Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_14.711.82ON1948192687690.0
YNL271C (BNI1)1.82ON1953194074900.0
Smik_14.661.82ON1952194174470.0
Skud_14.691.82ON1946194373930.0
NCAS0A005901.82ON1946108829680.0
CAGL0J08206g1.82ON1898110428690.0
NDAI0F042201.82ON2022109727710.0
TDEL0C061901.82ON1879110826960.0
Kpol_2000.661.82ON1930110926270.0
KAFR0D039501.82ON195785026230.0
KNAG0F004701.82ON2028115526130.0
ZYRO0F16676g1.82ON1994106424270.0
TPHA0B044901.82ON1940111222510.0
TBLA0A054401.82ON217062920450.0
SAKL0C02618g1.82ON1988111319880.0
Kwal_33.133921.82ON196862419470.0
KLTH0F02376g1.82ON197662518630.0
AFR669W1.82ON191859218530.0
Ecym_10861.82ON209164418370.0
KLLA0C02321g1.82ON184258317480.0
SAKL0E15224g5.717ON13354247731e-82
NCAS0G001205.717ON13144237674e-82
CAGL0H06765g5.717ON12944767442e-79
Ecym_40045.717ON14544387421e-78
Ecym_5679na 1ON13064607336e-78
Kpol_416.105.717ON14914297313e-77
AFR301C5.717ON16554477306e-77
KLLA0F10912g5.717ON12834797202e-76
KNAG0L022505.717ON13674237152e-75
TDEL0F055605.717ON12924267095e-75
AGL364Cna 1ON12604137042e-74
Kwal_55.196205.717ON13894197018e-74
Smik_9.95.717ON13744326911e-72
NDAI0F001605.717ON13494216883e-72
Skud_9.85.717ON13744316865e-72
KLTH0E00704g5.717ON13894196865e-72
ZYRO0B16654g5.717ON14244196812e-71
TPHA0E001205.717ON16424216743e-70
YIL159W (BNR1)5.717ON13754906624e-69
TBLA0E018105.717ON14514736624e-69
KAFR0D021205.717ON13244176481e-67
Suva_9.265.717ON13754226365e-66
KAFR0K023306.223ON540112900.094
Ecym_22426.174ON58258765.2
KAFR0E005901.468ON75878757.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_14.71
         (1948 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...  3382   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...  2889   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...  2873   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...  2852   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...  1147   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...  1109   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}          1071   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...  1043   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...  1016   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....  1014   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}    1011   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   939   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   871   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   792   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   770   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   754   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   722   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   718   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   712   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   677   0.0  
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   302   1e-82
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      300   4e-82
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   291   2e-79
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   290   1e-78
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   286   6e-78
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   286   3e-77
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   285   6e-77
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   281   2e-76
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   280   2e-75
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   277   5e-75
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   275   2e-74
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   274   8e-74
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   270   1e-72
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     269   3e-72
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   268   5e-72
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   268   5e-72
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   266   2e-71
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   264   3e-70
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   259   4e-69
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   259   4e-69
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   254   1e-67
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   249   5e-66
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    39   0.094
Ecym_2242 Chr2 (476716..478464) [1749 bp, 582 aa] {ON} similar t...    34   5.2  
KAFR0E00590 Chr5 complement(127525..129801) [2277 bp, 758 aa] {O...    33   7.8  

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score = 3382 bits (8769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1696/1926 (88%), Positives = 1696/1926 (88%)

Query: 23   LFQNLKRLXXXXXXXXXXXXXXXXXEHQHPPVGQEXXXXXXXXXXFRRLNGPSRSTSTEA 82
            LFQNLKRL                 EHQHPPVGQE          FRRLNGPSRSTSTEA
Sbjct: 23   LFQNLKRLANSSASNNNATSPNNASEHQHPPVGQETSTSSASSSSFRRLNGPSRSTSTEA 82

Query: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQH 142
            RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQH
Sbjct: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQH 142

Query: 143  TGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGD 202
            TGQ                 KFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGD
Sbjct: 143  TGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGD 202

Query: 203  KQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQHPILTANSTLSSP 262
            KQEELMSYSTEKKWLIVKQDLQNELKK                  DQHPILTANSTLSSP
Sbjct: 203  KQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTSIASDQHPILTANSTLSSP 262

Query: 263  KSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIAGGLKKQPSLNSIYRGG 322
            KSALMTSASSPTSTVY            VGTSTPKGHNNKKTIAGGLKKQPSLNSIYRGG
Sbjct: 263  KSALMTSASSPTSTVYSNTLNHSTTLSSVGTSTPKGHNNKKTIAGGLKKQPSLNSIYRGG 322

Query: 323  PEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGH 382
            PEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGH
Sbjct: 323  PEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGH 382

Query: 383  IAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 442
            IAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE
Sbjct: 383  IAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 442

Query: 443  GLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS 502
            GLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS
Sbjct: 443  GLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS 502

Query: 503  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINH 562
            HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINH
Sbjct: 503  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINH 562

Query: 563  LCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEAS 622
            LCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEAS
Sbjct: 563  LCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEAS 622

Query: 623  NKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLK 682
            NKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLK
Sbjct: 623  NKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLK 682

Query: 683  LMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERD 742
            LMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERD
Sbjct: 683  LMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERD 742

Query: 743  SLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVEL 802
            SLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVM                      VEL
Sbjct: 743  SLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVEL 802

Query: 803  RKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGM 862
            RKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGM
Sbjct: 803  RKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGM 862

Query: 863  TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXXXSS 922
            TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERL                    SS
Sbjct: 863  TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKSS 922

Query: 923  VKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYK 982
            VKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYK
Sbjct: 923  VKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYK 982

Query: 983  GFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQX 1042
            GFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQ 
Sbjct: 983  GFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQE 1042

Query: 1043 XXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTG 1102
                                  IYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTG
Sbjct: 1043 TEEDEDEETKSSSSSSDADDDEIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTG 1102

Query: 1103 QNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPFKQNKDE 1162
            QNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPFKQNKDE
Sbjct: 1103 QNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPFKQNKDE 1162

Query: 1163 DLVKDLSTENDIADGTFVSDKVGGDVQKHIKNKVRKRLDDKXXXXXGXXXXXXXXXXXXX 1222
            DLVKDLSTENDIADGTFVSDKVGGDVQKHIKNKVRKRLDDK     G             
Sbjct: 1163 DLVKDLSTENDIADGTFVSDKVGGDVQKHIKNKVRKRLDDKEEEEEGVTTDTSHVSDSDS 1222

Query: 1223 XXXXXNPSTTSSTLHXXXXXXXXXXXXXLRLFGTVNQSPDKEKETEDDTAGEXXXXXXXX 1282
                 NPSTTSSTLH             LRLFGTVNQSPDKEKETEDDTAGE        
Sbjct: 1223 EVEAENPSTTSSTLHPPPPPPPPPPPIPLRLFGTVNQSPDKEKETEDDTAGEAAAAPPPP 1282

Query: 1283 XXXXXXMGLFGQNNGGTXXXXXXXFVLSSTXXXXXXXXXXXXXXSQMKSAVTSPLLPQSP 1342
                  MGLFGQNNGGT       FVLSST              SQMKSAVTSPLLPQSP
Sbjct: 1283 PPXXXXMGLFGQNNGGTPPPPPLPFVLSSTGPGAIPPAPPMMPASQMKSAVTSPLLPQSP 1342

Query: 1343 SLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIK 1402
            SLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIK
Sbjct: 1343 SLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIK 1402

Query: 1403 SLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFL 1462
            SLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFL
Sbjct: 1403 SLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFL 1462

Query: 1463 SKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYW 1522
            SKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYW
Sbjct: 1463 SKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYW 1522

Query: 1523 GSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQ 1582
            GSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQ
Sbjct: 1523 GSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQ 1582

Query: 1583 AQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQL 1642
            AQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQL
Sbjct: 1583 AQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQL 1642

Query: 1643 VNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLT 1702
            VNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLT
Sbjct: 1643 VNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLT 1702

Query: 1703 IMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVE 1762
            IMEFESLMQTYGEDSG               VNEYKRAQSQNLAAEEEERLYEKHKKMVE
Sbjct: 1703 IMEFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVE 1762

Query: 1763 EQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKSDPSSARKRALV 1822
            EQQKRAQDKEKHREHSALP         DRRAVMDKLLEQLKNAGPAKSDPSSARKRALV
Sbjct: 1763 EQQKRAQDKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALV 1822

Query: 1823 RKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPEDL 1882
            RKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPEDL
Sbjct: 1823 RKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPEDL 1882

Query: 1883 PSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRARKERANGETNTG 1942
            PSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRARKERANGETNTG
Sbjct: 1883 PSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRARKERANGETNTG 1942

Query: 1943 NKLSFK 1948
            NKLSFK
Sbjct: 1943 NKLSFK 1948

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score = 2889 bits (7490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1480/1940 (76%), Positives = 1572/1940 (81%), Gaps = 23/1940 (1%)

Query: 23   LFQNLKRLXXXXXXXXXXXXXXXXXEHQHPPVGQEXXXXXXXXXXFRRLNGPSRSTSTEA 82
            +FQNLKRL                 + QH PVG E          FR+LN PSRSTSTEA
Sbjct: 23   IFQNLKRLANSNATNSNTGSPTYASQQQHSPVGNEVSTSPASSSSFRKLNAPSRSTSTEA 82

Query: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQH 142
            RPLNKK+TLNTQNLSQYMNGK+S D P SSQHARSHS+QSKYSYSKR SSQASNKLTRQH
Sbjct: 83   RPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTRQH 142

Query: 143  TGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGD 202
            TGQ                 KFTTPDGKI+LEMPSDPYEVEVLFEDIMYKRNIFQSLS D
Sbjct: 143  TGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDIMYKRNIFQSLSED 202

Query: 203  KQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQHPILTANSTLSSP 262
            KQE LM YS EKKWLIVKQDLQNELKK                  D HPILTANS+LSSP
Sbjct: 203  KQEALMGYSIEKKWLIVKQDLQNELKKMRANTTSSSTASRTSMASDHHPILTANSSLSSP 262

Query: 263  KSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIAGGLKKQPSLNSIYRGG 322
            KS LMTSASSPTSTVY            VGTST KG   KK ++G LKKQPSLN+IYRGG
Sbjct: 263  KSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKG---KKLVSGSLKKQPSLNNIYRGG 319

Query: 323  PEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGH 382
             E NTSASTLPGDRTNRPPIHYVQRILADKLT+DEMKDLWVTLRTEQLDWVDAFIDHQGH
Sbjct: 320  AENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDHQGH 379

Query: 383  IAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 442
            IAMANVLMNSIYKTAPRE+LTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE
Sbjct: 380  IAMANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 439

Query: 443  GLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS 502
            GLFSTKL TRKMATEIFVCMLEKKNK+RFEAVLT+LDKKFRIGQNLHMIQNFKKMPQYFS
Sbjct: 440  GLFSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFKKMPQYFS 499

Query: 503  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINH 562
            HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINH
Sbjct: 500  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINH 559

Query: 563  LCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEAS 622
            LCSCSDN+NQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEA+
Sbjct: 560  LCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEAN 619

Query: 623  NKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLK 682
            NKAFNVDL DPLSLLKNLW+ICKGT+NEKLLVSLVQHLFLSSSKLIEENQN SKL+KQLK
Sbjct: 620  NKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLK 679

Query: 683  LMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERD 742
            LMDSLVTNVSVAST+DEE+NMNMAIQRLYDAMQTDEVARRAILESR LTKKLEEIQAERD
Sbjct: 680  LMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERD 739

Query: 743  SLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVEL 802
            SLSEKL KAEHGLVGQLE+ELH RDRILAKNQRVM                      VEL
Sbjct: 740  SLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVEL 799

Query: 803  RKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGM 862
            RKMLTILNSRPEES + ++GT+ +N SLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGM
Sbjct: 800  RKMLTILNSRPEESFNKNEGTRGMNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGM 859

Query: 863  TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXXXSS 922
            TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK+RL                      
Sbjct: 860  TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKPL 919

Query: 923  VKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYK 982
            VK Q AD+NKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYK
Sbjct: 920  VKPQEADVNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYK 979

Query: 983  GFGIDFNVEEFIETPKKFS--VDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVK 1040
            GFGIDFNV+E +++PKK +  V+ E DA Y SLDPK YQ KLDEINRITD+LLD+QTQ +
Sbjct: 980  GFGIDFNVDEIMDSPKKNTGDVETEEDANYASLDPKTYQKKLDEINRITDQLLDIQTQTE 1039

Query: 1041 QXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYG 1100
                                    IYQDASP+QE R E+SELS+GSGPGSFLDALSQKYG
Sbjct: 1040 HEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRSEHSELSSGSGPGSFLDALSQKYG 1099

Query: 1101 TGQNVTASAGL-RDNRGSGHMP--SNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPFK 1157
            TGQNVTASA    +N GSG  P  S VEK+F+NRLRKST SSAPYLEELTQKVNKVEP++
Sbjct: 1100 TGQNVTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYLEELTQKVNKVEPYE 1159

Query: 1158 QNKDEDLVKDLSTENDIADGTFVSDKVGGDVQKHIKNKVRKRLDDKXXXXXGXXXXXXXX 1217
            QN+DE L K    EN  A      DK   D+++H++N  + R+ +               
Sbjct: 1160 QNEDEGLDKKSLPENSTASAASAFDKAEKDMRQHVENGKQGRVVNHEEDKTA---DFSAV 1216

Query: 1218 XXXXXXXXXXNPSTTSSTLHXX-XXXXXXXXXXXLRLFGTVNQSPDKEKETEDDTAGEXX 1276
                      + ST SS L                +LFG   +S +KEK++EDDT  +  
Sbjct: 1217 SKLNNTDGAEDLSTQSSVLSSQPPPPPPPPPPVPAKLFG---ESLEKEKKSEDDTVKQET 1273

Query: 1277 X------XXXXXXXXXXXMGLFGQNNGGTXXXXXXXFVLSSTXXXXXXXXXXXXXXSQMK 1330
                              M LFG+  G T        VLSS+              SQ+K
Sbjct: 1274 TGDSPAPPPPPPPPPPPPMALFGKPKGETPPPPPLPSVLSSSTDGVIPPAPPMMPASQIK 1333

