE+LLQS+ND++++++LIFS RF  NL L A+ DYQ++ +C+++  + KN    ST
Sbjct: 128 LKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTN--SIKNSMGAST 185

Query: 184 SLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXSGE 243
           S++L+  +EFTMLL+DL+NLFL T LN +EF+   +S  + N +I             GE
Sbjct: 186 SIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFH---KSIEDRNLNIV------------GE 230

Query: 244 PHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVW 303
               L         +F  LEGKFMYEKAID+FTRFLKT LHL M IPFRM ++LLKDV+W
Sbjct: 231 DEDGLVDDE----EEFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIW 286

Query: 304 DVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIH------- 356
           DV+ LYQS  +LWK WRN+KQLD+ L TV++E++++S N+  +CI+CMD LI+       
Sbjct: 287 DVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDND--MCIVCMDSLINIDFNSTE 344

Query: 357 --------SANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
                        A         +LPC HILHL CLKNWMERSQTCPICRL VFD  GN+
Sbjct: 345 ETENKEKEEQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404

Query: 409 VQTPF 413
           +  PF
Sbjct: 405 L--PF 407

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  359 bits (921), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/410 (51%), Positives = 273/410 (66%), Gaps = 28/410 (6%)

Query: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXX 63
           ++R  Q V F +  Y+LTF  VY A  +S+SFLQVT+KL +GFN++++SIF         
Sbjct: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINSIILW 64

Query: 64  XXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123
                  FGELRLIE+EH+ ERLPFT+IN +FMSSMF+E   FT     LLLLY+KV +W
Sbjct: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMKVSNW 124

Query: 124 IIKDRLEALLQSINDSTTLKTLIFS-RFSFNLALLALTDYQIITRCIS-SIYTNKNIDVV 181
           I++DRLE+LLQ++NDSTT+  LIFS +F FNL L +L DY ++  CIS S+ +N NI   
Sbjct: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSNIG-S 183

Query: 182 STSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXS 241
           S S+YL+  MEFTMLL+DL N+   + LN +EFY S  S  + + H+             
Sbjct: 184 SASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKS--SLVSLDTHL----------TSE 231

Query: 242 GEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 301
            E   E           F GLEGKF+YEK ID FTRFLKT +H+ +LIPF MP+ML KDV
Sbjct: 232 DEEDDE---------SGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDV 282

Query: 302 VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQ 361
           V D++ L Q+  T+WKIW NN++LDD L TVT  Q Q  + ED ICIICMD+L  ++ Q+
Sbjct: 283 VIDLVTLSQNINTIWKIWVNNRKLDDQLPTVT--QHQLDSMEDKICIICMDDLSINSIQK 340

Query: 362 AWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQT 411
            +         LPCGHILH++CLKNWMERSQTCP+CRLPVF+EKG V+ T
Sbjct: 341 NFEKRKPKM--LPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPT 388

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  354 bits (908), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/434 (42%), Positives = 262/434 (60%), Gaps = 51/434 (11%)

Query: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXX 63
           + RR QL+AF  + Y+LT  C+ ++   S SFL ++LKLN+GFN+M+++IFI        
Sbjct: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLW 62

Query: 64  XXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123
                  F ELRLIE EHI ERLPFTIIN +F+S+MF+E++F T+AF+G +LLY+K+F+W
Sbjct: 63  KFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122

Query: 124 IIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCI-------SSIYTNK 176
           I+KDRLE L+QS N + ++   IFS+F  NL +L+  + Q+I  CI         +Y N 
Sbjct: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181

Query: 177 -------------------NIDVVSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCS 217
                              N ++    +YLM  MEF +LLI+ +NLFL + L+ +E Y S
Sbjct: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYKS 241

Query: 218 QQSQSNENNHIXXXXXXXXXXXXSGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTR 277
            Q                       +               F GLE KF+YEK ID+FTR
Sbjct: 242 NQYDQLNAIIEDIEDENDDDDDTPAD---------------FNGLENKFIYEKIIDLFTR 286

Query: 278 FLKTALHLSMLIPFRMPMMLLKDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQM 337
            L T +H+S+ +P  +PM++LKD++WD+++LYQ+   L++I +NNK LD  L  +  E +
Sbjct: 287 SLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDL 346

Query: 338 QNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPIC 397
           Q+S   DN+CI+CMD+L+   +++          RLPCGH LHLSCLKNWMERSQTCPIC
Sbjct: 347 QDS---DNVCIVCMDDLLSEEHKKK------KAKRLPCGHFLHLSCLKNWMERSQTCPIC 397

Query: 398 RLPVFDEKGNVVQT 411
           RLPVFDE GNV ++
Sbjct: 398 RLPVFDESGNVKES 411

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  353 bits (905), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/455 (41%), Positives = 270/455 (59%), Gaps = 51/455 (11%)

Query: 6   RRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXX 65
           ++ Q V F +  YL+TF+ + +A  +S SFL + LKLNEGFN+M+++IFI          
Sbjct: 11  KKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLSWKL 70

Query: 66  XXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHWII 125
                F +LRLIE EHI ERLPFT+IN + M++MF+ER+FFT+  +GLLL+ L+V+HWI+
Sbjct: 71  ITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVYHWIL 130

Query: 126 KDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRC----------------- 168
           KDRLE ++Q+INDST++  +IFS+FSFNL  L+L + ++I  C                 
Sbjct: 131 KDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKNNQNLFN 190

Query: 169 ---------ISSIYTNKNIDVVSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQ 219
                    ISS   +  I+  S  +YLM  MEF++LL++  N+   + L+ +EFY S+Q
Sbjct: 191 SIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYKSKQ 250

Query: 220 SQSNENNHIXXXXXXXXXXXXSGEPHAEL------XXXXXXXXRQFTGLEGKFMYEKAID 273
               +                + E    +                F GLEGKF+YEK ID
Sbjct: 251 FSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEKIID 310

Query: 274 VFTRFLKTALHLSMLIPFRMPMMLLKDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVT 333
           +FTRFL T +H+S+L+P  +PM+L+KD++WD  +LY++A +L+KIW+NN++L+  L  +T
Sbjct: 311 LFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALPNMT 370

Query: 334 IEQMQNSANEDNICIICMDELI----------------HSANQQAWXXXXXXXXRLPCGH 377
            + +Q+S   DN+CIICMD+L+                 S+N            +LPCGH
Sbjct: 371 PDDLQHS---DNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCGH 427

Query: 378 ILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTP 412
            LH SCLKNWMERSQTCPICRL VFD+ GNV   P
Sbjct: 428 FLHFSCLKNWMERSQTCPICRLDVFDKNGNVKVYP 462

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  343 bits (879), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/406 (47%), Positives = 261/406 (64%), Gaps = 37/406 (9%)

Query: 21  TFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXXXXXXXFGELRLIEHE 80
           TF  +Y A  +S S+LQVT+KL++GFN +VL +F                FG LRLIE+E
Sbjct: 24  TFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYE 83

Query: 81  HIFERLPFTIINTLFMSSMFHERYF-FTVAFFGLLLLYLKVFHWIIKDRLEALLQSINDS 139
           H+ ERLPFTI+N +   SMF+++   FT + FG  L+++KV HWI++DRL+A++QS NDS
Sbjct: 84  HVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFNDS 143

Query: 140 TTLKTLIFSR-FSFNLALLALTDYQIITRCISSIYTNKNIDVVSTSLYLMQVMEFTMLLI 198
           +TL ++I S  F  NL +  + DY++++ C+S+  +N      ST+++L+  MEFTMLLI
Sbjct: 144 STLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSM--GASTTVHLLLGMEFTMLLI 201