Query: 1331 SAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLA 1390
            SAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEK+D TDNSIWG+GKAEKFADDLYEKGVLA
Sbjct: 1334 SAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLA 1393

Query: 1391 DLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDR 1450
            DLEKAFAAREIKSLA+KRKEDLQK+TFLSRDISQQFGINLHMYSSLSVADLVKKIL CDR
Sbjct: 1394 DLEKAFAAREIKSLASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDR 1453

Query: 1451 DFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQI 1510
            DFLQTPSVVEFLSK EI EVSVNLARNYAPYSTDWEG+R+LEDAKPPEKDPNDLQRADQI
Sbjct: 1454 DFLQTPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQI 1513

Query: 1511 YLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVIL 1570
            YLQLMVNLE YWGSRMRALTVVTSYE+EYNELLAKLRKVD+AV ALQESDNLRNVFNVIL
Sbjct: 1514 YLQLMVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVIL 1573

Query: 1571 AVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEP 1630
            AVGNFMNDTSKQAQGFKLSTLQRLTFIKDT NSMTFLNYVEKI+RLNYPSFNDFL ELEP
Sbjct: 1574 AVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEP 1633

Query: 1631 VLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARR 1690
            VLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR+
Sbjct: 1634 VLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARK 1693

Query: 1691 KGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEE 1750
            KGDLLEDEVKLTIMEFESLM TYGEDSG               +NEYK+AQ+QNLAAEEE
Sbjct: 1694 KGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEE 1753

Query: 1751 ERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXX--XXXXXXDRRAVMDKLLEQLKNAGP 1808
            ERLY KHKK+VEEQQKRAQ+KEK +E+S  P           DRRAVMDKLLEQLKNAGP
Sbjct: 1754 ERLYIKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGP 1813

Query: 1809 AKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPT 1868
            AKSDPSSARKRALVRKKY+S+KDN+ Q+LNDL+ EEGSILYSPEA  P  DTVIHAESPT
Sbjct: 1814 AKSDPSSARKRALVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPT 1873

Query: 1869 PLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKL 1928
            PLATRG MNT EDLPSPSK SALEDQEEI+DRARMLLKELRGSD PVKQNSILDEHLEKL
Sbjct: 1874 PLATRGVMNTSEDLPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSILDEHLEKL 1933

Query: 1929 RARKERANGETNTGNKLSFK 1948
            RARKER+ GE +TGN+LSFK
Sbjct: 1934 RARKERSIGEASTGNRLSFK 1953

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score = 2873 bits (7447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1469/1941 (75%), Positives = 1568/1941 (80%), Gaps = 26/1941 (1%)

Query: 23   LFQNLKRLXXXXXXXXXXXXXXXXX-EHQHPPVGQEXXXXXXXXXXFRRLNGPSRSTSTE 81
            LFQNLKRL                  + QH PV  E          FR+LNGPSRS STE
Sbjct: 23   LFQNLKRLANSNAANNNTGSPTNVSPQQQHSPVEHEAATSPASSSSFRKLNGPSRSISTE 82

Query: 82   ARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQ 141
            ARPLNKK+TLNTQNLSQYMNGKIS D P SSQHARSHS+QSKYSYSKR SSQASNKLTRQ
Sbjct: 83   ARPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTRQ 142

Query: 142  HTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSG 201
            HTGQ                 KFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSG
Sbjct: 143  HTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSG 202

Query: 202  DKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQHPILTANSTLSS 261
            DKQE LMSYSTEKKWLIVKQDLQNELKK                  D HPILTANS+LSS
Sbjct: 203  DKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRTSIASDHHPILTANSSLSS 262

Query: 262  PKSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIAGGLKKQPSLNSIYRG 321
            PKS LMTSASSPTSTVY            VGTST K   +KK + G LKKQPSLN+IYRG
Sbjct: 263  PKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSK---SKKLMGGSLKKQPSLNNIYRG 319

Query: 322  GPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQG 381
            G E NTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQG
Sbjct: 320  GSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQG 379

Query: 382  HIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVA 441
            HIAMANVLMNSIYKTAPR+ LTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVA
Sbjct: 380  HIAMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVA 439

Query: 442  EGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYF 501
            EGLFST+L TRKMATEIFVCMLEKKNK+RFEAVLTALDKKFRIGQNLHMIQNFKKMPQYF
Sbjct: 440  EGLFSTRLATRKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYF 499

Query: 502  SHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFIN 561
            SHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFIN
Sbjct: 500  SHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFIN 559

Query: 562  HLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEA 621
            HLCSCSDN+NQRMLLRTKLENCG+LRIMNKIKLLDYDKV+DQIELYDNNKLDDFNV+LEA
Sbjct: 560  HLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEA 619

Query: 622  SNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQL 681
            +NKAFNVDL+DPLSLLKNLW+ICKGT+NEKLLVSLVQHLFLSSSKLIEENQNPSKL+KQL
Sbjct: 620  NNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNPSKLTKQL 679

Query: 682  KLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAER 741
            K+MDSLVT+VS+AST+DEESNMNMAIQRLYDAMQTDEVARRAILESR LTKKLEEIQAER
Sbjct: 680  KVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAER 739

Query: 742  DSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVE 801
            DSLSEKL KAEHGLVGQLE+ELHGRDRILAKNQRVM                      VE
Sbjct: 740  DSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVE 799

Query: 802  LRKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFG 861
            LRKMLTILNSRPEE+S +++G +  N SLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFG
Sbjct: 800  LRKMLTILNSRPEENSSINEGIRGKNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFG 859

Query: 862  MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXXXS 921
            MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK+ L                     
Sbjct: 860  MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKL 919

Query: 922  SVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKY 981
              + Q  DMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKY
Sbjct: 920  ISRPQEVDMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKY 979

Query: 982  KGFGIDFNVEEFIETPKKFSVDE--ENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQV 1039
            KGFGIDFNVEE +E+PKK S +E  E+ A Y SLDP+ YQ+KLDEINRITD+LLDLQ Q 
Sbjct: 980  KGFGIDFNVEEIMESPKKNSANERKEDGANYSSLDPRTYQNKLDEINRITDQLLDLQAQT 1039

Query: 1040 KQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKY 1099
            KQ                       +YQDA P+QE R E SELS  SG GSFLDALSQKY
Sbjct: 1040 KQ----DDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRSENSELSVESGSGSFLDALSQKY 1095

Query: 1100 GTGQNVTASAGLRDN---RGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPF 1156
            GTGQN T S GLRD+      GHMPS VEK+F+N+LRKSTASSAPYLEELTQKVNKVE +
Sbjct: 1096 GTGQNNTVSVGLRDSDYVSVIGHMPSKVEKTFMNKLRKSTASSAPYLEELTQKVNKVESY 1155

Query: 1157 KQNKDEDLVKDLSTENDIADGTFVSDKVGGDVQKHIKNKVRKRLDDKXXX-----XXGXX 1211
            +Q++DE   K+ S++N   +   V DKV    + H++++   RLD K             
Sbjct: 1156 EQDEDEVRSKESSSKNAPRNAVPVIDKVKESFRGHVESREEGRLDTKEEEIVKNDEETIT 1215

Query: 1212 XXXXXXXXXXXXXXXXNPSTTSSTLHXXXXXXXXXXXXXLRLFGTVNQSPDKEKETEDDT 1271
                            + +T SSTL                LFG    S +KE+E++DD+
Sbjct: 1216 TNLSAVCGSDNVANAKSITTVSSTLPPPPPPPPPPPVPV-ELFGN---SLEKEEESKDDS 1271

Query: 1272 AGEXX--XXXXXXXXXXXXMGLFGQNNGGTXXXXXXXFVLSSTXXXXXXXXXXXXXXSQM 1329
              +                M LFG+N GGT        VL S+              SQ+
Sbjct: 1272 VKQDTGNGAAPPPPPPPPPMALFGKNMGGTPPPPPLPSVLRSSAAGAIPPAPPMMPASQV 1331

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEK+DSTDNSIWG+GKAEKFADDLYEKGVL
Sbjct: 1332 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVL 1391

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
            ADLEKAFAAREIKSLATKRKEDL+K+TFLSRDISQQFGINLHMYSSLSV DLVKKIL CD
Sbjct: 1392 ADLEKAFAAREIKSLATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCD 1451

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            RDFLQTPSVVEFLSKPEI EVSVNLARNYAPYSTDWEG+++L+DAKPPEKDPNDLQRADQ
Sbjct: 1452 RDFLQTPSVVEFLSKPEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQ 1511

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            IYLQLMVNLE YWGSRMRAL VVTSYEKEYNELL KLRKVD+AVGALQESDNLRNVFNVI
Sbjct: 1512 IYLQLMVNLESYWGSRMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVI 1571

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE
Sbjct: 1572 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1631

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVLDVVKVSIEQLVNDC+DFSQSIVNVERSVEIGNLSDSSKFHPLDK+LIKTLPVLPEAR
Sbjct: 1632 PVLDVVKVSIEQLVNDCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEAR 1691

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +KGDLLEDEVKLTIMEFESLM TYGEDSG               +NEYK+AQSQNLAAEE
Sbjct: 1692 KKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEE 1751

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHR--EHSALPXXXXXXXXXDRRAVMDKLLEQLKNAG 1807
            EER+YEKHKK+VEEQQKRAQ++EK +   +S+           DRRAVMDKLLEQLKNAG
Sbjct: 1752 EERIYEKHKKIVEEQQKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAG 1811

Query: 1808 PAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESP 1867
            P KSDPSSARKRALVRK+Y+SDKDNS Q+LNDL++EEGSILYSPEA  PD D VIHAESP
Sbjct: 1812 PGKSDPSSARKRALVRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAESP 1871

Query: 1868 TPLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEK 1927
            TPL TRG +N PEDLPSPSKAS LEDQEEI+DRA+MLLKELRGSD PVKQNSILDEHLEK
Sbjct: 1872 TPLTTRGTLNIPEDLPSPSKASTLEDQEEISDRAKMLLKELRGSDTPVKQNSILDEHLEK 1931

Query: 1928 LRARKERANGETNTGNKLSFK 1948
            LRARKER  GE + GNKLSFK
Sbjct: 1932 LRARKERTIGEGSAGNKLSFK 1952

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score = 2852 bits (7393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1474/1943 (75%), Positives = 1576/1943 (81%), Gaps = 37/1943 (1%)

Query: 23   LFQNLKRLXXXXXXXXXXXXXXXXXEHQHPPVGQEXXXXXXXXXXFRRLNGPSRSTSTEA 82
            L QNLKRL                 + QH P+GQE          FR LNGPSR+TS EA
Sbjct: 22   LLQNLKRLANSNGTSANAASPTNATQQQHSPMGQESSTSPSSSSSFRNLNGPSRTTSIEA 81

Query: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQH 142
            RPLNKK+TLNTQNLSQYM+GK+S D P SSQHARSHSVQSKYSYSKR SSQASNKLTRQH
Sbjct: 82   RPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQH 141

Query: 143  TGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGD 202
            TGQ                 KFTTPDGKIHLEMPSDPYEVE+LFEDIMYKRNIFQSLSGD
Sbjct: 142  TGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSGD 201

Query: 203  KQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQHPILTANSTLSSP 262
            KQE LM YSTEKKWLIVKQDLQNELKK                  D  PILTANS+LSSP
Sbjct: 202  KQEALMGYSTEKKWLIVKQDLQNELKKMRANTTSSSAASRTSVASDHLPILTANSSLSSP 261

Query: 263  KSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIAGGLKKQPSLNSIYRGG 322
            KS LMTSASSPTSTVY             GTST K   +KK + G LKKQPSLN+IYRGG
Sbjct: 262  KSILMTSASSPTSTVYSNNLNHSTTLSSAGTSTSK---SKKIVTGSLKKQPSLNNIYRGG 318

Query: 323  PEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGH 382
             E N SASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFI+HQGH
Sbjct: 319  SENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGH 378

Query: 383  IAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 442
            IAMANVLMNS+YKTAPR++LTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE
Sbjct: 379  IAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 438

Query: 443  GLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS 502
            GLFSTKL T+KMATEIFVCMLEKKNK+RFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS
Sbjct: 439  GLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS 498

Query: 503  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINH 562
            HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASD+FKNGGGENAILEYCQWTMVFINH
Sbjct: 499  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINH 558

Query: 563  LCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEAS 622
            LCSCSDN+NQRMLLRTKLENCG+LRIMNKIKLLDYDKVIDQI+LYDNNKLDDFNVKLEA+
Sbjct: 559  LCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEAN 618

Query: 623  NKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLK 682
            N+AFNVDL+DPLSLLKNLW ICKGT+NEKLLVSLVQHLFLSSSKLIEENQN SKL+KQLK
Sbjct: 619  NEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLK 678

Query: 683  LMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERD 742
            LMDSLVTNVS+AS ADEESN+NMAIQRLYDAMQTDEVARRAILESR LTKKLEEIQAERD
Sbjct: 679  LMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERD 738

Query: 743  SLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVEL 802
            SLSEKL KAEHGLVGQLE+ELH RD ILAKNQRVM                      VEL
Sbjct: 739  SLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVEL 798

Query: 803  RKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGM 862
            RKMLTILNSRPEESSD+++GT++I+PSLN SEKANIQKVLQDGLSRAKKDYKDDSKKFGM
Sbjct: 799  RKMLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGM 858

Query: 863  TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXXXSS 922
            TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERL                      
Sbjct: 859  TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKNFL 918

Query: 923  VKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYK 982
             + Q ADMNKLNDLRRALA+IQMESN+ISKFNVEERVNELFNEKKSLALKRLKELETKYK
Sbjct: 919  ARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYK 978

Query: 983  GFGIDFNVEEFIETPKKFSV--DEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVK 1040
            GFGIDFNVE+ +E+PKK SV  + E DA Y SLDPKAYQ KLDEINRITDELLDLQTQ K
Sbjct: 979  GFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRITDELLDLQTQTK 1038

Query: 1041 QXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYG 1100
            Q                       +YQDASP+ E R E SELSAGSGPGSFLDALSQKYG
Sbjct: 1039 QETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYG 1098

Query: 1101 TGQNVTASAGLRDN---RGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPFK 1157
            TGQNVTASAGLRD+    G GH PS VEK+F+NRL++ST +SAPYLEELTQKVNKVEP +
Sbjct: 1099 TGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCE 1158

Query: 1158 QNKDEDLVKDLSTENDIADGTFVSDKVGGDVQKHIKNKVRKRLDDKXXXXXGXXXXXXXX 1217
            QN+  ++ ++LS +  +   T  SD++    Q+H++NK++                    
Sbjct: 1159 QNEHVNIPRELSPKKSLTSST--SDEIEKYDQEHVENKIQGS-----------TTSTSTG 1205

Query: 1218 XXXXXXXXXXNPSTTSSTLHXXXXXXXXXXXXX--LRLFGTVNQSPDKEKETEDD----- 1270
                      N  T+SS L                + LFG   +S  +EKE ED+     
Sbjct: 1206 GQPNSVLEAENSLTSSSVLPPPPPPPPPPPPPPVPIELFG---KSLVREKEIEDNAAKQN 1262

Query: 1271 -TAGEXXXXXXXXXXXXXX---MGLFGQNNGGTXXXXXXXFVLSSTXXXXXXXXXXXXXX 1326
             TAGE                 M LFG+  GGT        VLSS+              
Sbjct: 1263 TTAGEAVPPPPPPPPPPPPPPPMALFGKPTGGTPPPPPLPSVLSSSATGAIPPAPPMMPA 1322

Query: 1327 SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEK 1386
            SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEK+DSTDNSIWGSGKAEKFADDLYEK
Sbjct: 1323 SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEK 1382

Query: 1387 GVLADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKIL 1446
            GVLADLEKAFAAREIKSLATKRKEDLQK+TFLSRDISQQFGINLHMYSSLSV DLVKK+L
Sbjct: 1383 GVLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVL 1442

Query: 1447 KCDRDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQR 1506
             CDRDFLQTPSVVEFLSK EI EVSVNLARNYAPYSTDWEG+R+L+DAKPPEKDPNDLQR
Sbjct: 1443 NCDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQR 1502

Query: 1507 ADQIYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVF 1566
            ADQ+YLQLM+NLE YWGSRMRALTVVTSYE+EYNELLAKLRKVD+AVGALQ SDNLRNVF
Sbjct: 1503 ADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVF 1562

Query: 1567 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLK 1626
            NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDT NSMTFLNYVEKIIRLNYP+FNDFLK
Sbjct: 1563 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLK 1622

Query: 1627 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1686
            ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP
Sbjct: 1623 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1682

Query: 1687 EARRKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLA 1746
            EARRKGDLL+DEVKLTIMEFESLMQTYGEDSG               +NEYK+AQ+QNLA
Sbjct: 1683 EARRKGDLLKDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLA 1742

Query: 1747 AEEEERLYEKHKKMVEEQQKRAQDKEKHREHSALPX--XXXXXXXXDRRAVMDKLLEQLK 1804
             EEEERLYEKHKK+VEEQQK+AQ+KEK +E SA P           DRR VMDKLLEQLK
Sbjct: 1743 GEEEERLYEKHKKLVEEQQKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLK 1802

Query: 1805 NAGPAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHA 1864
            NAGPAK+DPSSARKRALVRKKY+SDKD++ Q+LNDL++EEGSILYSPEATTPDT T +HA
Sbjct: 1803 NAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHA 1862

Query: 1865 ESPTPLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEH 1924
            ESPTPLATRG MNTPEDLPSPSKA ALEDQEEI+DRARMLLKELRGS+  VKQNS LDEH
Sbjct: 1863 ESPTPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEH 1922

Query: 1925 LEKLRARKERANGETNTGNKLSF 1947
            LEKLRARKERA+ ETNTGNKLSF
Sbjct: 1923 LEKLRARKERASSETNTGNKLSF 1945

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score = 1147 bits (2968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/1088 (57%), Positives = 744/1088 (68%), Gaps = 45/1088 (4%)

Query: 77   STSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASN 136
            S +   +PLNKK +LNTQNLSQY+N K S     S+    S         S +T     N
Sbjct: 65   SHTNSLKPLNKKTSLNTQNLSQYINDKHSPQHTRSASVQSSSKYSYSRRSSSQTLGSTLN 124

Query: 137  KLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIF 196
            ++ RQHT Q                 KF  PDGKI+LEMP DP EVEVLFEDIM KRNI 
Sbjct: 125  QIARQHTNQSSASILSQGSFTNLS--KFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNIL 182

Query: 197  QSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXX-XXXXXXXXXXXXXXXXDQHPILTA 255
            QSL  DKQ ELMSY  EKKWLIVKQDLQNE+KK                      P  ++
Sbjct: 183  QSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKTNSTNTNNNNNNNRSSMSPENSS 242

Query: 256  NSTLSSPKSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIA---GGLKKQ 312
               L+SP +  M    SP   +                S+   H+   TI+    G    
Sbjct: 243  TINLNSPATMQM----SPHHHI-----------GSNSNSSINSHHTPITISKRPTGPISN 287

Query: 313  PSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDW 372
            P  N+        NTS+S++  D+TNRPPIHYV+RI+AD +T++EMKDLWVTLRTEQ+DW
Sbjct: 288  PIPNADMYKLSMRNTSSSSM-SDKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDW 346

Query: 373  VDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFST 432
            VDAFI+HQGHIAMAN+LM S+YKT+       +LLEKEN+FFKCFRVLSMLSQGL EF+ 
Sbjct: 347  VDAFIEHQGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTR 406

Query: 433  HRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQ 492
            H +M+ TVA GLFS  L TR+MATEIFVCMLEKKN  RF+ +L ALD+KF+IG N HM Q
Sbjct: 407  HEIMSQTVARGLFSITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQ 466

Query: 493  NFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEY 552
            N K  P YF+HLTL+S LK+ QAWLFAVE TLDGRGKMGSLVGASD+FKN GGENAILEY
Sbjct: 467  NIKMFPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEY 526

Query: 553  CQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKL 612
            CQW+M+FINHLCSCS N+NQRMLLRTKLENCGILRIMNK+K LDYDKVI+QI+LY+NNKL
Sbjct: 527  CQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKL 586

Query: 613  DDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQ 672
            DD N  LE++NK  N++L+DP S+L+NLW+ CKGT+NEKLL+SL+QHLFLSSS+ IEE +
Sbjct: 587  DDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKK 646

Query: 673  NPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTK 732
            +P KLS+QLKL+DSLVTNVSV+ST D+E++MNMAIQRLYDAMQTDEVARR+ILESRTLTK
Sbjct: 647  DPVKLSRQLKLLDSLVTNVSVSST-DQEASMNMAIQRLYDAMQTDEVARRSILESRTLTK 705

Query: 733  KLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXX 792
            KLEE+QAERD LS+KL  AEHGLVGQL++EL  RDRIL+KNQRVM               
Sbjct: 706  KLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHL 765

Query: 793  XXXXXXXVELRKMLTILNSRPE--ESSDLSKGTKDINPS-LNSSEKANIQKVLQDGLSRA 849
                   VELRKMLTILN+RPE  E +  SK TK  NPS L+ S+K +IQ+ LQDGLSR 
Sbjct: 766  LEKHEQEVELRKMLTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRT 825

Query: 850  KKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXX 909
            KKDY  D++ FGMT+QPNKRLK+LRMQME+IENEAR+LEMTNF E+EK +L         
Sbjct: 826  KKDYSVDARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKP 885

Query: 910  XXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSL 969
                       S        +NKLNDLR+ LAEIQMESNDISKFNV+ERVNELFN+K+  
Sbjct: 886  KKVATKKEIDPS--------INKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRIT 937

Query: 970  ALKRLKELETKYKGFGIDFNVEEFIETPKK-FSVDEENDAAYPSLDPKAYQSKLDEINRI 1028
            ALKRL++LETKYK FGIDFN++E +++  K  + + +    Y SLDPKAYQ KLDE+NR+
Sbjct: 938  ALKRLQDLETKYKDFGIDFNIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRL 997

Query: 1029 TDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERRGEYSELSAGS-G 1087
            TDELL ++ +V                            D     ER+   S  S  S G
Sbjct: 998  TDELLRVKNKVNASDNNLSSRRPSASSSSESASSSSDSDDGESLIERQDTQSNFSGTSAG 1057

Query: 1088 PGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELT 1147
            PGSFL+AL+QKY TGQ    SA  RD   S  M  N+   FINR+ K T  + P+L+ELT
Sbjct: 1058 PGSFLEALTQKYATGQ---KSASPRDQ--STRMKDNI---FINRI-KQTNVAPPFLDELT 1108

Query: 1148 QKVNKVEP 1155
             KV +  P
Sbjct: 1109 DKVAEAPP 1116

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/625 (68%), Positives = 509/625 (81%), Gaps = 15/625 (2%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            K  + SPLLPQS SLFE YPRP KKLKQLHWEK+D+TDNSIW + KAEKFADDLYEKGVL
Sbjct: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
             DLEKAFAAREIKSLA+K+KEDL K++FLSRDISQQFGINLHMY++L V D+VKKILKCD
Sbjct: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            RDFL TPSV+EFLSKPEI EVSVNLARNYAPYSTDWEG++ +EDAK PEKDPN+LQRADQ
Sbjct: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            +YLQL++NL+ YWGSRMRALTV+T+++KEYNELL KLRKVD+AV +LQES+NL+NVFNVI
Sbjct: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKI+R NYPSFNDFL ELE
Sbjct: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVLDVVK+SIEQLV+DCK+FSQSIVNVERSVE GNLSDSSKFHP D+VL K LP+LP+AR
Sbjct: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +KG+LL DEVKLTIMEF  LMQ YGEDS                + EYK+AQ+QN+ AEE
Sbjct: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEE 1692

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPA 1809
            EE++YE+HKKMVE+QQK+ Q++E     S            DRRA+MDKLL+QLKNAGP+
Sbjct: 1693 EEQVYERHKKMVEDQQKKLQEQENGSNGSENGEEGSGDDSGDRRAMMDKLLDQLKNAGPS 1752

Query: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTP-----DTDTVIHA 1864
            K+DPSSARKRALVRKK +++   S  +L D+  E+ SI+YSPE   P     D DT  H 
Sbjct: 1753 KTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLDTP-HD 1808

Query: 1865 ESPTPLATRGFMNTPEDLPSPSKASAL--EDQEEITDRARMLLKELRGSDAPVKQNSILD 1922
            ES   +++     +     SPS+ S L  +DQ+E+TDRA+ LL ELRGS+ P K+NS+LD
Sbjct: 1809 ESEMDVSSSPIQRS----LSPSRNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLD 1864

Query: 1923 EHLEKLRARKERANGETNTGNKLSF 1947
            EH EKLRAR+ + N + ++G +L F
Sbjct: 1865 EHKEKLRARRRKTNSDLHSGTRLQF 1889

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score = 1109 bits (2869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1104 (55%), Positives = 764/1104 (69%), Gaps = 75/1104 (6%)

Query: 81   EARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS--KYSYSKRTSSQASN-- 136
            ++RPLNKK+TLN+QNLSQY+N   +    + S H R+ S QS  KYSYS+R+S Q S   
Sbjct: 73   QSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAP 132

Query: 137  ------KLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIM 190
                   LTR +T                   +F TPDGKI+L MPSDPYEVE LFEDIM
Sbjct: 133  SSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIM 192

Query: 191  YKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQH 250
            YKRNI QSL  +KQ ELMSYS EKKWLIVKQDLQNE K+                     
Sbjct: 193  YKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKR--------------------- 231

Query: 251  PILTANSTLSSPKSALMTSASSPTSTVYXXXXXXXXXXXX----VGTSTPKGH--NNKKT 304
             I  +N   S    ++    S P+++V                 V ++ P  +  + KK 
Sbjct: 232  -IKASNKGDSRTGMSMPDLGSDPSNSVSPPGPISSSGSSIFSSDVTSTAPSTYSRSGKKN 290

Query: 305  IAGGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVT 364
            I        +   +Y    E NTS+ST+  D+ NRPPIHYV++I+ DKL+ DEMKDLWVT
Sbjct: 291  IPISKPIAATSTELYHIA-ERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVT 349

Query: 365  LRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLS 424
            LRTEQLDWVDAF+++QGHIAMAN+LM SIYKT P++ +++ LL+KEN+FFKCFRVL++LS
Sbjct: 350  LRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLS 409

Query: 425  QGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRI 484
            QGL+EF+ H LMTDT+A+GLFS +L TRKMATEIFV +LEKKNK RFE+VL++LDK F I
Sbjct: 410  QGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFII 469

Query: 485  GQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGG 544
            GQN HM +++KK+PQYF+HLT  S+LK+IQAWLFAVEQTLDGRGKMGSLVGAS+++KN G
Sbjct: 470  GQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAG 529

Query: 545  GENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQI 604
            GENAILEYCQWTMVFINHLCS S+N+NQR LLR KLENCGILRIMNKIKLLDY+KVIDQI
Sbjct: 530  GENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQI 589

Query: 605  ELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSS 664
            ELY+NNKLDDFN  LE++ K  NVDL+DP+SL+KNL + CKGT+NEK LVSLVQH+FL +
Sbjct: 590  ELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPT 649

Query: 665  SKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAI 724
            SKL++E Q+P+K++KQLKLMDSLVTNVSV ST +E SN+NMAIQRLYD+MQTDEVARRAI
Sbjct: 650  SKLLDEKQDPNKVTKQLKLMDSLVTNVSVTST-EEGSNVNMAIQRLYDSMQTDEVARRAI 708

Query: 725  LESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXX 784
            LESRTLTKKLEE++AERD L EKL KAEHGLVGQLE E+  RDRILAKNQRVM       
Sbjct: 709  LESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESEL 768

Query: 785  XXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQD 844
                           VELRKMLTILNSRP ++ +  K       S+ +SEK ++Q+ LQ 
Sbjct: 769  EELKKKHLLEKHEQEVELRKMLTILNSRPAKTKEQKKKI----GSIEASEKEDLQRALQS 824

Query: 845  GLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXX 904
            GL +AKKD+KDDSKKFGMT+QPN+RLK+LRMQME+IENEAR+LEMTNFAE+EK+ L    
Sbjct: 825  GLQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPA 884

Query: 905  XXXXXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFN 964
                             S   +   + KLN+LR  L  IQMESND+SKFNV+ERVNELFN
Sbjct: 885  NVQKKSKPI--------SELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFN 936