Query: 199 DLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXSGEPHAELXXXXXXXXRQ 258
           DLLNLFL T LN +EF+ +   +S                  S     +          Q
Sbjct: 202 DLLNLFLHTCLNLYEFHLTTLERS------------------SNIIQEDGEDDEEDDELQ 243

Query: 259 FTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPM-MLLKDVVWDVLALYQSATTLWK 317
           F  LEGKFMYEK IDVFTRFLKT +H+ MLIP RM   +LLKDV+W+V++LY+   +LWK
Sbjct: 244 FNSLEGKFMYEKTIDVFTRFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWK 303

Query: 318 IWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAW------------XX 365
            W+NNKQLDD L T +IE+++N+ N  NICI+CMD+L+   N + +              
Sbjct: 304 TWKNNKQLDDKLPTASIEELKNTDN--NICIVCMDDLLPRINSEKYDSQREKELYDHIMK 361

Query: 366 XXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQT 411
                 +LPCGHILHL+CLKNWMERSQTCPICRLPVFD+KGNV+ +
Sbjct: 362 SKQKPKKLPCGHILHLNCLKNWMERSQTCPICRLPVFDDKGNVMPS 407

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  308 bits (789), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 153/404 (37%), Positives = 234/404 (57%), Gaps = 36/404 (8%)

Query: 6   RRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXX 65
           +R+Q V + V TY    + V    + S+SFL   LKL EG NL+VL  F           
Sbjct: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKG 65

Query: 66  XXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHWII 125
                FGELRL+E+EHIFERL FTI+N  FMSS F E  F TV     LL +++VFHW++
Sbjct: 66  LTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125

Query: 126 KDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVVSTSL 185
           KDRLE + Q  ++ T +  L+ SRF  N+ + A+ DYQ++  C+ +  TNK+    S  +
Sbjct: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185

Query: 186 YLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXSGEPH 245
           Y++  ++F+MLL+D+  + +++ +N  E    +++   + +                   
Sbjct: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGD------------------- 226

Query: 246 AELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDV 305
                        F GL+GKFMYEK + +  + LK  L ++ L PF MP+M+ KD++WD 
Sbjct: 227 ------------DFVGLDGKFMYEKLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDG 274

Query: 306 LALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWXX 365
           +AL+ +  ++W+ W++N+Q+D+ L  VT  Q+  +A+ED +CI+CM++++  +   +   
Sbjct: 275 IALFHTGKSVWRTWKSNRQIDEKLPDVTEAQL--NASEDKMCIVCMEDMLPPSEATS--- 329

Query: 366 XXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVV 409
                 +LPC H LHL CLK+WMERSQTCPICR+ VFD KGNV 
Sbjct: 330 AKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  303 bits (776), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 155/413 (37%), Positives = 240/413 (58%), Gaps = 38/413 (9%)

Query: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           M    +R+Q  A++  +Y    + +    + S+SFL+++ +L EG NL++L  F      
Sbjct: 1   MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGV 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120
                     FGELRL+E+EHIFERL FTI+N  FMSS F E  F +V  F   L+++KV
Sbjct: 61  LLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKV 120

Query: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCI--SSIYTNKNI 178
           FHW+++DRLE + Q  ++ T    L+ SRF FN+ LL   D+Q+   CI  +  ++    
Sbjct: 121 FHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF 180

Query: 179 DVVSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXX 238
              S S++LM  +EF MLL+D+  + +++ +N  E Y  ++S + +              
Sbjct: 181 YSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKRSFARD-------------- 226

Query: 239 XXSGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL 298
              GE               +TGLEGKFMYEK + +  +  +  LH+ +++PF MP+M+ 
Sbjct: 227 ---GE--------------DYTGLEGKFMYEKVVQLICQLTRMGLHIMLMMPFSMPLMIA 269

Query: 299 KDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSA 358
           KD++WD  A++ +A +L   W++N+Q+D+ L  V+  Q+  +A++D +CI+CMD+++  +
Sbjct: 270 KDILWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQL--AASDDKMCIVCMDDMLAPS 327

Query: 359 NQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQT 411
                        RLPC H LHL CLK+WMERSQTCPICR+PVFD+KGNVV T
Sbjct: 328 E---CTNAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVVVT 377

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  288 bits (736), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 169/444 (38%), Positives = 237/444 (53%), Gaps = 56/444 (12%)

Query: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXX 63
            +R++Q    +VV YLLT + V +A   S +FL+ T  L +G N ++++ F         
Sbjct: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66

Query: 64  XXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123
                  FG+LRLIE EHIFER+P T+IN + +SS+  ++Y F +   G LLL LKV HW
Sbjct: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSHW 126

Query: 124 IIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTN-KNIDVVS 182
           I++DRLE  LQ IND+TTL +L+FS+FS NL +  + DY +   C  + + N  +    S
Sbjct: 127 ILRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFGNFYHHGDFS 186

Query: 183 TSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXSG 242
               +M  +E+ ++ IDL+N+   T LNF+ F+ +Q  QS   N              SG
Sbjct: 187 NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQL-QSARFNLEMMNDDFSEDENDSG 245

Query: 243 EPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVV 302
                             GLEGKF+YEK ID     L+T LH +MLIP R   ML+KD V
Sbjct: 246 -------------VNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFV 292

Query: 303 WDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELI---HSAN 359
           WD+  L  +  +LWKI++NN+QL+  L  + IE +    + DN+CI+CMD+L+   H   
Sbjct: 293 WDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDL---LDHDNMCIVCMDDLVLVHHPTK 349

Query: 360 QQA-----------------------------------WXXXXXXXXRLPCGHILHLSCL 384
           ++                                             +LPCGH+LH SCL
Sbjct: 350 RRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCL 409

Query: 385 KNWMERSQTCPICRLPVFDEKGNV 408
           KNWMERSQTCPICR+PVFD+ GNV
Sbjct: 410 KNWMERSQTCPICRVPVFDKDGNV 433

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  228 bits (581), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 211/405 (52%), Gaps = 19/405 (4%)

Query: 8   KQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXXXX 67
           ++ +A+ +++Y    + ++    TS S+L    K+ EG + M+                 
Sbjct: 24  QKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVI 83

Query: 68  XXXFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHWIIKD 127
              FG+LRLIE+EHI ER+ +T+I TL +S          +    +L +  +  HWI+KD
Sbjct: 84  HMLFGQLRLIEYEHILERISYTVI-TLLLSCSSMNGLISVMQIHCVLFVCCRTLHWILKD 142

Query: 128 RLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVVSTSLYL 187
           R+E   Q+ +   TLK ++ SRF FNL +L   D  I+   ++ I    NIDV  T   L
Sbjct: 143 RMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVTYT---L 199

Query: 188 MQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQS---QSNENNHIXXXXXXXXXXXXSGEP 244
             + ++ +L  DLL + L+T LN +E    Q     + N ++H+               P
Sbjct: 200 FIISQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEE-----RP 254

Query: 245 HAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWD 304
           +A           +  GLEGKF+YEK IDVF   +K  +  +    F    +++  V+W+
Sbjct: 255 NAVAIEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFAS--SFSTGRVMMVTVLWE 312

Query: 305 VLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWX 364
            +  ++SA  LWK W+++K LD +L+  T   +Q  + E +ICI+CM++ + S  +++  
Sbjct: 313 AITTFKSARGLWKNWKSSKSLDASLMDAT--DIQIESGEIDICIVCMEDFLPSHQRKS-- 368