Query: 965  EKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDE 1024
            +KK  AL+RLKELETKYKGFGIDF VE+F       S D  N+  Y SLDPK YQ KLDE
Sbjct: 937  DKKRTALQRLKELETKYKGFGIDFKVEDFTHE----STDSSNE-GYSSLDPKVYQDKLDE 991

Query: 1025 INRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERRGEYSELSA 1084
            I +I++ELL  + +++                        +    + +++  G  S +S 
Sbjct: 992  ITKISEELLQQKNELE--TTQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNVS- 1048

Query: 1085 GSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAP-YL 1143
                GSFLD L+QKYGTGQ     + +      GH  +  EKSF++R++++  S  P Y+
Sbjct: 1049 DLASGSFLDTLTQKYGTGQAEPIQSPV------GHYSNRNEKSFVDRMKRN--SRVPSYV 1100

Query: 1144 EELTQKVNKVEPFKQNKDEDLVKD 1167
            EEL++K+      + NKD +  +D
Sbjct: 1101 EELSKKM------RGNKDHEFEED 1118

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/622 (67%), Positives = 496/622 (79%), Gaps = 5/622 (0%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            K  V+SPLLPQSPSLFE YPRP KKLKQLHWEK++STDNSIWGS KAEKFADDLYEKGVL
Sbjct: 1240 KKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVL 1299

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
            ++LEKAFAAREIKSLAT++KEDLQK++FLS DISQQFGINLHMYS+L+V   V+K+LKC+
Sbjct: 1300 SELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCE 1359

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            RDF+ TPSV+EFLSK EI EVS NLARNYAPYSTDWEGI+ +EDAK PEKDPN+LQRADQ
Sbjct: 1360 RDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQ 1419

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            IYLQLMVNL+ YW SRMRA+ ++TSYE+EYNELLAKL +VD+AVG+LQ SDNL+N+FNVI
Sbjct: 1420 IYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVI 1479

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGNFMND++KQA+GFKLSTLQRLTFIKD +NSMTFLNYVEKI+R NYP FN+FL ELE
Sbjct: 1480 LAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELE 1539

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVL+VVKVSIEQLVNDC DF Q I NVERS+EIGNLSDSSKFHPLDKVL+K LP L EAR
Sbjct: 1540 PVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEAR 1599

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +KG+LL DE+KLTIMEFE +MQTYGED G               + EYK+AQ+QN+  EE
Sbjct: 1600 KKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEE 1659

Query: 1750 EERLYEKHKKMVEEQQKRAQ-DKEKHREHSA-LPXXXXXXXXXDRRAVMDKLLEQLKNAG 1807
            EE  YE+HKKMVEEQQ++AQ D  K  E+S+            DRRAVMDKLLEQLKNAG
Sbjct: 1660 EEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAG 1719

Query: 1808 PAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESP 1867
              K+DP+SARKRAL+RKK  S +++ +  L ++     S++YSP+A     +  IH  SP
Sbjct: 1720 QVKTDPTSARKRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDA-KEQIELEIHMASP 1778

Query: 1868 TPLATR-GFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLE 1926
            TP     G + T E+    S    + + EEI DRA+ LL ELRGSDA + +N+ LDEH E
Sbjct: 1779 TPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKE 1838

Query: 1927 KLRARKERANG-ETNTGNKLSF 1947
            +LRAR++R +  +  + N+L F
Sbjct: 1839 RLRARRKRTDSNKIPSSNRLKF 1860

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1097 (55%), Positives = 725/1097 (66%), Gaps = 39/1097 (3%)

Query: 75   SRSTSTEARPLNKKATLNTQNLSQYMNGKISTD--APTSSQHARSHSVQSKYSYSKRTSS 132
            S  +S E +PL K  TLNTQNLSQY+N K   D     S Q +  +S  S+ + S+   S
Sbjct: 71   SLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQTNPS 130

Query: 133  QASNKLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYK 192
                KL RQ+T Q                 KF T DGK++LEMP+DP E+E L+++IM K
Sbjct: 131  VTGYKLDRQYTNQSSAVSVLSQGSYSNLS-KFMTHDGKLNLEMPTDPSEIEYLYQEIMIK 189

Query: 193  RNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQHPI 252
            RNI QSL G KQ+ELMSY   KKWLIVKQDLQNE KK                  + +  
Sbjct: 190  RNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGPDNNNNNNNN 249

Query: 253  LTANSTLSSP-KSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNK--KTIAGGL 309
               +  L SP KS  M S  S  +  +              T+  K +NNK  K  A  +
Sbjct: 250  YNNHLILGSPSKSNNMISPKSNLNN-FESPSSSLSASTQTTTNNYKQYNNKPSKRSASNI 308

Query: 310  KKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQ 369
             +  S   +Y      + S++T   D+TNR PI YV++I++D LT++EMKDLWVTLRTEQ
Sbjct: 309  SQPKSTTEVYSN--SHSNSSNTTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQ 366

Query: 370  LDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYE 429
            LDWVDAFI+HQGHIAMANVLM SIYKT P E LT +LLEKENSFFKCFRVLSMLSQGL E
Sbjct: 367  LDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLRE 426

Query: 430  FSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLH 489
            F+ H LM  T+A GLFST L TRKMATEIFVCML KKN  RF+ +L  LD+KF+IGQNLH
Sbjct: 427  FTKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLH 486

Query: 490  MIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAI 549
            M  N KK  +YF  LTL+S+LK+ +AWLFAVE +LDGRGKMGS VGASD++KN GGENA 
Sbjct: 487  MAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENAT 546

Query: 550  LEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDN 609
            LEYCQW+M+FINHLC CSDN+NQRMLLR KLE CGI+RIMN+IK L Y+KVI+QI++Y+N
Sbjct: 547  LEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYEN 606

Query: 610  NKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIE 669
            +KLDD N  LE SNK  N++L DP SL+KNLW+ CKGT+NEKLL+SLVQHLFLSSS+LIE
Sbjct: 607  SKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIE 666

Query: 670  ENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRT 729
            + Q+ ++LSKQLKLMDSLVTNVSVAST D+ES MNMAIQRLYDAMQTDEVARR+ILESRT
Sbjct: 667  DKQDATQLSKQLKLMDSLVTNVSVAST-DQESTMNMAIQRLYDAMQTDEVARRSILESRT 725

Query: 730  LTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXX 789
            LTKKLEE QAE D LS+KL  AEHGLVGQL++EL  RDR+ AKNQR+             
Sbjct: 726  LTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKK 785

Query: 790  XXXXXXXXXXVELRKMLTILNSRPEESS---DLSKGTKDINPSLNSSEKANIQKVLQDGL 846
                      VELRKMLTILN+R ++       SK  K I  S  SS+K NIQKVLQ+GL
Sbjct: 786  KHLLEKHEQEVELRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGL 845

Query: 847  SRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXX 906
            +R KKD+  DSK FGMT+QPNKRLK LRMQME+IENEAR+LEMTNFAEFEK++L      
Sbjct: 846  NRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKI 905

Query: 907  XXXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEK 966
                                      LN+LR+ LA IQ ESNDISKFNVEERVNELFNEK
Sbjct: 906  KKLKQKKQNKNEKKEEDDKIKK----LNELRQTLANIQNESNDISKFNVEERVNELFNEK 961

Query: 967  KSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAA--YPSLDPKAYQSKLDE 1024
            +S AL+RLKELETKYK FGI+FN+++  E  K   +D   D +  Y SLDP AYQ KLDE
Sbjct: 962  RSTALQRLKELETKYKDFGINFNIDDISE--KTTGIDNSGDKSTEYSSLDPNAYQIKLDE 1019

Query: 1025 INRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQ-----------DASPSQ 1073
            +NRIT++LLD Q ++ +                                     D   S+
Sbjct: 1020 LNRITEQLLDAQAKLNEKNLKDSSNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSR 1079

Query: 1074 ERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLR 1133
            +R+ E S  S  S  GSFL+ALSQKY  GQN   S+  RD           +  FINR+R
Sbjct: 1080 DRQSEISAQSTSSAAGSFLEALSQKYAMGQN-NPSSPQRDRPVKAS-----QYDFINRVR 1133

Query: 1134 KSTASSAPYLEELTQKV 1150
            K+  +   +LEEL+ KV
Sbjct: 1134 KNNITPQ-FLEELSGKV 1149

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/631 (65%), Positives = 503/631 (79%), Gaps = 24/631 (3%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            K  ++SPLLPQSPSLFE YPRPHKKLKQLHWEK+++TDNSIW + KAE+FADDLYEKGVL
Sbjct: 1331 KKVLSSPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVL 1390

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
            ++LE AFAAREIKSLA+K+K+DLQK+TFLS D+SQQFGINLHMY+SL V DL+ KILKCD
Sbjct: 1391 SELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCD 1450

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            RDFLQTPSV+EFLS+PEI +VSVNLARNYAPY  DWEGI+++EDAKPPEK+PN+LQRADQ
Sbjct: 1451 RDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQ 1510

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            IYLQLMVNL+ YWGSRMRAL V+T++EKEYNELL KLRKVDRAV +LQES+NL+NVF VI
Sbjct: 1511 IYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVI 1570

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+ N+MTFLNYVEKI+R NYP+FN FL ELE
Sbjct: 1571 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELE 1630

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVLDVVK+SIEQLV+DCK+FSQSIVNVERS+EIGNLSDSSKFHP D+VL K LP LP+AR
Sbjct: 1631 PVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDAR 1690

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +KG+LL DEVKLTIMEF  LMQ YGEDSG               + EYK+AQ+QNL  EE
Sbjct: 1691 KKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEE 1750

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXX-XDRRAVMDKLLEQLKNAGP 1808
            EE++YE+HKKMVEEQQ++AQ+ E  R +S             D RA+MD LLEQLKN  P
Sbjct: 1751 EEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTP 1810

Query: 1809 A-KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESP 1867
              K+DPSSARKRALVRKK +   ++++ +L D++ E+ SI+YSP+A  P   TV  A + 
Sbjct: 1811 TNKTDPSSARKRALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTT 1868

Query: 1868 TPLATRGFMNTPEDLPSPSKASAL-----------EDQEEITDRARMLLKELRGSDAPVK 1916
                    + +  D+ SP++ ++            E++EEI +RA+ LL +L GS +P K
Sbjct: 1869 --------LESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTK 1920

Query: 1917 QNSILDEHLEKLRARKERANGETNTGNKLSF 1947
            ++S+L+EH E+LRAR+ R   E  +G KL F
Sbjct: 1921 RHSLLNEHKERLRARRRRTTNEFVSG-KLQF 1950

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1108 (53%), Positives = 734/1108 (66%), Gaps = 62/1108 (5%)

Query: 69   RRLNGPSR-STSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS--KYS 125
            R+++ PSR S + + RPLNKK+T+NTQNLS YMNGK S ++  SS H+RS SVQS  KY+
Sbjct: 55   RKVSVPSRVSNANDLRPLNKKSTMNTQNLSHYMNGKSSAES-LSSNHSRSPSVQSSTKYT 113

Query: 126  YSKRTSSQAS-----NKLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPY 180
            YS+R+SS  S     + LTR+ T Q                  F TPDGKI L+MPS  +
Sbjct: 114  YSRRSSSHLSTPGVNSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPSS-H 172

Query: 181  EVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXX 240
            EVE LFED+MYKRNI Q+LS DKQ+ELM Y  +KKWLIVKQDLQN+ KK           
Sbjct: 173  EVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHA 232

Query: 241  XXXXXXXDQHPILTANSTLSSPKSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHN 300
                   D      ++  +SSP+S+ MT  S   +  +             G+S+    N
Sbjct: 233  AISSSNSDSL---PSSLKVSSPRSS-MTYESIQQAIKFNKTNN--------GSSSGPASN 280

Query: 301  NKKTIAGGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKD 360
            NK  +     K              N+S STL  ++ NRPPIHYV+RI+ADKLT +EM D
Sbjct: 281  NKSKLQQLSDK--------------NSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMND 326

Query: 361  LWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVL 420
            LWVTLRTEQLDWVD F++HQGHIAMANVL  SIYKT P   L+ +LLEKE++FF+CFRVL
Sbjct: 327  LWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVL 386

Query: 421  SMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDK 480
            S+L+QGLYE S H +M +TVA GLFS +L TRKMATEIFVCMLEKKNK RFEAVL ALDK
Sbjct: 387  SVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDK 446

Query: 481  KFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEF 540
            KF+IG+NLHM+   K  PQ+FSH T +S  KI+Q+WLFAVEQ+L+GRGKMGSLVGAS++F
Sbjct: 447  KFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDF 506

Query: 541  KNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKV 600
            K  GGENAILEY QWTMVFINH C+ +D +NQR+LLRT+LEN G LRIMN+ KLLDYDKV
Sbjct: 507  KASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKV 566

Query: 601  IDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHL 660
            ++ +E Y+N KLDD N  LE    A ++D+ D  SLLK L++ CKGT++EKLL SLV+HL
Sbjct: 567  MELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHL 626

Query: 661  FLSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVA 720
            FLS+S+L+E+NQ+P+KLSKQL+LMDSLVTNVSV S  DE S++NMAIQRLYD+MQTDEVA
Sbjct: 627  FLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSV-SAVDESSSINMAIQRLYDSMQTDEVA 685

Query: 721  RRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXX 780
            RRAILESRTLTKKLEE QAERD LS+KL K  +GLVGQLE E+  RD IL KNQRV    
Sbjct: 686  RRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQL 745

Query: 781  XXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDLS-KGT--KDINPS-LNSSEKA 836
                               VELRKMLTILNSRPE   DLS KG+      P  L+  +K+
Sbjct: 746  QDELEELKKKHLLEKHEHEVELRKMLTILNSRPE--GDLSRKGSVHSKAQPGILDPDKKS 803

Query: 837  NIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFE 896
             IQ+ LQDGL + KKD   DSK+FG+T+QPNKRLKMLR+QME+IE EAR+LEMTNFA+  
Sbjct: 804  TIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHN 863

Query: 897  KERLXXXXXXXXXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVE 956
            K  L                      +K      NKL++LR+ALA+IQ ESN +SKFNVE
Sbjct: 864  KAVLQAPVKVESSNYVRKENELRAKELKA-----NKLSELRKALADIQKESNGVSKFNVE 918