Query: 365 XXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVV 409
                   LPC H LHLSCLKNW+ RS TCPICRLP+FDE GNV+
Sbjct: 369 -DGKKVKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVM 412

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  176 bits (447), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 115/398 (28%), Positives = 190/398 (47%), Gaps = 36/398 (9%)

Query: 13  FIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXXXXXXXFG 72
           FI  TY L  +  YS   +    L      + G + ++   F+               FG
Sbjct: 13  FITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVLFG 72

Query: 73  ELRLIEHEHIFERLPFTIINTLFMSSMFHERYF---FTVAFFGLLLLYLKVFHWIIKDRL 129
           +L  IE++HIFERL   ++    +     + Y     T+ F+ L L    V HW+++DR+
Sbjct: 73  QLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRDRM 128

Query: 130 EALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVVSTSLYLMQ 189
           + + Q     ++L  ++ SRF F+L +L + DY+++  C+     N N+D     LYLM 
Sbjct: 129 DFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQ----NTNVDGKRHELYLML 184

Query: 190 VMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIXXXXXXXXXXXXSGEPHAELX 249
            + F  L++D+L++ L TSLN +E   S++++S    +                   E  
Sbjct: 185 ALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVY-------------------EGG 225

Query: 250 XXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDVLALY 309
                   +   LEGK++YE   D+    LK  L +   +     + ++  +    +   
Sbjct: 226 TTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAG 285

Query: 310 QSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWXXXXXX 369
           +S   ++  W+NNK+L + L  V+ EQ+ ++   D++CIICMD+++ +            
Sbjct: 286 ESFLLVYNYWKNNKKLYEKLSDVSEEQLDDT---DSMCIICMDDMLPTTET---TKMNRR 339

Query: 370 XXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGN 407
              LPCGH+LH  CLK+WMERSQTCPICRL VF    N
Sbjct: 340 AKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  164 bits (415), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 112/407 (27%), Positives = 189/407 (46%), Gaps = 46/407 (11%)

Query: 13  FIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXXXXXXXFG 72
           FI VTY L  + +Y+ T TS+SFLQ   K   G +L++   F+               FG
Sbjct: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72

Query: 73  ELRLIEHEHIFERLPFTIINTL-FMSSMFHERYFFTVAFFGLLLLYLKVFHWIIKDRLE- 130
            L L+E+EHIFERL  T++++L  + +M  +     V      +L  +V HW+++DR+E 
Sbjct: 73  RLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVL-CQVLHWVVRDRMEF 131

Query: 131 ALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISS-----------IYTNKNID 179
                I     +K L+FSRF  ++ +L + D++++                 ++++   +
Sbjct: 132 VFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQN 191

Query: 180 VVSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCS----QQSQSNENNHIXXXXXXX 235
                L L   ++F +L +D L + L   L F E + +    Q+ Q  +NN +       
Sbjct: 192 TSEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQLLDNNELENDIEDD 251

Query: 236 XXXXXSGEPHAELXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPM 295
                                     LE KF+YEK ++     LK  L++ ++       
Sbjct: 252 GAFI----------------------LEEKFIYEKIVETVLEILKILLNIFLITSGIHSF 289

Query: 296 MLLKDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELI 355
           ++  ++    +   +    L+  W+NN++L + L+ VT   +      D  C ICMD+++
Sbjct: 290 VVFYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV---DITCTICMDDML 346

Query: 356 HSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVF 402
            S + +           LPCGH+LH  CLK+WM+R+QTCPICR PVF
Sbjct: 347 PSKDVKV---NNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 18/78 (23%)

Query: 335 EQMQNSANEDNI--CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSC 383
           E +++ A+E++   C ICM E+          H+ +QQ++          PC HI H +C
Sbjct: 684 ELLEHGASENHTVDCAICMSEVPVYVKDIPETHAVDQQSYMVT-------PCNHIFHTAC 736

Query: 384 LKNWMERSQTCPICRLPV 401
           L+NWM     CP+CR P+
Sbjct: 737 LENWMGYKLQCPVCRAPL 754

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 34/77 (44%), Gaps = 16/77 (20%)

Query: 334 IEQMQNSANEDNICIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCL 384
           +E  Q S      C ICM E+          H  +Q ++          PC HI H SCL
Sbjct: 689 MEHGQTSEVNTVDCSICMSEIPVYVEELPETHKVDQHSYMVT-------PCNHIFHTSCL 741

Query: 385 KNWMERSQTCPICRLPV 401
           +NWM     CP+CR P+
Sbjct: 742 ENWMSYKLQCPVCRAPL 758

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 18/78 (23%)

Query: 335 EQMQNSANEDNI--CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSC 383
           E M++ ++ D+   C ICM E+          H  + Q +          PCGH+ H  C
Sbjct: 689 ELMEHGSSVDHTVDCAICMSEVPVYVEDVPETHKVDLQTYMTT-------PCGHVFHTQC 741

Query: 384 LKNWMERSQTCPICRLPV 401
           L+NWM     CP+CR P+
Sbjct: 742 LENWMSYKLQCPVCRSPL 759

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 17/78 (21%)

Query: 334 IEQMQNSANEDNI-CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSC 383
           I +  + A E+ + C ICM ++          H  +Q ++          PC H+ H SC
Sbjct: 685 ISEHGSGAAENTVDCTICMSDVPIYIEEIPETHKVDQHSYMVT-------PCDHVFHTSC 737

Query: 384 LKNWMERSQTCPICRLPV 401
           L+NWM     CP+CR P+
Sbjct: 738 LENWMSYKLQCPVCRSPL 755

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 22/145 (15%)

Query: 266 FMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDVLALYQSATTLWKIWRNNKQL 325
           F Y   I    R  +  + LS+ + F++ +M  +D++     L Q +     I+     L
Sbjct: 627 FTYSSNIFRHHRDPRFVVFLSLWLLFQLSIMYSQDILGARWFLPQHSIPEGYIYFKPVSL 686

Query: 326 DDTLITVTIEQMQNSANEDNICIICMDEL---------IHSANQQAWXXXXXXXXRLPCG 376
                   + + + ++     C ICM E+          H+ +Q ++          PC 
Sbjct: 687 ------AHLAKHEGASKHTADCAICMSEVPVYIEEAEETHNIDQHSYMVT-------PCD 733

Query: 377 HILHLSCLKNWMERSQTCPICRLPV 401
           HI H  CL+NWM     CP+CR P+
Sbjct: 734 HIFHTDCLENWMGYKLQCPVCRTPL 758

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 16/76 (21%)

Query: 335 EQMQNSANEDNICIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLK 385
           E    +A     C ICM ++          H  +Q ++          PC H+ H SCL+
Sbjct: 687 EHGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVT-------PCNHVFHTSCLE 739

Query: 386 NWMERSQTCPICRLPV 401
           NWM     CP+CR P+
Sbjct: 740 NWMNYKLQCPVCRSPL 755

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 16/64 (25%)

Query: 347 CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPIC 397
           C ICM ++          H  +Q ++          PC H+ H SCL+NWM     CP+C
Sbjct: 699 CAICMSDVPIYIEEIPETHKVDQHSYMVT-------PCNHVFHTSCLENWMSYKLQCPVC 751

Query: 398 RLPV 401
           R P+
Sbjct: 752 RSPL 755

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 20/77 (25%)

Query: 337 MQNSANEDNICI---ICMDELI---------HSANQQAWXXXXXXXXRLPCGHILHLSCL 384
           +++ AN DN C+   ICM EL          H AN   +          PC H+ H  CL
Sbjct: 682 LEHGAN-DNYCVSCAICMSELAIHVEDIPETHKANIHDYMVT-------PCSHLFHTGCL 733

Query: 385 KNWMERSQTCPICRLPV 401
           +NWM     CP+CR P+
Sbjct: 734 ENWMSYKLQCPVCRAPL 750

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 16/64 (25%)

Query: 347 CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPIC 397
           C ICM E+          H  ++Q +          PC HI H  CL+NWM     CP+C
Sbjct: 706 CAICMSEVPIRVEEVPETHKVDEQTYMVT-------PCAHIFHTQCLENWMSYKLQCPVC 758

Query: 398 RLPV 401
           R P+
Sbjct: 759 RSPL 762

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 17/84 (20%)

Query: 328 TLITVTIEQMQNSANEDNI-CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGH 377
            L T  I +      E+ + C ICM ++          H  +Q ++          PC H
Sbjct: 680 ALSTEYISEHGGGTAENTVDCAICMSDVPIYIEEVPETHKVDQHSYMVT-------PCNH 732

Query: 378 ILHLSCLKNWMERSQTCPICRLPV 401
           + H  CL+NWM     CP+CR P+
Sbjct: 733 VFHTPCLENWMSYKLQCPVCRSPL 756

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 16/64 (25%)

Query: 347 CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPIC 397
           C ICM E+          H+ ++  +          PC HI H +CL+NWM     CP+C
Sbjct: 691 CTICMSEVPVYIQDIEETHNIDKDTYMIT-------PCNHIFHTTCLENWMSYKLQCPVC 743

Query: 398 RLPV 401
           R P+
Sbjct: 744 RAPL 747

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 16/64 (25%)

Query: 347 CIICMDELI---------HSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPIC 397
           C ICM E+          H  N   +          PC H+ H  CL+NWM     CP+C
Sbjct: 699 CAICMSEVAIYVEDIPETHKTNPNEYMVT-------PCAHVFHTECLENWMSYKLQCPVC 751

Query: 398 RLPV 401
           R P+
Sbjct: 752 RAPL 755

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 16/72 (22%)

Query: 339 NSANEDNICIICM---------DELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWME 389
            S N   +C ICM          E  H  + Q++          PC HI H  CL+NWM 
Sbjct: 690 GSQNNCFVCPICMVDVPVYVEETEETHKIDAQSYMIT-------PCSHIFHTECLENWMS 742

Query: 390 RSQTCPICRLPV 401
               CP+CR P+
Sbjct: 743 YKLQCPVCRAPL 754

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 347 CIICM-DELIHSAN-QQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPV 401
           C ICM D  I+ ++ ++            PCGHI H  CL++WM     CP+CR P+
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 16/72 (22%)

Query: 339 NSANEDNICIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWME 389
           +S N    C ICM+++          H  +++++          PC HI H  CL++WM 
Sbjct: 680 SSPNYSIDCAICMNDVPVYVDDIPKTHKVDKESYMIT-------PCSHIFHTQCLESWMS 732

Query: 390 RSQTCPICRLPV 401
               CP+CR P+
Sbjct: 733 YKLQCPVCRAPL 744

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 18/76 (23%)

Query: 337 MQNSANEDNI--CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLK 385
           +++ A+ D+   C ICM E+          H  +  ++          PC H+ H  CL+
Sbjct: 683 LEHGASSDHTVDCAICMSEVPVYVDDVPTTHKVDLDSFMIT-------PCNHVFHTQCLE 735

Query: 386 NWMERSQTCPICRLPV 401
           NWM     CP+CR P+
Sbjct: 736 NWMGYKLQCPVCRAPL 751

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 16/64 (25%)

Query: 347 CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPIC 397
           C ICM  +          H  +Q ++          PC HI H  CL+NWM     CP+C
Sbjct: 703 CSICMSGIPLYVDDKPETHKVDQYSYMVT-------PCNHIFHTECLENWMSYKLQCPVC 755

Query: 398 RLPV 401
           R P+
Sbjct: 756 RTPL 759

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 18/76 (23%)

Query: 337 MQNSANEDNI--CIICMDEL---------IHSANQQAWXXXXXXXXRLPCGHILHLSCLK 385
           M++  +E++   C ICM E           H  ++ ++          PC H+ H SCL+
Sbjct: 686 MEHGGSENHTVDCAICMAEFPVYVEELPETHQVDKDSYMIT-------PCDHMFHTSCLE 738

Query: 386 NWMERSQTCPICRLPV 401
           +WM     CP+CR P+
Sbjct: 739 SWMSYKLQCPVCRSPL 754

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVFDEK 405
           LPCGH+    CL  W     +CPICR P+  E+
Sbjct: 217 LPCGHVFGRECLYKWTTEHNSCPICRAPILSEE 249

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 16/64 (25%)

Query: 347 CIICMDELI---------HSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPIC 397
           C ICM E+          H  ++  +          PC HI H  CL++WM     CP+C
Sbjct: 691 CAICMSEVAVYVDDIPETHKVDKDDYMIT-------PCSHIFHTQCLESWMSYKLQCPVC 743

Query: 398 RLPV 401
           R P+
Sbjct: 744 RAPL 747

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 406
           +LPCGHI    C++ W     TCPICR  +    G
Sbjct: 228 KLPCGHIFGRECIRQWTNEHNTCPICRARIVGADG 262

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
           LP C H   L C+  W+ +S+TCP+CR  V   K NV
Sbjct: 53  LPHCNHRFDLECVAVWLSKSRTCPLCRDDVLSHKPNV 89

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 372 RLP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
           RLP CGH   L CL  W  +S +CP+CR  V   +  V
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEV 129

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
           LP CGH   L C+  W+ RS TCP+CR  V   K  +
Sbjct: 108 LPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEI 144

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 18/77 (23%)

Query: 333 TIEQMQNSANEDNI--CIICMD---------ELIHSANQQAWXXXXXXXXRLPCGHILHL 381
           +IE    S +E     C ICM          E  H  +  ++          PC HI H 
Sbjct: 687 SIEHGGGSKDEPYTVDCAICMSPVPVYIEEVEGTHKVDIHSYMVT-------PCNHIFHT 739

Query: 382 SCLKNWMERSQTCPICR 398
            CL+NWM     CP+CR
Sbjct: 740 ECLENWMGYKLQCPVCR 756

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 406
           LPCGHI    C+  W +   +CPICR  + +++G
Sbjct: 279 LPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQ 410
           RLPCGH+    CL  W     +CP+CR  + +  G  VQ
Sbjct: 272 RLPCGHVFGRECLYKWSRLENSCPLCRHKISESAGVPVQ 310

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 13/56 (23%)

Query: 343 EDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           E   CI+CM  +I+ +               PCGHI   +CL NW +  + CP+CR
Sbjct: 271 ESRKCILCMSFMINPSCA-------------PCGHIYCWNCLINWCKEKEECPLCR 313

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 13/59 (22%)

Query: 347 CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEK 405
           CI+C+++++  +               PCGHI    CL +W +    CP+CR P   ++
Sbjct: 290 CILCLNDMVDPSCS-------------PCGHIFCWRCLMDWCQERAECPLCRQPCLPQQ 335

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 16/72 (22%)

Query: 329  LITVTIEQMQNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWM 388
            L T+T E  +N+  E   C IC+  + + A              + CGH+   SC+ +W+
Sbjct: 1149 LSTLTYEAQKNTTME---CSICLQPITNGA-------------MVNCGHLFCTSCIFSWL 1192