Query: 957  ERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYPS-LDP 1015
            ERVNELF +KK  AL RL +LE  YK +GID +    I+   + S + E +A  PS LDP
Sbjct: 919  ERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDP 978

Query: 1016 KAYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQER 1075
            +AYQ+KLDEI+RI+ EL+++++++K                           D    Q+ 
Sbjct: 979  RAYQAKLDEIDRISKELIEMKSELKNDKALRRHESPSKQDT-----------DDDEIQDT 1027

Query: 1076 RGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKS 1135
                +E    SG  SFL++LSQKYGTG+N T +    D   S     +  +SF+ R++K 
Sbjct: 1028 GSMVNEDLQSSGTSSFLESLSQKYGTGKNAT-NMLTNDILNSSERKGHSRQSFMERMKKP 1086

Query: 1136 TASSAPYLEELTQKVNKVEPFKQNKDED 1163
            +   A YLEEL  KV K  P    + ED
Sbjct: 1087 SGVPA-YLEELPLKVPKAPPLGVAETED 1113

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/607 (67%), Positives = 492/607 (81%), Gaps = 18/607 (2%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            ++AV SPLLPQSPSLF  YPR  KKLKQLHWEK+D+TDNSIW SGKAEKFA DLYEKGVL
Sbjct: 1236 RTAVPSPLLPQSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVL 1295

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
             DLEKAFAAREIKSLATK++EDL K+TFLSRD+SQQFGINLHMYS LSV +LV KILKC+
Sbjct: 1296 EDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCE 1355

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            RDF+ TPSV+EFLSKPEI EVS NLARNY+PYSTDW+G+  +EDAK PEKDP +LQRADQ
Sbjct: 1356 RDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQ 1415

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            +YLQL+ NL+ YWGSRMRAL V+TSYE+EY+EL+ KLRKVD+AV  +Q+S NLRNVFNVI
Sbjct: 1416 LYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVI 1475

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MND++KQAQGFKLSTLQRLTFIKD NNSMTFLNYVEKI+R NYPSFNDFL++L+
Sbjct: 1476 LAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQ 1535

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVLDVVK+SIEQL++DCK+FSQSI NVERS++IGNL+DSSKFHPLDKVL+K LPVLPEA 
Sbjct: 1536 PVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEAS 1595

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            ++ +LL++EVKL+IMEFESLMQ YGEDS                +NEYKRAQ+QNL AEE
Sbjct: 1596 KRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEE 1655

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPA 1809
            EERLY+ HKKMVEEQQKRA++KE+    +            DRRA+MDKLLEQLKNAGP 
Sbjct: 1656 EERLYQTHKKMVEEQQKRAEEKERSENAT---EEDASEENEDRRAMMDKLLEQLKNAGPV 1712

Query: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTP 1869
            K+DP SARKRA++RKK ++D +  + VL+ +  E+ S++YSPE     T+       PT 
Sbjct: 1713 KADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPEKQEGITN-------PTG 1765

Query: 1870 LATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLR 1929
             +++         PS   A+  +D+EEITDRA+ LL  LRG ++P K+N++L+ H EKLR
Sbjct: 1766 DSSQS--------PSKGAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLR 1817

Query: 1930 ARKERAN 1936
            AR+ + N
Sbjct: 1818 ARRRKTN 1824

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/1109 (51%), Positives = 714/1109 (64%), Gaps = 59/1109 (5%)

Query: 74   PSRSTSTEARPLNKKATLNTQNLSQYMNG-KISTDAPT-----SSQHARSHSVQS--KYS 125
            P + TSTE RPLNKK+TLNTQNLSQY++G KI  D P      ++ H R+HS QS  KYS
Sbjct: 54   PKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYS 113

Query: 126  YSKRTSSQASN-KLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEV 184
            YS+R+S+     KL+RQ T Q                 K+   DGKI+LEMP DP+EVE 
Sbjct: 114  YSRRSSTATGPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEA 173

Query: 185  LFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXX 244
            LFED+MYKRNIFQ+L  DKQ+ELMSY   KKW +VKQDLQNE+KK               
Sbjct: 174  LFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSY------- 226

Query: 245  XXXDQHPILTANSTLSSPKSAL------------MTSASSPTSTVYXXXXXXXXXXXXVG 292
                 HP   + S+ S+    L               ++SP + ++              
Sbjct: 227  -----HPTEGSYSSASNSNGNLNSYSSSLRSSATSQDSNSPQTAIFTSNSGTMQNNTINL 281

Query: 293  TSTPKGHNNKKTIAGGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADK 352
             +       K    G        NS+     E N S S++  DR NRPPIHYV++I+AD+
Sbjct: 282  NNGNIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADR 341

Query: 353  LTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENS 412
            LT++EM DLWVTLRTEQLDWVDAF++HQGHIAMANVLMN+IYK AP   LT EL EKE+S
Sbjct: 342  LTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHS 401

Query: 413  FFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFE 472
            FFKCFRVLSMLSQGLYEF+ H+LM+DT+A GLFS++L TRKMATE+ VCM+EK+N  RFE
Sbjct: 402  FFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFE 461

Query: 473  AVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGS 532
             VL +LD+ FR  +NL+M+   K +P  +   T  +  KIIQAWL A+++TL+GRGKMGS
Sbjct: 462  VVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGS 521

Query: 533  LVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKI 592
            LVGASD++++  GENAILEYC WTMVFINHLCS S  +NQR+LLRTKLEN G LRIM K+
Sbjct: 522  LVGASDDYRS-AGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKL 580

Query: 593  KLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKL 652
            K LDY+K+ +QIELYDNNKLDDFN  LE  +K   V++++P SL++NLWE CKG+DNEKL
Sbjct: 581  KRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKL 640

Query: 653  LVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYD 712
            L+SL+QHL+LSSSKL+ E ++P+KLSKQLKL+DSL+TNV+  S  DEES+MN+AIQRLYD
Sbjct: 641  LLSLIQHLYLSSSKLMGEKEDPTKLSKQLKLIDSLLTNVN-GSMFDEESHMNLAIQRLYD 699

Query: 713  AMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAK 772
            +MQTDEVARRAILESRTLTKKLEE  AERD LS KL  AE+GLVGQLE++L  RD IL K
Sbjct: 700  SMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEK 759

Query: 773  NQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDLSKGTKDINPSLNS 832
            NQRVM                      VELRKMLTILNSR   +   +    D+  +L+ 
Sbjct: 760  NQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNSR---NGTQNPDVDDVTITLDP 816

Query: 833  SEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNF 892
            ++K +IQK L+  L++ KKD  +DSK+FG+T+QPNKRLKMLRMQME+IENEARQLEMTNF
Sbjct: 817  NKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNF 876

Query: 893  AEFEKERLXXXXXXXXXXXXXXXXXXXXSSV-KTQGADMNKLNDLRRALAEIQMESNDIS 951
            A+ ++  L                        K       KL  LR+ALA IQ E+NDIS
Sbjct: 877  ADHKRTNLKKPVIVKKEKKLRKKKKINTEEFDKENEMKTKKLMQLRKALAAIQSETNDIS 936

Query: 952  KFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYP 1011
            KFNVE RVNE+F +KK  AL+RLK+LE KYK F I F+     E       + +++  + 
Sbjct: 937  KFNVEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFD-----ELQDLDDRELDDEQQHS 991

Query: 1012 SLDPKAYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASP 1071
            +LDP   Q K++E++ I+DEL  +                                D   
Sbjct: 992  TLDPTYLQKKINELDEISDELYLMNYDSDANNGNTSDSSSSSEA------------DGDG 1039

Query: 1072 SQERRGEYSELSAG-SGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFIN 1130
            +   R   +  S G S  GSFL++LSQKYGTGQN  +S        +  + S  EKSF+N
Sbjct: 1040 TDSMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPT-SITSPNERIASQGEKSFMN 1098

Query: 1131 RLRKSTASSAPYLEELTQKVNKVEPFKQN 1159
            RL++ T  +AP+LEELTQKVN       N
Sbjct: 1099 RLKRQTM-AAPFLEELTQKVNDTSSIDDN 1126

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/669 (58%), Positives = 483/669 (72%), Gaps = 38/669 (5%)

Query: 1289 MGLFGQNNGGTXXXXXXXFVLSSTXXXXXXXXXXXXXXSQMKSAVTSPLLPQSPSLFEKY 1348
            +G  G+N+GGT        ++                    KS V  P L Q  +  ++ 
Sbjct: 1227 LGAGGKNSGGTPPPPPPPPMMG--------------KKEPYKSVVDQPSLLQLTN-SDRL 1271

Query: 1349 PRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKR 1408
            PRP KKLKQLHW+K+DSTD+SIW  G AE+FADDLYEKGVL +LEKAFAAREIKS+ T++
Sbjct: 1272 PRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRK 1331

Query: 1409 KEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEIT 1468
            KEDL K++FLS DISQQFGINLHMY SL+V +L++K+LKCDR+ + TPSV+EFL+K EI 
Sbjct: 1332 KEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIV 1391

Query: 1469 EVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQI-------YLQLMVNLEQY 1521
            EVSVNLARNYAPY+TDWEG++ L+  K         QR  Q+       ++  MVNL+ Y
Sbjct: 1392 EVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELIKFIYNMVNLQSY 1443

Query: 1522 WGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSK 1581
            W SRMRAL V+TSYE+EYNEL+ KLRKVD+AVGA+Q S+NL+NVFNVILAVGN+MNDTSK
Sbjct: 1444 WASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSK 1503

Query: 1582 QAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQ 1641
            QAQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYPSFNDF+ +LEPVLDVVK+S+EQ
Sbjct: 1504 QAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQ 1563

Query: 1642 LVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKL 1701
            L++DC +FSQSIVNVERS+EIGNLSDSSKFHP DKVL K LPVLPEA +K  LL DEVKL
Sbjct: 1564 LISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKL 1623

Query: 1702 TIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMV 1761
            TIMEFE+LM+ YGED+G               + EYK+AQSQNL  EEEER YEKHK+M+
Sbjct: 1624 TIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHKRMI 1683

Query: 1762 EEQQ-KRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKSDPSSARKRA 1820
            EEQQ K+  ++E+ RE    P         DRRA+MDKLLE+LKNAGP K+DPSSARKRA
Sbjct: 1684 EEQQHKQDLEEERSREVEGEP----GEEQSDRRAMMDKLLEKLKNAGPGKADPSSARKRA 1739

Query: 1821 LVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPE 1880
            LVRKK ++DK+ +A +L D++  + SI+YSP   T +    IH  SPTP      +    
Sbjct: 1740 LVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPNDIHLASPTPSGKSDLVLASV 1799

Query: 1881 DLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRARKERANGETN 1940
                 S A  + + E I+DRA+ LL ELRGS+  +K+NS L+E  EKL+AR+ R   +T 
Sbjct: 1800 SPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKRNSQLEEQKEKLKARRSRRRTQTE 1858

Query: 1941 --TGNKLSF 1947
              + NKL F
Sbjct: 1859 SISSNKLFF 1867

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/850 (61%), Positives = 635/850 (74%), Gaps = 31/850 (3%)

Query: 311  KQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQL 370
            K+P+ + +Y+   E N S STL  D+TNRPP  YV++I+ADKL+ DEM+DLWVTLRTEQL
Sbjct: 288  KKPTSHELYQLT-ESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQL 346

Query: 371  DWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEF 430
            DWVD+F+++QGHIAMAN+LM  IYKT P++HL+ +LLEKENSFFKCF+VLSMLSQG+YEF
Sbjct: 347  DWVDSFLENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEF 406

Query: 431  STHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHM 490
            S H+LMTDT+A GLFST+L TRKMA EIFVCMLEK+NK+RFEA+L +LD+ FRIG N HM
Sbjct: 407  SKHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHM 466

Query: 491  IQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAIL 550
             QN KK+PQYF HLT +SHLK++QAWLF++E T+DGRGKMGSLVGAS + KN GGENAIL
Sbjct: 467  FQNLKKLPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAIL 526

Query: 551  EYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNN 610
            EYC WTMVF+N LC+ S  + QRMLLRTKLEN G LRIMNKIKLL+Y+KVID+IE Y+NN
Sbjct: 527  EYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENN 586

Query: 611  KLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEE 670
            KLDDFN+ LE+ NK  NV+L+DP+SLL NLW+ CKGT+NEKLL+SL+QHLFLSSS+LIEE
Sbjct: 587  KLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEE 646

Query: 671  NQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTL 730
              +P+KLSKQLKLMDSLVTNVS +STADEES MNMAIQRLYD+MQTDEVARRAILESRTL
Sbjct: 647  VDDPTKLSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTL 706

Query: 731  TKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXX 790
            TKKLEE+QAE+D L EKL KAE+GLVGQLEN+L+ RD+ILAKNQRV              
Sbjct: 707  TKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKK 766

Query: 791  XXXXXXXXXVELRKMLTILNSRPEESSDLSKGTKDIN------PSLNSSEKANIQKVLQD 844
                     VELRKMLTILN+R    S  + G K I+        LN  +  NIQKVLQD
Sbjct: 767  HLLEKHEHEVELRKMLTILNTR----SSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQD 822

Query: 845  GLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLX--- 901
            GL RAK D+  D+KKFGMT+QPNKRLKMLRMQME+IENEARQLEMTNF EFE+++L    
Sbjct: 823  GLIRAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPV 882

Query: 902  XXXXXXXXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNE 961
                                    Q + +NKLNDLR ALAEIQ ESN+ISKFN+EERVNE
Sbjct: 883  EVTKPKHRHKKHKIEKINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNE 942

Query: 962  LFNEKKSLALKRLKELETKYKGFGIDFNVEEFIET-PKKFSVDEENDAAYPSLDPKAYQS 1020
            LFNEKK  AL+RLKELETKYK FGI+F +++F+E  P   + +   +  Y SLDPK Y+ 
Sbjct: 943  LFNEKKLKALQRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEK 1002

Query: 1021 KLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERRGEYS 1080
            KLD+I+R+T++LL+LQ    Q                       I+  +S S+       
Sbjct: 1003 KLDDIDRLTEQLLNLQKT--QELREESSSSYSSSESDEENDDDEIFVASSSSK------- 1053