Query: 389  ERSQTCPICRLP 400
            +  +TCP+C+ P
Sbjct: 1193 KNRKTCPLCKHP 1204

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 40.0 bits (92), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 372 RLP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
           +LP C H   L C+  W+ +S+TCP+CR  V   K  V
Sbjct: 100 KLPHCSHRFDLECVAVWLSKSRTCPLCRDDVLSHKPKV 137

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
           LP CGH   L C+  W+ +S TCP+CR  V   K ++
Sbjct: 122 LPHCGHRFDLECISVWLSKSDTCPLCRDSVLSHKTDI 158

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICR 398
           ++PCGHI   SCL  W     +CP+CR
Sbjct: 292 KIPCGHIFGRSCLYEWTRLENSCPLCR 318

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 355 IHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           +   +++A         +LPCGHI    CL  W +   TCP+CR
Sbjct: 215 VEDNDEEAHPTYNHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 13/52 (25%)

Query: 347 CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           CI+C++E+   +               PCGH+   +C+ NW +  + CP+CR
Sbjct: 318 CILCLNEMTDPSCP-------------PCGHLFCWACIMNWCKEREECPLCR 356

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 39.7 bits (91), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 9/80 (11%)

Query: 327 DTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLP-CGHILHLSCLK 385
           DT I       Q     D+ C IC    I  A++            LP CGH     C+ 
Sbjct: 84  DTFIDSLPRIPQKKLKSDDTCPICCSNFI--ADEYP------LVVELPHCGHKFDFECVS 135

Query: 386 NWMERSQTCPICRLPVFDEK 405
            W+ ++ TCP+CR  V  +K
Sbjct: 136 MWLTKNTTCPMCRDDVTHKK 155

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 406
           +LPCGHI    C+  W +   +CP+CR  + +  G
Sbjct: 253 KLPCGHIFGRECIYKWSKLENSCPLCRHKISESAG 287

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 13/56 (23%)

Query: 343 EDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           E   CI+C++ ++  +               PCGHI    C+ NW +    CP+CR
Sbjct: 274 ESRNCILCLNSMVDPS-------------AAPCGHIFCWDCIINWCKERPECPLCR 316

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICR 398
           +LPCGHI    CL  W +   TCP+CR
Sbjct: 301 KLPCGHIFGRECLFKWSKVENTCPLCR 327

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 37.7 bits (86), Expect = 0.009,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 372 RLP-CGHILHLSCLKNWMERSQTCPICR 398
           +LP CGH     CL  W+ +++TCP+CR
Sbjct: 51  KLPHCGHNFDYECLSIWLSKNKTCPMCR 78

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 337 MQNSANE-DNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQT-- 393
           M++SA E DNIC IC D+L  +   Q            PC H  H  C++ W   S    
Sbjct: 1   MKSSALEGDNICPICFDDLNDTDILQGKLK--------PCNHKYHYDCIRRWHGYSDNSD 52

Query: 394 CPICR 398
           CP+CR
Sbjct: 53  CPLCR 57

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 31/87 (35%), Gaps = 12/87 (13%)

Query: 320 RNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHIL 379
           +N    D    +   EQ Q   NE            +S + Q          +LPC H+ 
Sbjct: 184 QNGPANDGETASSPPEQEQPKDNE------------NSGDDQGKVTYKHSPVQLPCSHVF 231

Query: 380 HLSCLKNWMERSQTCPICRLPVFDEKG 406
              C++ W     TCPICR  +    G
Sbjct: 232 GRECIRQWTNLHNTCPICRANIVGADG 258

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 406
           +LPCGHI    C+  W     +CP+CR  + +  G
Sbjct: 264 KLPCGHIFGRECIYKWSRLENSCPLCRHKISENAG 298

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 13/56 (23%)

Query: 343 EDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           E   CI+C+ E+   +              LPCGH+    C+ +W + +  CP+CR
Sbjct: 273 ESRNCILCLMEMTDPSC-------------LPCGHVFCWDCITDWTKENPECPLCR 315

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 38.5 bits (88), Expect = 0.013,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICR 398
           LP C H   L CL  W+ RS TCP+CR
Sbjct: 97  LPHCHHKFDLECLSVWLSRSTTCPLCR 123

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTP 412
           L CGH+    C+  W + + +CPICR  +   +G + ++P
Sbjct: 229 LKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSP 268

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVF 402
           +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 13/52 (25%)

Query: 347 CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           CI+C+ E+   +               PCGHI   +C+ NW +    CP+CR
Sbjct: 271 CILCLTEMKDPSCA-------------PCGHIFCWNCIINWCKERSECPLCR 309

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 406
           +LPCGHI    C+  W     +CP+CR  + +  G
Sbjct: 254 KLPCGHIFGRECIYKWSRLENSCPLCRQKISESVG 288

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 20/73 (27%)

Query: 326 DDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLK 385
           DDTL T     +Q ++     CI+C+ +++  +               PCGH+    C+ 
Sbjct: 263 DDTLFTF----IQGASR---TCILCLSKIVDPSCA-------------PCGHLYCWDCIL 302

Query: 386 NWMERSQTCPICR 398
           NW      CP+CR
Sbjct: 303 NWCNEKPECPLCR 315

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 13/57 (22%)

Query: 342 NEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           +E   CI+C+  ++  +               PCGH+    CL NW +    CP+CR
Sbjct: 274 SESRKCILCLSLMVDPSCA-------------PCGHLFCWDCLLNWSKERPECPLCR 317

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEK 405
           LP C H   L CL  W+ RS TCP+CR  V   +
Sbjct: 125 LPHCNHRFDLECLSVWLSRSTTCPLCRDDVMGHR 158

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICR 398
           +LPCGHI    C+  W     +CP+CR
Sbjct: 337 KLPCGHIFGRDCIFKWSHLENSCPLCR 363

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 9/66 (13%)

Query: 341 ANEDNICIICMDELIHSANQQAWXXXXXXXXRLP-CGHILHLSCLKNWMERSQTCPICRL 399
            N+D IC IC  +         +         LP C H   L C+  W++++ +CPICR 
Sbjct: 109 KNKDEICSICRCKF--------FDDDYPLIIELPNCKHYFDLECITLWLQKNSSCPICRN 160

Query: 400 PVFDEK 405
            V ++K
Sbjct: 161 DVLEKK 166

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVFD-------EKGNVVQT 411
           LPC HI    CL  W +   +CP+CR  + +       E GN   T
Sbjct: 301 LPCAHIFGRECLDKWSQIENSCPLCRRKIVEVQPEQRPEPGNPAGT 346

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 372 RLP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
           +LP C H   L C+  W+ +S TCP+CR  V   K  +
Sbjct: 107 KLPNCNHKFDLQCITLWLSKSSTCPMCRNDVMSSKTKI 144

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 3/29 (10%)

Query: 373 LPCGHILHLSCLKNWME---RSQTCPICR 398
           +PCGH  HL+C++ W      +++CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 372 RLP-CGHILHLSCLKNWMERSQTCPICR 398
           +LP CGH     C+  W+ +++TCPICR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGH+   SCL +W +    CP+CR
Sbjct: 300 PCGHLFCWSCLMSWCKERPECPLCR 324

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEK 405
           LP C H   L CL  W+ RS TCP+CR  V   +
Sbjct: 132 LPHCHHKFDLECLSVWLSRSTTCPLCRDDVMGHR 165

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 14/26 (53%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           LPC HI    CL  W     TCP+CR
Sbjct: 262 LPCHHIFGRECLYKWTRHENTCPLCR 287