Query: 1081 ELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSA 1140
               AGSG  SFL+ LS+KYGTGQ   A     ++R    + +  EK F++R+R+S +++A
Sbjct: 1054 --PAGSGTRSFLETLSEKYGTGQKNVAMTATPNSR----IVTQSEKQFLDRMRRS-STAA 1106

Query: 1141 PYLEELTQKV 1150
            P+L+ELT+KV
Sbjct: 1107 PFLQELTEKV 1116

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/622 (67%), Positives = 498/622 (80%), Gaps = 13/622 (2%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            KS  +SPLLPQSPSLFE+YPR  KK+KQLHWEKI++TDNSIW +GKAE+FADDL+EKGV 
Sbjct: 1285 KSVSSSPLLPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVF 1344

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
            ++LEKAFAARE+KSLA+KRK+DL K+TFLSRDISQQFGINLHMYSSLSV DLV KILKCD
Sbjct: 1345 SNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCD 1404

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            RDFL TPSV+EFLSKPEITEVSVNLARNY+PY+TDWEG++ +EDAKPPEKDPNDLQRADQ
Sbjct: 1405 RDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQ 1464

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            IYLQLMVNL+ YW SRMRAL ++T+YEKEYNELL KLRKVD+AVG+LQES+NLRNVFNVI
Sbjct: 1465 IYLQLMVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVI 1524

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MNDTSKQAQGFKLSTLQRLTFIKD+ NSMTFLNYVEKIIR+NYPSFN FL+ELE
Sbjct: 1525 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELE 1584

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVL+VVK+SIEQL NDCK+F QS+ NVERS+EIGNLSDSSKFHPLD+VL K LP LP+ R
Sbjct: 1585 PVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVR 1644

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +KGDLL DEV LT+MEF+ LMQ YGED+                +NEY++AQ QN+  EE
Sbjct: 1645 KKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEE 1704

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPA 1809
            EE  YE+HK+MVEEQQ++A+ KE   +++            DRR  MDKLLEQLKN GP+
Sbjct: 1705 EEEAYERHKRMVEEQQRKAERKEAKNQNNIDENEDDDQERTDRRGTMDKLLEQLKNVGPS 1764

Query: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTP 1869
            ++DPSSARKRAL RKK ++DK+ +  +++DL  E  SI+YSP+           A   TP
Sbjct: 1765 RADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDN---------KAIGSTP 1815

Query: 1870 LATRGFMNTPEDLPSPSKASALED---QEEITDRARMLLKELRGSDAPVKQNSILDEHLE 1926
                G  +  ++    S +    D   +EEI++RA+ LL  LRG+ +P K+NS+LDEH E
Sbjct: 1816 FGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKE 1875

Query: 1927 KLRARKERANGETNTG-NKLSF 1947
            KLRAR+ R N +  +G NKL F
Sbjct: 1876 KLRARRRRTNNDLPSGSNKLKF 1897

 Score =  139 bits (351), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 78/153 (50%), Positives = 100/153 (65%), Gaps = 3/153 (1%)

Query: 77  STSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASN 136
           + +T  +PLNKK+TLNTQNLSQYM+   S+   ++S    S S +S    S   +S++  
Sbjct: 77  AITTTNKPLNKKSTLNTQNLSQYMDHARSSSTNSASASKYSSSRRSSTQVS---TSESLR 133

Query: 137 KLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIF 196
           +L+RQHTGQ                 KF TPDGK +LEMP DP E+E LFE+IMYKRNI 
Sbjct: 134 RLSRQHTGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193

Query: 197 QSLSGDKQEELMSYSTEKKWLIVKQDLQNELKK 229
           Q+LS +KQ ELM+Y   KKWLIVKQD+QNE K+
Sbjct: 194 QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKR 226

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/1155 (49%), Positives = 746/1155 (64%), Gaps = 95/1155 (8%)

Query: 83   RPLNKKATLNTQNLSQYMNGKISTD-------APTSSQHARSHSVQ-SKYSY---SKRTS 131
            +PL+KKAT+N+QNLS Y +G  +T        A     H+R+ S Q S++SY   S+R+S
Sbjct: 152  KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSGQTSRFSYTSPSRRSS 211

Query: 132  SQASNKLTRQHTGQXXXXXXXXXXXXXXXXXKFTTP-DGKIHLEMPSDPYEVEVLFEDIM 190
            S A  KL + HT Q                 +F +P DGK+ LEMP DP EVE+L+EDIM
Sbjct: 212  SDA--KLAKYHTAQSSQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIM 269

Query: 191  YKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQH 250
            YKRNI Q+L  DKQ ELM+Y  +KKWLIVKQDLQNE KK                     
Sbjct: 270  YKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTKTSSHQQTVQSA------ 323

Query: 251  PILTANSTLSSPKSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIAGGL- 309
            P +    T SS        AS P    +            V T+     N+  +I     
Sbjct: 324  PFMNLQDTSSS--------ASLPGQGFHDQQSVVSETSSRVPTT-----NDAASILSSAT 370

Query: 310  ---------KKQPSL----NSIY--RGGPEIN-TSASTLPGDRTNRPPIHYVQRILADKL 353
                     K+Q +L    +++Y   G  E + +S+STL  D+TNR PIHYV++I+AD+L
Sbjct: 371  PSLRHPSRRKQQYTLTNKQHTVYPANGTAERHASSSSTLASDKTNRLPIHYVKKIIADQL 430

Query: 354  TTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSF 413
            + DE+ DLWVTLRTEQLDWVDAF+D+QGHIAMANVLM S+YKT+P   L+  LL+KE S+
Sbjct: 431  SQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLMKSLYKTSPNVSLSGPLLDKEQSY 490

Query: 414  FKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEA 473
            FKCF+VLSML+QGL EF+ HRL+TDT+A GLFS++L TRKMATEIFVCMLE KN+ RF+A
Sbjct: 491  FKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRLPTRKMATEIFVCMLETKNQTRFDA 550

Query: 474  VLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSL 533
            V+T+LD+ F+IG N HM+ N +KMP YF HL L+S LK++QAWLFA++QTLDGRGKMGSL
Sbjct: 551  VITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQSTLKVVQAWLFAIDQTLDGRGKMGSL 610

Query: 534  VGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIK 593
            VGASDEFK   GEN++LEYCQWT+VF+N  C  S+N+NQRMLLRTKLEN G LRIMNK+K
Sbjct: 611  VGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNLNQRMLLRTKLENAGFLRIMNKMK 670

Query: 594  LLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLL 653
            LLDY+K+ DQIE Y+  KLDDFN  LE+ NK  N+D+++PLSLL+NLW+ C+GTD+E LL
Sbjct: 671  LLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDMQNPLSLLQNLWDACRGTDSENLL 730

Query: 654  VSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTNV--SVASTADEESNMNMAIQRLY 711
            VSLVQHLFLSS++LI+ N++P++L+KQLKL+DSLVTNV  SV++ ADEE+ M+M IQRL+
Sbjct: 731  VSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSLVTNVGSSVSAVADEETTMSMTIQRLF 790

Query: 712  DAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILA 771
            D+MQTDEVARRAI+ESRTLTKK+EE+QAE+D L +KL KAE GLVG+L+ ++  RD ILA
Sbjct: 791  DSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKLSKAEGGLVGELQRDIRERDAILA 850

Query: 772  KNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSR--PEESSDLSKGT-KDINP 828
            KNQRV                       VELRKMLTI+NS+  P  + + S    K  +P
Sbjct: 851  KNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTIINSKASPNLAQNPSASVLKSHDP 910

Query: 829  ----SLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEA 884
                SL S +++ IQKVLQDGL+R KKD+ +D+KKFGMT+QPNKRL++LRM++E+IENEA
Sbjct: 911  KNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAKKFGMTVQPNKRLQLLRMKVEDIENEA 970

Query: 885  RQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXXXSSVKTQGAD-------MNKLNDLR 937
            RQLEMTNFA+ EK                          K Q A+       +  LN LR
Sbjct: 971  RQLEMTNFADIEKNATPVILTKGTKKKKSKKKLKTAQPDKKQRANQRNENQKIEALNKLR 1030

Query: 938  RALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETP 997
             AL  IQ ESNDISKFNVEE VNELF E+K  AL+RL++LE+K+ G   +FN+++ I + 
Sbjct: 1031 MALTAIQSESNDISKFNVEEHVNELFTERKFKALQRLRDLESKFNGLNTNFNIDDIIAST 1090

Query: 998  KKFSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXX 1057
            +K       D  Y SLDP+   +KLDEI R+T++L  L   +K+                
Sbjct: 1091 EKALT--ATDDGY-SLDPRRADNKLDEIERLTNDLSKLHDSMKEQEQATLQSDNSSESSD 1147

Query: 1058 XXXXXXXIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGS 1117
                      + S  Q    + SE + GS  GSFL +LSQKY TGQ    S         
Sbjct: 1148 SESVESD--NEGSTVQ---SDVSEPTVGS--GSFLASLSQKYETGQKQPNS--------- 1191

Query: 1118 GHMPSNV-EKSFINRLRKSTASSAP-YLEELTQKVNKVEPFKQNKDE-DLVKDLSTENDI 1174
               P  V +K+F+ RL++S  S AP YL+EL++K+ +   F ++ D+  L K     N  
Sbjct: 1192 ---PVTVNQKAFMTRLKRS--SGAPLYLQELSKKIPQRPAFDESVDKVTLRKSTGDSNAN 1246

Query: 1175 ADGTFVS--DKVGGD 1187
            +DGT     DK G D
Sbjct: 1247 SDGTTAKSLDKDGDD 1261

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/630 (63%), Positives = 497/630 (78%), Gaps = 21/630 (3%)

Query: 1331 SAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLA 1390
            S + SPL  QS S+FEKYPRP KKLKQLHWEK+DST+NSIW + KAEKFADDLYEKGVL+
Sbjct: 1360 SPIPSPLFSQS-SIFEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLS 1418

Query: 1391 DLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDR 1450
            +LEKAFAARE+KSL++K+ +D  K+TFL+RD+SQQFGINLHM+ +LSV +LV KILKCDR
Sbjct: 1419 NLEKAFAAREVKSLSSKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDR 1477

Query: 1451 DFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQI 1510
            + L +PSV+EFLSK E+ EVSVNLARNY+PYSTDWEG++ +EDAK PEKDPN+LQRADQ+
Sbjct: 1478 EVLNSPSVIEFLSKQEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQL 1537

Query: 1511 YLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVIL 1570
            Y+ LMVNL+ YW SRMRAL V+T+YE+EY ELL KLRKVD+AVG+LQ+S+NL+NV NVIL
Sbjct: 1538 YMSLMVNLQPYWSSRMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVIL 1597

Query: 1571 AVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEP 1630
            AVGN+MNDTSKQAQGFKL+TLQRLTFIKDT NSMTFLNYVEKI+R NYP+FNDFL EL+P
Sbjct: 1598 AVGNYMNDTSKQAQGFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQP 1657

Query: 1631 VLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARR 1690
            VLDVVK+SI+QLV+DC++FS S+VNVERS+EIGNLSDSSKFHP D+VL+K LPVLPEAR+
Sbjct: 1658 VLDVVKISIDQLVSDCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARK 1717

Query: 1691 KGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEE 1750
            K DLL DEVKLT++EF +LMQTYGEDS                + EYK+AQ QN+AAEEE
Sbjct: 1718 KADLLTDEVKLTMLEFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEE 1777

Query: 1751 ERLYEKHKKMVEEQQKRAQDKEKHREHSALP-------XXXXXXXXXDRRAVMDKLLEQL 1803
            E+ YE+HKK+VEEQQ++ ++  K R  SA P                DRRA+MDKLLEQL
Sbjct: 1778 EQQYERHKKIVEEQQRQGEEARK-RLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQL 1836

Query: 1804 KNAGPAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIH 1863
            KNAG  K+DPSSARKRAL R+K + DKD ++ +L+D++ ++ S++YSP+        +I 
Sbjct: 1837 KNAGTVKADPSSARKRALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGHLIG 1896

Query: 1864 AESPTPLATRGFMNTP-EDLPSPSKASALEDQEEITDRARMLLKELRGS-DAPVKQNSIL 1921
              SPTP   +   +TP ++L SP   +A +D E++TDRA+ LL ELRG   +P+K+N+ L
Sbjct: 1897 G-SPTP-GDKLLGSTPTKELSSP---TAGQDDEDVTDRAKALLMELRGGQSSPMKKNAFL 1951

Query: 1922 DEH---LEKLRARKERANGET-NTGNKLSF 1947
            DE    +   R R E A  E    GNKLSF
Sbjct: 1952 DEQRERIRSRRRRNELAGTEPLRGGNKLSF 1981

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1064 (49%), Positives = 668/1064 (62%), Gaps = 96/1064 (9%)

Query: 118  HSVQSKYSYSKRTSSQASN--------------------KLTRQ-----HTGQXXXXXXX 152
             S  SKY+Y KRTSS  +                     +L+RQ     H          
Sbjct: 101  QSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRQQTNHSHANSQSSAASV 160

Query: 153  XXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYST 212
                      +F  PDGK+ L+MP D +EVE LFEDIMYKRNI Q+L  +KQ+EL +Y  
Sbjct: 161  LSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDI 220

Query: 213  EKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQHPILTANSTLSSPKSALMTSASS 272
            +KKWLIV+QDL ++LKK                       L+  +T+SS         S 
Sbjct: 221  DKKWLIVRQDLSSDLKKMMAKSSSSATQASANTTD-----LSLTNTISS------HDYSD 269

Query: 273  PTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIAGGLKKQPSLNSIYRGGPEINTSASTL 332
             TS  +                  K + + K++   L    + NS          S +T+
Sbjct: 270  ATSIRHM-----------------KTNASSKSLNSNLYSNANANS----------SNTTV 302

Query: 333  PGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNS 392
              ++ NRPP +YV++I+AD LT DE+ DLWVTLRTEQLDWVDAF++HQGHIAMANVLM S
Sbjct: 303  NTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKS 362

Query: 393  IYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTR 452
            +YKT     LT++ LE+E S+FKCFRVL ML+QGLYEF+ H +M +TVA  LFS +L TR
Sbjct: 363  LYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTR 422

Query: 453  KMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKI 512
            KMATEIFVCMLEKKNK+RF+ +LTALDKKF IG+NLHM+Q  K  PQ F HL  +S  KI
Sbjct: 423  KMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKI 482

Query: 513  IQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQ 572
            +QAWL  +E  L GRGKMGSLVGAS+E +  GGEN+ILEY QWTMVFINHLC  +D VNQ
Sbjct: 483  VQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQ 542

Query: 573  RMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKD 632
            R+LLRT+LEN G LRIMN+ KLLDYDK+  QIE Y+N KLDD N  LE+  +   V+++D
Sbjct: 543  RVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQD 602

Query: 633  PLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTNVS 692
            P+ +L+ +W+ CKGT+NEK  +SL++HLFLSSSK+ ++  +PSKL+KQLKLMDSLV NVS
Sbjct: 603  PMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLVANVS 662

Query: 693  VASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAE 752
            V S  DEES++N+AIQRLYDAMQTDEVARRAILESR LTK+LEEIQAERD L +KL    
Sbjct: 663  V-SAVDEESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTG 721

Query: 753  HGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSR 812
             G+VG+LE EL  RD ILAKNQRV                       VELRKMLTILN+R
Sbjct: 722  DGIVGRLEEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNAR 781

Query: 813  PEES--SDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRL 870
            P++   +  +K TK +N  L+   + +IQK LQDGL R +KD   DSK+FG+T+QPNKRL
Sbjct: 782  PDDENLAKSTKVTKSVN-GLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRL 840

Query: 871  KMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXXXSSVKTQGADM 930
            +MLRM+ME IE EAR+LEMTNFAE E+++L                     +   + A +
Sbjct: 841  RMLRMKMEGIEQEARELEMTNFAEHEEKQL----------------EEPVGTGTKKKAGV 884

Query: 931  NKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNV 990
             KL++LR+ L++IQ E+N+++KFNVEERV ELFN+K+  ALKRLKELET YKGFGIDFN 
Sbjct: 885  RKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRLKELETTYKGFGIDFNA 944

Query: 991  EEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVK-QXXXXXXXX 1049
               +E+  K      ND      D +  Q K+DE++RI +EL  ++ +V+ Q        
Sbjct: 945  NALLES--KGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHTDS 1002

Query: 1050 XXXXXXXXXXXXXXXIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASA 1109
                              D +       E+S+ S GSG GSFL+ALSQKYG GQN T S 
Sbjct: 1003 SSTESSSEDDDGATGSRTDTA------SEFSQKSFGSGAGSFLEALSQKYGAGQNTTISN 1056

Query: 1110 GLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKV 1153
                  G     SN   SF NR++KS A+  PY +ELT+KV K 
Sbjct: 1057 S--PFPGVDRKSSNHRTSFANRMKKSNAT--PYFDELTRKVAKA 1096

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/626 (66%), Positives = 501/626 (80%), Gaps = 16/626 (2%)

Query: 1335 SPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEK 1394
            S  L ++P+  + YP+PHKKLKQLHWEK+D+T++SIW SG AEKFA DLYEKGVLA LEK
Sbjct: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305

Query: 1395 AFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQ 1454
            AFAAREIK+LATK+KEDL+K+TFLS D SQQFGINLHMYS +SV DLV KILKCDRDF+Q
Sbjct: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365

Query: 1455 TPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQL 1514
            TPSV+EFLSK EITEVSVNLARN++PYSTDW+GI+ LEDAKPPEKDPNDLQRADQIYLQL
Sbjct: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425

Query: 1515 MVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGN 1574
            + NL+ YWGSRMRA+ V+TSY+KEY EL+ KLRKVD+AVGA+ +S+NL N+FNVILAVGN
Sbjct: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485

Query: 1575 FMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDV 1634
            FMNDT+K+AQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIR NYPSFNDFLKELEPVL+V
Sbjct: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545

Query: 1635 VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDL 1694
             K+SI+QLVNDC ++ Q++ NVERS+EIGNLSDSSKFHPLD+VLIK LPVLPEAR+K DL
Sbjct: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605

Query: 1695 LEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLY 1754
            L+DEV+L+IMEFE+LMQ YGED+G               V EYK+AQ+QNL  EEEER+Y
Sbjct: 1606 LDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVY 1665

Query: 1755 EKHKKMVEEQQKRAQDKEKHREHSA-LPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKSDP 1813
            E+HKKMVEEQQ+R Q   K+R++              DRRA+MDKLL+QLKNAGP  SDP
Sbjct: 1666 ERHKKMVEEQQRREQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTTSDP 1725

Query: 1814 SSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATR 1873
            SSARKRAL+R+K  +DKD +A +++DL+  E SI+YSP A+    D   +AE  +P   +
Sbjct: 1726 SSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNAS---QDQSANAEEASPTVHK 1782

Query: 1874 GF--MNTP--EDLPSPSKASALEDQ------EEITDRARMLLKELRGSDAPVKQNSILDE 1923
            G    N P   DL SP KAS   D+      EEI+D+A+ LL EL G+ AP ++  +L+ 
Sbjct: 1783 GSNKNNKPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMELSGNGAPTRREELLNG 1842

Query: 1924 HLEKLRARKE--RANGETNTGNKLSF 1947
            H E+LRAR+   + +GE  + NKL+F
Sbjct: 1843 HKERLRARRRRTQGHGELISSNKLAF 1868

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1112 (45%), Positives = 690/1112 (62%), Gaps = 104/1112 (9%)

Query: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQ-----------------------HARSHS 119
            +PLNK+ +LN QNLSQY+NGK+      SS                        H RS S
Sbjct: 69   KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSAS 128

Query: 120  VQSK---YSYSKRTSSQASNKLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMP 176
            VQS        + ++S A+ +L+RQ T                   K+   +G+++L+MP
Sbjct: 129  VQSSAKYSYSRRSSNSTAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMP 188

Query: 177  SDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXX 236
            +D +E+E LFE++MYKRNI Q+LS DKQ ++M+Y T+KKW+IVKQDLQNELK+       
Sbjct: 189  TDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKL---- 244

Query: 237  XXXXXXXXXXXDQHPILTANSTLSSPKSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTP 296
                        ++  +  + T   P S++ +S  S  S+V                S P
Sbjct: 245  ------------KNNNINNSDTTIIP-SSMPSSNISERSSV--NTMDNNLRTIDTNASNP 289

Query: 297  ----KGHNNKKTIAGGLKKQPS-LNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILAD 351
                KG  +  +++      PS +N+ Y     I+ S+     D+TN  PIHYV++IL+D
Sbjct: 290  RIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISESS-----DKTNIAPIHYVRKILSD 344

Query: 352  KLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKEN 411
             L+ +E+ DLWVTLRTEQLDWVDAF++HQGHIA+AN L+  IYKTAP  +L+ EL+EKE 
Sbjct: 345  TLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEY 404

Query: 412  SFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRF 471
             FFKCFRVL+ML QGLYEF+ H+LM DT+A GLFST++ TRKMA EI V ++ KKN  RF
Sbjct: 405  GFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRF 464

Query: 472  EAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMG 531
            E+V+ +LD+ FR+ +NL+M++   +    FS  + ++  KI QA++ ++E TL+GRGKMG
Sbjct: 465  ESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMG 524

Query: 532  SLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNK 591
            S VGASD+FK  GGENAILEYC W ++FIN LC+ SD +NQR++LRTK EN G LR+M K
Sbjct: 525  SKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTK 584

Query: 592  IKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEK 651
            +KL+DY+K+  Q+E Y+++KLDDFN  LE  + +  ++++DP SL+ +LWE+CKGT+NEK
Sbjct: 585  LKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEK 644

Query: 652  LLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLY 711
            LL+SL+QHLFLSSSKL+++ + P+KLSKQLKLMDSL+TN++ AS  DE+++MN+AIQRLY
Sbjct: 645  LLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNIT-ASEVDEQTHMNLAIQRLY 703

Query: 712  DAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILA 771
            D+MQTD+VARRAILE+RTL+KKLEE+ AE++ L EKL KAE+GLVGQLE EL  RD IL 
Sbjct: 704  DSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQLELELEQRDNILT 763

Query: 772  KNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDLSKGTKDINPSLN 831
            K+QRV                       VELRK+LTI+N+             D + SLN
Sbjct: 764  KSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNT-----------DADASLN 812

Query: 832  SS--EKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEM 889
            +S  +K NIQK L+  LSR KKD  +D KKFG+++QPNKRL+MLR+QME+IE EAR+LEM
Sbjct: 813  NSSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEM 872

Query: 890  TNFAEFEKERLXXXXXXXXXXXXXXXXXXXXSSVKTQGADMN----------KLNDLRRA 939
            TNF+E +K  L                    S       + N          KL +LRR 
Sbjct: 873  TNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENNRKRANAIKKQKLLELRRD 932

Query: 940  LAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKK 999
            LA IQ E+ND+SKFNV++RVNELF EKK  AL RL+ LE KYK F IDF+  +F    K+
Sbjct: 933  LAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDF----KQ 988

Query: 1000 FSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXX 1059
              +D  ++A+Y SLDP     K+ +I+RI DEL                           
Sbjct: 989  AQLD--SNASYESLDPNFVTKKITDIDRIADEL----------DAFSGDGTSSYSSSSLS 1036

Query: 1060 XXXXXIYQ-DASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSG 1118
                  Y+ +A P+    G    L  GS   SFL++LS+KYGT QN T    L       
Sbjct: 1037 DSEKNYYESNAVPTI---GPQKGLIDGS---SFLESLSEKYGTAQN-TEGTSLSPLSPQN 1089

Query: 1119 HMPSNVEKSFINRLRKSTASSAPYLEELTQKV 1150
             + S  EKSF+NR ++   SS  +LEEL+QKV
Sbjct: 1090 RIASLGEKSFMNRFKRK-PSSMQFLEELSQKV 1120

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/628 (62%), Positives = 477/628 (75%), Gaps = 30/628 (4%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            +S   S +L +SPSL+ KYPRP KKLKQLHW+K+D ++ SIW S  AE+FADDLYEKGVL
Sbjct: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
             +LEKAFAAREIKSLA K+KEDL K++FLSRDISQQFGINLHM+ SL+V +LV KILKC+
Sbjct: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            RD + TPSV+EFLSKPEIT+VS+NLARNYAPY TDWEG++ +EDAK PEK  + LQRADQ
Sbjct: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            IY+QLMVNL+ YW SRMRA+ V+TSYEKEY EL+ KLR++D AV A+Q+SDNL N+FNVI
Sbjct: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MND+SKQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKIIR NYP FN F++ELE
Sbjct: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVLDVVK+S+EQLVNDC +F+QSI+NVERS+EIGNLSDSSKFHPLDKV+ K LPVLPEA 
Sbjct: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +K DLL DEVKLT MEFE+LMQ +GEDSG               +NEYK+A++QNL AEE
Sbjct: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPA 1809
            E R YE+HK+MVEEQQ++A+++EK+   + +          D R  MDKLL QLKNAGPA
Sbjct: 1665 EVRKYERHKQMVEEQQRKAKEQEKNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPA 1724

Query: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAE---- 1865
            +SDPSSARKRA++RKK +S+KD+++ +L+DLN  +GSI+YSP  T    DT +  +    
Sbjct: 1725 RSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSP-TTDKVVDTSLGEDEMIL 1783

Query: 1866 -SPTPLATRGF------------------------MNTPEDLPSPSKASALEDQEEITDR 1900
             SPTP +                             N   D+     ++   + E ITDR
Sbjct: 1784 KSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVITDR 1843

Query: 1901 ARMLLKELRGSDAPVKQNSILDEHLEKL 1928
            A+ LL ELRGS  P K+NS LD+  EKL
Sbjct: 1844 AKALLMELRGSQTPSKKNSHLDDQREKL 1871

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/629 (63%), Positives = 481/629 (76%), Gaps = 17/629 (2%)

Query: 1334 TSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLE 1393
            ++P    SP+ FEKYPR  KKLKQLHWEK+D TDNSIW +GKAE+FADDL+EKGVL  LE
Sbjct: 1425 SAPDFSTSPNFFEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLE 1484

Query: 1394 KAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFL 1453
             AFAAREIKSLA+K+KED  K+T+LSRDISQQFGINLHM+S+L+V  L++KI++CDR  L
Sbjct: 1485 SAFAAREIKSLASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSIL 1544

Query: 1454 QTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQ 1513
             TPSV++FLSK EI EVSVNLAR+YAPYSTDWEG++D++DAKPPEKDPN+LQRADQIYLQ
Sbjct: 1545 NTPSVIDFLSKQEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQ 1604

Query: 1514 LMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVG 1573
            LMVNL+ YWGSRM AL VVTSYEK+++EL+ KLR+VD AVG++Q+S+NL+NVFNVILAVG
Sbjct: 1605 LMVNLQSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVG 1664

Query: 1574 NFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLD 1633
            NFMND SKQAQGFKL+TLQRLTFIKD+ N+MTFLNYVE IIR NYP FNDFL EL+PVLD
Sbjct: 1665 NFMNDASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLD 1724

Query: 1634 VVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGD 1693
            VVKVSIEQLV DCK+FSQ I+NV RSVEIG LSDSSKFHP DKVLIK LPVLPEA +K D
Sbjct: 1725 VVKVSIEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKAD 1784

Query: 1694 LLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERL 1753
            LL DEVKL+IMEFE+LMQ +GEDS                +NEYKRAQ QNL  EEEER+
Sbjct: 1785 LLSDEVKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERI 1844

Query: 1754 YEKHKKMVEEQQKRAQD--KEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKS 1811
            YE HKK +EEQQKR +D  K+ H + ++           DRR VMDKLLEQLKN GP K+
Sbjct: 1845 YENHKKRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKT 1904

Query: 1812 DPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEAT--TPDTDTVIHAESPTP 1869
            DP+SARKRA+VRKK  ++K+ ++Q+L +    E SI+YSP  +  TP   +  + +SPTP
Sbjct: 1905 DPTSARKRAMVRKKLQNEKETASQILKEFETGEDSIVYSPTDSKITPKKVSNEYLQSPTP 1964

Query: 1870 LATRGFMN-----------TPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQN 1918
                   +           T  D    + +S  +  +EI DRA+ LL ELRGS  P ++N
Sbjct: 1965 GEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSLLFELRGSQTPTRKN 2024