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 36.2 bits (82), Expect = 0.084,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDE 404
           LP C H   L CL  W+ ++ TCP+CR  V ++
Sbjct: 104 LPHCSHRFDLECLTPWLLKNSTCPLCRDDVMEK 136

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 35.4 bits (80), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
           C H   L C+  W+ +S TCP+CR  V + K N+
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 15/69 (21%)

Query: 338 QNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMER-SQTCPI 396
           +N ++E+  C+IC ++     N +           L C HI H  C+  W+ R S  CP+
Sbjct: 101 KNVSDEEESCVICQEQFNELNNIRV----------LGCSHIFHSHCIDRWICRNSACCPL 150

Query: 397 CR----LPV 401
           C+    LPV
Sbjct: 151 CKRSYSLPV 159

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICR 398
           +LPC HI    CL  W +   +CP+CR
Sbjct: 243 KLPCDHIFGRECLYKWSKLENSCPLCR 269

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEK 405
           LP C H   L CL  W+ RS TCP+CR  V   +
Sbjct: 127 LPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHR 160

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 14/26 (53%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           LPC HI    CL  W     TCP+CR
Sbjct: 279 LPCKHIFGRECLYKWTRVQNTCPLCR 304

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 35.8 bits (81), Expect = 0.11,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGH+    CL +W      CP+CR
Sbjct: 116 PCGHVFCWKCLLSWCNERPECPLCR 140

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 372 RLP-CGHILHLSCLKNWMERSQTCPICR 398
           +LP CGHI  L C+  W+    TCP+CR
Sbjct: 109 QLPHCGHIFDLQCISMWLSNQVTCPMCR 136

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVF 402
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 258 IPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 373 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQ 410
           LP C H  H  C+K W++++  CP+CR  V + K    +
Sbjct: 228 LPNCSHHFHFECIKLWLQKNSLCPLCRDNVMECKAETTE 266

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 373  LPCGHILHLSCLKNWMERSQTCPICR 398
            + CGH     C+ +W++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 13/52 (25%)

Query: 347 CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           CI+C+ +++  +              LPCGH+   +C+ +W      CP+CR
Sbjct: 270 CILCLVDMVDPSC-------------LPCGHLFCWNCIMHWCTERSECPLCR 308

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 35.4 bits (80), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 15/88 (17%)

Query: 315 LWKIWRNNKQLDDTLITVTIEQMQNSANED-NICIICMDELIHSANQQAWXXXXXXXXRL 373
           +W I +N  +LD+++           A+ED ++C IC            +          
Sbjct: 15  VWDIPKNEDRLDESM-----------ADEDEDVCGICRASYHAPCPNCRYPGESCAIVLG 63

Query: 374 PCGHILHLSCLKNWMERSQT---CPICR 398
            CGH  H+ C+  W++   +   CP+CR
Sbjct: 64  RCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVF 402
           +PC H  H  CL  W  ++  CPICR    
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 13/52 (25%)

Query: 347 CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           CI+C+ ++   +              LPCGH+   +C+  W      CP+CR
Sbjct: 266 CILCLADMTDPSC-------------LPCGHMFCWACVMQWCNERNECPLCR 304

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCR 281

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGH+   +CL +W +    CP+CR
Sbjct: 300 PCGHLFCWNCLMSWCKERPECPLCR 324

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGHI    C+ +W +    CP+CR
Sbjct: 294 PCGHIFCWECILDWCKERPECPLCR 318

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 31/90 (34%), Gaps = 25/90 (27%)

Query: 341 ANEDNICIICMDELIHSANQQAWXXXXXXXXR-----------------LPCGHILHLSC 383
           AN+D  C IC+ EL+ +              +                 +PC H  H  C
Sbjct: 135 ANDDETCCICL-ELLKTQEYDTITTQDGMRVKTKGGPPTKSIKDTDIVMIPCQHYFHAGC 193

Query: 384 LKNWM-------ERSQTCPICRLPVFDEKG 406
           LK W         R   CP+CR+ +   K 
Sbjct: 194 LKEWFSPQRRGKRRPLVCPLCRMDIVKCKA 223

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICRLPVF 402
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 188 IPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGH+    CL +W +    CP+CR
Sbjct: 300 PCGHLFCWDCLMSWCKERPECPLCR 324

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 13/52 (25%)

Query: 347 CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           CI+C++ +   +               PCGHI    C+ +W +    CP+CR
Sbjct: 276 CILCLNAMTDPSCA-------------PCGHIFCWDCILSWCKERPECPLCR 314

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 13/52 (25%)

Query: 347 CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
           C++C++ ++  +               PCGH+    C+  W    Q CP+CR
Sbjct: 255 CVLCLNYMLDPSAT-------------PCGHLFCWDCIMEWTLERQECPLCR 293

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGH+    CL +W +    CP+CR
Sbjct: 300 PCGHLFCWDCLMSWCKERPECPLCR 324

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 373  LPCGHILHLSCLKNWMERS--QTCPICRL 399
            L CGH     C+ NW+E+S  + CPIC++
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKI 1178

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 33.9 bits (76), Expect = 0.24,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           CGH  HL C+  W++    CP+   P
Sbjct: 81  CGHAFHLHCINKWIKTRDACPLDNQP 106

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 13/56 (23%)

Query: 346 ICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQ--TCPICRL 399
           IC IC+D +  S  +             PC H  H+ C++ W   S    CP CR+
Sbjct: 18  ICAICLDAIDKSIAKLE-----------PCNHKYHIDCIRTWHNYSNDLNCPTCRI 62

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H SCL  W      CP+CR
Sbjct: 285 IPCQHTFHCSCLDKW--NDSRCPVCR 308

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 252 IPCQHTFHCQCLDKW--KNSKCPVCR 275

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 18/26 (69%)

Query: 373  LPCGHILHLSCLKNWMERSQTCPICR 398
            + CGH     C+ +W++ +Q+CP+C+
Sbjct: 1214 IKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCR 274

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 13/25 (52%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGHI    C+ +W      CP CR
Sbjct: 242 PCGHIFCWDCIVDWCRERPECPFCR 266

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 373 LPCGHILHLSCLKNWME---RSQTCPICRLPV 401
           +PC H  HLSC++ W       +TCP CR+ +
Sbjct: 24  IPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 255 IPCQHTFHCQCLDKW--KNSRCPVCR 278

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 372 RLP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408
            LP C H   L C+  W+ +S +CP+CR  V   K  +
Sbjct: 120 ELPHCNHKFDLECISVWLSKSTSCPLCRDDVMSHKPGI 157

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 17/26 (65%)

Query: 373  LPCGHILHLSCLKNWMERSQTCPICR 398
            + CGH     C+++W++   +CP+C+
Sbjct: 1239 IKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 11/56 (19%)

Query: 346 ICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQ--TCPICRL 399
           +C IC++++   ++              PCGH  H  C++ W   ++   CP+CR+
Sbjct: 5   VCAICLEDICGKSSTSYLK---------PCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 373  LPCGHILHLSCLKNWMERSQTCPICRL 399
            + CGH    SC+ +W+     CP+C++
Sbjct: 1177 IKCGHFFCKSCIHSWLRNKNACPLCKM 1203

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSRCPVCR 274

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 406
           +L CGH     C+  W +   +CPICR  +   +G
Sbjct: 244 QLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 375 CGHILHLSCLKNWMERSQTCPICR 398
           C H   L CL  W++ + TCP+CR
Sbjct: 92  CNHKFDLECLSIWLQNNHTCPMCR 115

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           LPC H+    CL  W +   +CP+CR
Sbjct: 216 LPCNHVFGRECLFKWSQLENSCPLCR 241

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 375  CGHILHLSCLKNWMERSQTCPICRLPV 401
            CGH    SC+  W++   TCP+C+  V
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 13/52 (25%)

Query: 347  CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICR 398
            C IC+D +                  L CGH     C+ +W++    CPIC+
Sbjct: 1267 CTICLDAITKGC-------------MLKCGHFFCEDCIYDWLQTRTICPICK 1305

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 375  CGHILHLSCLKNWMERSQTCPICRLPV 401
            CGH    SC+  W++   TCP+C+  V
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  +   CP+CR
Sbjct: 264 IPCQHTFHCQCLNKW--KDSRCPVCR 287

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 373  LPCGHILHLSCLKNWMERSQTCPICRL 399
            L CGH     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 15/68 (22%)

Query: 333  TIEQMQNSANEDNI--CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMER 390
             + +++++ NE+ +  C IC+ E+   A              + CGH    SC+  W+  
Sbjct: 1227 NLSRLKDTINENQVLSCSICLGEVEVGA-------------IIKCGHYFCKSCILTWLRS 1273

Query: 391  SQTCPICR 398
               CPIC+
Sbjct: 1274 HSKCPICK 1281

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  +   CP+CR
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCR 277

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 373  LPCGHILHLSCLKNWMERSQTCPICR 398
            + CGH    SC+ +W++   +CP+C+
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 15/68 (22%)

Query: 333  TIEQMQNS-ANEDNI-CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMER 390
            T+ Q++ + AN +NI C +C  ++   +              L CGH     C+ +W ++
Sbjct: 1192 TLGQLKTAIANGENISCAVCYSDIYTGS-------------ILKCGHFFCKDCVTHWFKK 1238

Query: 391  SQTCPICR 398
            + +CP+C+
Sbjct: 1239 NTSCPMCK 1246

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 375 CGHILHLSCLKNWMERS--QTCPICRL 399
           CGH  HL+C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 13/53 (24%)

Query: 347  CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRL 399
            C IC+ E+   +              + CGH    SC+ +W++   +CP+C++
Sbjct: 1223 CTICLGEIYMGS-------------VIKCGHFFCQSCIFSWLKNHASCPLCKM 1262

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PC H  H  CL  W  ++  CP+CR
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCR 255

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 32.7 bits (73), Expect = 0.96,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 375 CGHILHLSCLKNWMERSQT---CPICR 398
           C H  H+ C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 32.3 bits (72), Expect = 0.99,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++  + CP+   P
Sbjct: 89  CNHAFHLHCINKWIKTREACPLDNQP 114

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 32.0 bits (71), Expect = 1.00,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 23/59 (38%), Gaps = 17/59 (28%)

Query: 347 CIICMDEL-IHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWME------RSQTCPICR 398
           C ICM+E+  H    +           LPC H  H  C++ W        R   CP CR
Sbjct: 10  CPICMEEIGPHEPLGEL----------LPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 399 PCGHAIHQHCFDEYTKHSYKCPHCQVTVLN 428

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W +    CP+CR
Sbjct: 244 IPCQHTFHCVCLNKWGD--NRCPVCR 267

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWLQTRNACPLDNQP 103

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 375  CGHILHLSCLKNWMERSQTCPI---CRLP-VFD 403
            C H+LHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 11/66 (16%)

Query: 334 IEQMQNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMER-SQ 392
           +E +   A+    C IC ++     N             L C H+ H  C+  W+ R S 
Sbjct: 107 VESLGPGADSRTTCAICQEDFNKLNN----------VCLLGCNHVFHTYCIDQWICRNSA 156

Query: 393 TCPICR 398
            CP+C+
Sbjct: 157 CCPLCK 162

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 31.6 bits (70), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 12/57 (21%)

Query: 347 CIICMDELIHSANQQ---AWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRLP 400
           C+ C  E   ++  +   AW           C H  HL C+  W++    CP+   P
Sbjct: 55  CVNCQQEATFNSEHECVAAWGE---------CNHAFHLHCITQWIKSRNVCPLDNKP 102

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   + + S  CP C++ + +
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILN 433

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 15/68 (22%)

Query: 333  TIEQMQNSANEDNI--CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMER 390
             + +++++ NE+ I  C IC+ E+   A              + CGH    +C+  W+  
Sbjct: 1220 NLSRLKDTLNENQILSCSICLGEVEIGA-------------IIKCGHYFCKNCILTWLRA 1266

Query: 391  SQTCPICR 398
               CPIC+
Sbjct: 1267 HSKCPICK 1274

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   +++ S  CP C + V +
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 24/53 (45%), Gaps = 13/53 (24%)

Query: 347  CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMERSQTCPICRL 399
            C IC+ E+   +              + CGH     C+ +W++   +CP+C++
Sbjct: 1189 CTICLGEIYMGS-------------VIKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 12/22 (54%)

Query: 375 CGHILHLSCLKNWMERSQTCPI 396
           C H  HL C+  W++    CP+
Sbjct: 77  CNHAFHLHCINKWLQTRNACPL 98

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 69  CNHAFHLHCINKWIKTRDACPLDNQP 94

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 375 CGHILHLSCLKNWMERSQTCPICR 398
           C H   L C+  W+  + TCP+CR
Sbjct: 108 CSHKFDLQCISVWLSSNSTCPVCR 131

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 15/68 (22%)

Query: 333  TIEQMQNSANEDNI--CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMER 390
             + +++++ N++ I  C IC+ E+   A              + CGH    SC+  W+  
Sbjct: 1223 NLSRLKDTLNDNQILSCSICLGEVEIGA-------------IIKCGHYFCKSCILTWLRA 1269

Query: 391  SQTCPICR 398
               CPIC+
Sbjct: 1270 HSKCPICK 1277

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 32.0 bits (71), Expect = 1.7,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 105 CNHAFHLHCINKWLQTRNACPLDNQP 130

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 32/92 (34%)

Query: 340 SANEDNI-----CIICMD--ELIHSAN---------QQAWXXXXXXXXRLPCGHILHLSC 383
           S  +D I     CIIC++  +++ S N         +Q          +LPC H  H  C
Sbjct: 137 STKDDRIPINECCIICLERVKVVPSTNDLEKQQNGTEQTTDMIPSKVVKLPCEHYFHKCC 196

Query: 384 LKNWME------RSQT----------CPICRL 399
           +K+W        +S T          CP+CRL
Sbjct: 197 IKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score = 32.3 bits (72), Expect = 1.8,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 36/89 (40%), Gaps = 6/89 (6%)

Query: 316 WKIWRNNKQLDDTL---ITVTIEQMQNSANEDNICIICMDELIHSANQQAWXXXXXXXXR 372
           W I +N   ++  L       I  M +  +E+++C IC      +     +         
Sbjct: 16  WHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVI 75

Query: 373 LPCGHILHLSCLKNWMERSQT---CPICR 398
             C H  H+ C+  W++ S +   CP+CR
Sbjct: 76  GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 31.6 bits (70), Expect = 1.9,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 85  CNHAFHLHCINKWIKTRDACPLDNQP 110

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 32.0 bits (71), Expect = 1.9,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 375 CGHILHLSCLKNWMERSQT---CPICR 398
           C H  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 31.2 bits (69), Expect = 1.9,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 74  CNHAFHLHCINKWIKTRDACPLDNQP 99

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 31.6 bits (70), Expect = 2.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 83  CNHAFHLHCINKWIKTRDACPLDNQP 108

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 31.6 bits (70), Expect = 2.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 90  CNHAFHLHCINKWIQTRDACPLDNQP 115

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 31.6 bits (70), Expect = 2.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 31.2 bits (69), Expect = 2.1,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 85  CNHAFHLHCINKWIKTRDACPLDNQP 110

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 31.2 bits (69), Expect = 2.2,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 31.2 bits (69), Expect = 2.3,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 76  CNHAFHLHCINKWIKTRDACPLDNQP 101

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   +   S  CP C++ V +
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLN 379

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 12/25 (48%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICR 398
           PCGH     CL  W      CP+CR
Sbjct: 272 PCGHTYCWDCLFKWCNERPECPLCR 296

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 373  LPCGHILHLSCLKNWM--ERSQTCP 395
            LPCGH  H  C++ W   E  Q CP
Sbjct: 1308 LPCGHEGHFQCIQEWFLDENEQECP 1332

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWIKTRDACPLDNQP 103

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 375 CGHILHLSCLKNWMERSQTCPICRLP 400
           C H  HL C+  W++    CP+   P
Sbjct: 89  CNHAFHLHCINKWIKTRDACPLDNQP 114

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 20/74 (27%)

Query: 327  DTLITV--TIEQMQNSANEDNICIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCL 384
            D+L T+  +IEQ     N+   C IC+  LIH+ +             + CGH    +C+
Sbjct: 1254 DSLTTLQESIEQ-----NKTFTCPICLG-LIHTGSM------------ISCGHFFCNNCI 1295

Query: 385  KNWMERSQTCPICR 398
             +W++ +  CP+C+
Sbjct: 1296 FSWLKLNSNCPLCK 1309

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 373  LPCGHILHLSCLKNWMERSQTCPICR 398
            + CGH     C+ +W++    CPIC+
Sbjct: 1164 IKCGHFFCKHCIFSWLKNKSVCPICK 1189

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score = 32.0 bits (71), Expect = 2.6,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 375 CGHILHLSCLKNWMERSQT---CPICRLPVFDEKGNVV 409
           C H  H+ C+  W+E   +   CP+CR  VF+ +  VV
Sbjct: 84  CKHNFHVHCIFEWLETEASRGLCPMCR-QVFELRKGVV 120

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 374 PCGHILHLSCLKNWMERSQTCPIC 397
           PCGH     C++ ++ R   CP+C
Sbjct: 42  PCGHTFCSICIREYINRQSKCPLC 65

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 372 RLPCGHILHLSCLKNWMERSQTCPICR 398
           +L C HI   SCL  W +   +CP+CR
Sbjct: 334 QLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 376  GHILHLSCLKNWMERSQTCPICR 398
            GH     C+ +W+E  Q+CP+C+
Sbjct: 1235 GHFYCQECISSWLETKQSCPLCK 1257

>Smik_5.261 Chr5 complement(404258..405067) [810 bp, 269 aa] {ON}
           YER116C (REAL)
          Length = 269

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 45/117 (38%), Gaps = 22/117 (18%)

Query: 305 VLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWX 364
           V  + ++  +L K   NNK+     + +T + +   A E  + +I  D+    A + +  
Sbjct: 137 VSTVPEAVPSLAKAETNNKE---QAVDLTEDAIDLDAEEQQVLVISDDDFQEEAKEDSKE 193

Query: 365 XXXXXXXRLP-------------CGHILHLSCLKNWMERSQT------CPICRLPVF 402
                  R P             CGH+   SCL   +  S+T      C +CR  V+
Sbjct: 194 YGAAKDYRCPICFEPPETALMTLCGHVFCCSCLFQMVNSSRTCRQFGHCALCRSKVY 250

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 2/28 (7%)

Query: 374 PCGHILHLSCLKNW--MERSQTCPICRL 399
           PC H  H  CL+ W        CPICR+
Sbjct: 24  PCNHKFHRDCLRRWHLYAHDLVCPICRV 51

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 15/68 (22%)

Query: 333  TIEQMQNSANEDNI--CIICMDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWMER 390
             + +++++ NE+ I  C IC+ ++   A              + CGH    +C+  W+  
Sbjct: 1224 NLSRLKDTLNENQILSCSICLGDVEIGA-------------IIKCGHYFCKNCILTWLRA 1270

Query: 391  SQTCPICR 398
               CPIC+
Sbjct: 1271 HNKCPICK 1278

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRL 399
           PCGH     C++ +++ +  CP+C L
Sbjct: 42  PCGHTFCSVCIREYLQSNSKCPLCLL 67

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 23/79 (29%)

Query: 334 IEQMQNSANED---NICIICMDELIHSANQQAWXXXXXXXXRL---PCGHILHLSCLKNW 387
           +E+  N+  ED    +C IC++E                  RL   PC H  H +C++ +
Sbjct: 323 LEERMNNLTEDTRHELCSICLEEC-------------KLQHRLFFAPCSHCWHSACIQPY 369

Query: 388 MERSQ---TCPICRLPVFD 403
           M +     TCP CR  +FD
Sbjct: 370 MNKDVPLFTCPNCRC-IFD 387

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
            (REAL)
          Length = 1151

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 375  CGHILHLSCLKNWMERSQTCPI---CRLP-VFD 403
            C H+LH SC + W E    CP    C  P +FD
Sbjct: 1118 CQHVLHSSCARTWWEIGDECPSGCGCNCPDMFD 1150

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 373 LPCGHILHLSCLKNWMERSQ--TCPICR 398
           LPC H  H+SC++ W   S    CP CR
Sbjct: 21  LPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 373 LPCGHILHLSCLKNWMERSQ--TCPICRL---PVFDEKGNV 408
           + C H  HL C++ W   SQ   CP CR+    + D + NV
Sbjct: 21  VTCQHEYHLECIREWHNHSQDFKCPTCRVESNKLLDVENNV 61

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 19/57 (33%)

Query: 344  DNICIIC---MDELIHSANQQAWXXXXXXXXRLPCGHILHLSCLKNWM--ERSQTCP 395
            +++C+IC   M +L  +A              L CGH  H  C KNW   E   TCP
Sbjct: 1343 NSLCVICECPMKKLTLTA--------------LRCGHEAHFQCFKNWFLDEGMNTCP 1385

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%)

Query: 373 LPCGHILHLSCLKNWMERSQT--CPICRL 399
           + CGH  H +C++ W   S+   CP CR+
Sbjct: 19  VECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 374 PCGHILHLSCLKNWMERSQTCPIC 397
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C  +    S  CP C++ V +
Sbjct: 388 PCGHAIHQHCFNDHTRHSYKCPQCQVTVVN 417

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 374 PCGHILHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C +     S  CP C++ V +
Sbjct: 239 PCGHAIHQHCFEEHTRHSYKCPHCQVTVLN 268

>Ecym_6068 Chr6 (126754..129762) [3009 bp, 1002 aa] {ON} similar to
           Ashbya gossypii ADR241C
          Length = 1002

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDV 180
           F   IKD L  L  +++D+   + LI   F+ +L LL L+D+++ +     I    +I V
Sbjct: 224 FDHKIKDVLGVLSGNVDDNDDQERLIV-LFNHSLQLLRLSDFKLKSNTPIEIAEGIDISV 282

Query: 181 VSTSLYL 187
           V +SLY+
Sbjct: 283 VDSSLYV 289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,733,271
Number of extensions: 1715592
Number of successful extensions: 7326
Number of sequences better than 10.0: 209
Number of HSP's gapped: 7426
Number of HSP's successfully gapped: 220
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)