Query: 1919 SILDEHLEKLRARKERANGETNTGNKLSF 1947
            S+L+E  EKLRAR  R N    T NKL F
Sbjct: 2025 SVLEERKEKLRAR--RRNTSDLTSNKLKF 2051

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/856 (50%), Positives = 555/856 (64%), Gaps = 36/856 (4%)

Query: 325  INTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIA 384
            IN  AS L  DRTNR P  Y++ IL D+L+ DEM DLWVTLRTEQL WV+ F++ QGHIA
Sbjct: 406  INNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIA 465

Query: 385  MANVLMNSIYKTAPREH-LTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEG 443
            MAN LM SIY+    ++ L+  L++KE +FFKCFRVLSMLSQGL EF  H+LMTDT+ +G
Sbjct: 466  MANSLMKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQG 525

Query: 444  LFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSH 503
            LFST+L TRK+ATEIFV ML+K N +    +LT  DK F I +NL+M+   K +P  + +
Sbjct: 526  LFSTRLATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHY 585

Query: 504  L--TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFIN 561
            L  T  + +K++ +WL+AVE TLDGRGKMGSLVGAS +FK  GGENAILEYCQWTMV IN
Sbjct: 586  LNSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLIN 645

Query: 562  HLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEA 621
             LC+ S  +NQR+LLRTKLEN G +RIMNK+K LDY+K+ +Q+E Y+N KLDD N  LE 
Sbjct: 646  RLCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQ 705

Query: 622  SNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQL 681
              K+ +VDL +P+SLL +L E+CK T+ E+ L S++QHL+LSSSKL ++  +P+KLSKQL
Sbjct: 706  DTKS-SVDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQL 764

Query: 682  KLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAER 741
            KLMDSL+T+ ++ ST D ES MNMAIQ LYD+M TD+VARRAILESR LTKKLEE+QAER
Sbjct: 765  KLMDSLMTDATL-STVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAER 823

Query: 742  DSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVE 801
            D LS +L +AE+GLVG+LENEL  RD ILAKNQRV                       VE
Sbjct: 824  DFLSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVE 883

Query: 802  LRKMLTILNSRPEESSDLSKG----TKDINPSLNSSE----KANIQKVLQDGLSRAKKDY 853
            LRKMLTILNSRPE   D +      TK     +   E    K  I+K LQDGL + KKD 
Sbjct: 884  LRKMLTILNSRPETELDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDL 943

Query: 854  KDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK------ERLXXXXXXX 907
              DSK+FG+T+QPNKRL+ LR+QME+IENEARQLEMTNF +  +      E+        
Sbjct: 944  SLDSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHP 1003

Query: 908  XXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKK 967
                            +       KL +LR+ALA+IQ E+NDIS+FNVEE VNELFN KK
Sbjct: 1004 SLKPGIPIAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKK 1063

Query: 968  SLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDA-AYPSLDPKAYQSKLDEIN 1026
              A++RLKELET Y+ FG+DFN+EEF+E     + + + D+ AY +LDP  +  K+DE++
Sbjct: 1064 IQAMERLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDELD 1123

Query: 1027 RITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERR---------- 1076
            + + +L  L + +                            D    +E            
Sbjct: 1124 KFSMKLDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNVND 1183

Query: 1077 --GEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRK 1134
                +S  S  SG  SFL++LSQKYGTGQN +          S + P   E+ F++R++K
Sbjct: 1184 NSSTFSHQSTTSGGSSFLESLSQKYGTGQNASGPMSSNTPNVSHYNP---ERKFMSRMKK 1240

Query: 1135 STASSAPYLEELTQKV 1150
              A+   Y+ EL QKV
Sbjct: 1241 QHATPN-YIRELNQKV 1255

 Score =  119 bits (297), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 93/174 (53%), Gaps = 33/174 (18%)

Query: 84  PLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS--------KYSYSKRTSSQAS 135
           PLN + +L   N++QY+    + +   S  H+R+ S+ S        KYSYS+R S+Q  
Sbjct: 95  PLNMRNSLTNPNMNQYVTSPYTHEYNNS--HSRNTSINSVNSNPLSTKYSYSRRGSNQI- 151

Query: 136 NKLTRQHTGQXX--------------------XXXXXXXXXXXXXXXKFTTPDGKIHLEM 175
             L+   TG                                      KF TPDGK++LEM
Sbjct: 152 --LSPSPTGNSSNNNTSNINPQQRYSVHSNNPNSSSILSQGSLHNLMKFMTPDGKVNLEM 209

Query: 176 PSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKK 229
           P++P EVE L+EDIMYKRNI Q+L  DKQ ELMSY   KKWLIVKQDLQ+ELKK
Sbjct: 210 PNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKK 263

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1113 (41%), Positives = 647/1113 (58%), Gaps = 97/1113 (8%)

Query: 82   ARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS----KYSYSKRTSSQASN- 136
             +PL+K+ TLNTQNLS Y    +  + P    H RS S  S    KYSYS+R+S  ++  
Sbjct: 68   GKPLSKQTTLNTQNLSSY----VDMNTP---HHNRSPSGMSGSPTKYSYSRRSSQWSNGN 120

Query: 137  ------KLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIM 190
                  +L+RQ T Q                 KF   DGK+ L+ PS+P E+E LF ++M
Sbjct: 121  NIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELM 180

Query: 191  YKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQH 250
            +KRN FQSL    Q+ELM+Y  +KKWL+VKQDLQ+ELKK                  + H
Sbjct: 181  HKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANKK-------------NTH 227

Query: 251  PILTANSTLSSPKSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKT-IAGGL 309
                      +  + L  + S+ T                 G+   KGHN+  + I GG 
Sbjct: 228  -------VAPAGAAGLAATISAATQGTSGAGGVGGVDGTQAGS---KGHNSTSSPILGG- 276

Query: 310  KKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQ 369
                     Y  G + N+S +TL  D  +  P +YV++I++DK++T ++KDLWV+LRTEQ
Sbjct: 277  ------GGFYESGNQ-NSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQ 329

Query: 370  LDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYE 429
            LDWV  F+D QG +A+ANVL+   +K +P   L  E L+KE +FFKC + L  L +G  E
Sbjct: 330  LDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANE 389

Query: 430  FSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLH 489
                +L+   + +GL S ++ TR++A+E+ V + +         V+  LD++  +  N+H
Sbjct: 390  AVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVH 449

Query: 490  MIQNFKKMPQYFSHLTLESHL--------KIIQAWLFAVEQTLDGRGKMGSLVGASDEFK 541
            +        +  S L  +  L        K  + WLF VE TLDGRGKMGSLVGAS++FK
Sbjct: 450  LQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFK 509

Query: 542  NGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVI 601
            + GGENAILEY   T++ +N LC+   +VNQR LLR++ ++CG+ RIM K++LL+YDK+ 
Sbjct: 510  SAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKID 569

Query: 602  DQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLF 661
            +Q+ ++++   DD+N  + + +   NVD+++PLSLL+NLWE  KGT  EK LVSLVQHLF
Sbjct: 570  EQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF 629

Query: 662  LSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVAR 721
            ++SSK+ +E  +P++ SKQLKL+DSLV+NV+++S  D ES+ N AIQRLYD+MQTDEVAR
Sbjct: 630  IASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSI-DTESSFNGAIQRLYDSMQTDEVAR 688

Query: 722  RAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXX 781
            RAI+E+R LT+K EE++AERD L EKL KAE GLVGQL+NEL  RDRIL KNQRV     
Sbjct: 689  RAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQ 748

Query: 782  XXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDLSK---GTKDINPS--LNSSEKA 836
                              VELRK+LTILNSRP+ SS + +   GT   +    L++  K 
Sbjct: 749  ADLEELKKKHLLEKHEHEVELRKLLTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKL 808

Query: 837  NIQKVLQDGLSRAKKDYKDDSKK----FGMTLQPNKRLKMLRMQMENIENEARQLEMTNF 892
             IQK LQD L + KKD   +SK+     G TL+PN+RLK+LR +ME+IENEAR+LEMTNF
Sbjct: 809  AIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNF 868

Query: 893  AEFEKERLXXXXXXXXXXXXXXXXXXXXSSVKTQGAD--MNKLNDLRRALAEIQMESNDI 950
            A+ +++ +                       K Q  +  + KL +LR+ LA +Q ESND+
Sbjct: 869  ADIQRQTVEEQTVVPALPPPAVPVLDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDV 928

Query: 951  SKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDA-- 1008
            SKFNVEER+NELFN+KK  AL RLKELETKYKGFGIDF  +  +      +  E + A  
Sbjct: 929  SKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKD 988

Query: 1009 --AYPSLDPKAYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIY 1066
              A+PSLDPK    K++E+++I DEL   + +++                          
Sbjct: 989  GQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPSSSSSS---------------- 1032

Query: 1067 QDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRG-SGHMPSNV- 1124
             D    Q+ R      S  +  GSFL+ LSQKYGTGQN   +A  R   G   + P    
Sbjct: 1033 SDEELEQDDRASIH--SGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGY 1090

Query: 1125 -EKSFINRLRKSTASSAPYLEELTQKVNKVEPF 1156
              +SF+ R++KS A  AP+L ELTQKV    P 
Sbjct: 1091 HRRSFMERVKKSDA--APFLSELTQKVAPKTPI 1121

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/631 (62%), Positives = 481/631 (76%), Gaps = 17/631 (2%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            ++A  SPLLPQSPSLFE+YPRP KKLKQLHWEKI+ T NSIW   KAEK+ADDLYE+GVL
Sbjct: 1292 RAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVL 1351

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
            A LEKAFAAREIK LA +RKEDL KVTFLSRD+SQQFGINLHMY++LSV ++V KIL+CD
Sbjct: 1352 AQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCD 1411

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            +DFL + SV++FL KPEI EVS NLARN+APYST+WEG+  +++AK PEKDP +LQRADQ
Sbjct: 1412 KDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQ 1471

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            +YL++MVNL+ YW SRMRAL V+T+YEKEY++LL KLR +D+AV ++Q SDNLR+VF VI
Sbjct: 1472 LYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVI 1531

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MND+SKQA GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FN FL+ELE
Sbjct: 1532 LAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELE 1591

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVLDVVK+S+EQL  DC++FSQ+IVNVERS+E+GNLSDSSKFHP D+VL+K LPVLPEAR
Sbjct: 1592 PVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEAR 1651

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            ++ DLL DEVKLT+MEF+ LMQ +GED+                + EYK+AQ+ N+  EE
Sbjct: 1652 KRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEE 1711

Query: 1750 EERLYEKHKKMVEEQQKRAQ-DKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGP 1808
            EER YE+ KKMVEEQ KRA+ + EK                   R VMDKLLE+LKNAGP
Sbjct: 1712 EERAYERRKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGP 1771

Query: 1809 AKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEG-----SILYSPEATTPDTDTVIH 1863
             KSDPSSARKRAL RKK +  K +SA +L++   +E      S++YSPE TT       H
Sbjct: 1772 GKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPE-TTLKAANAAH 1830

Query: 1864 AESPTPLATR-------GFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVK 1916
            AESPTP A+R       G   TP  L SPSK  A    E++ DRAR LLKELRG ++  K
Sbjct: 1831 AESPTPKASRQGSVAGSGATATPL-LESPSK-QASAGPEDVADRARNLLKELRGPESE-K 1887

Query: 1917 QNSILDEHLEKLRARKERANGETNTGNKLSF 1947
            +  +L++H EK+RAR+ R N   ++ NKL F
Sbjct: 1888 RKPLLEDHREKMRARRRRVNEGASSENKLVF 1918

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/624 (60%), Positives = 483/624 (77%), Gaps = 18/624 (2%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            ++   SP+LPQSPSLFE+YPRP KKLKQLHWEKID  ++SIW + KAE+FADDLYEKG+L
Sbjct: 1300 RTTTPSPMLPQSPSLFERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGIL 1359

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
            + LEKAFAAREIKSL +++K+D  K+TFLSRD+SQQFGINLHMYSSLSV ++V KILKCD
Sbjct: 1360 SRLEKAFAAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCD 1419

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            +DFL TPSV+EFLSK EI EVS NLARN+APY+TDWEGI +++DAKPPEKDP++LQRAD+
Sbjct: 1420 KDFLTTPSVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADR 1479

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            +YL+L VNL+ YW SRMRAL V+TSYEKEY++L+ KLR +D+A  A+Q+S+NLRNV +VI
Sbjct: 1480 LYLELFVNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVI 1539

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+R  YP FN FLKELE
Sbjct: 1540 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELE 1599

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PV+  VK+SIEQ+  DCK+FSQS++NVERSV+IGNLSDSSKFHPLD+ L+K LPVLPEAR
Sbjct: 1600 PVVAAVKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEAR 1659

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +KGDLL DE+KLT++EF++LM+ +GED+                + EYK+AQ+ N+  EE
Sbjct: 1660 KKGDLLMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEE 1719

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPA 1809
            EE+ YE+ KKMVEEQQ+RA++  + +E+S              R VMD+LLE+LKNAGP 
Sbjct: 1720 EEKAYERRKKMVEEQQRRARESNE-QENSVDGNADDNTAASGDRDVMDRLLEKLKNAGPG 1778

Query: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDE--EG-SILYSPEATTPDTDTVIHAES 1866
            KSDPSSARKRA+ R+K +    +++ +L++   E  EG S++YSPE  T  +++V H  S
Sbjct: 1779 KSDPSSARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSPEQVTL-SNSVDH--S 1835

Query: 1867 PTPLATRGFMNTPEDLPSPSKASALEDQE--EITDRARMLLKELRGSDAPVKQNSILDEH 1924
            PTP   +            S AS ++  E  ++TDRAR LL ELRG ++P ++ S  D+ 
Sbjct: 1836 PTPDVRK--------REGQSTASEVQTSESSDLTDRARNLLIELRGPESPSRRASSKDQR 1887

Query: 1925 LEKLRA-RKERANGETNTGNKLSF 1947
            + KLRA RK   +G + + N L+F
Sbjct: 1888 ISKLRARRKNDGSGNSGSDNHLNF 1911

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1109 (36%), Positives = 608/1109 (54%), Gaps = 135/1109 (12%)

Query: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQ-----SKYSYSKRTSSQASN- 136
            +PL+K++TLN  NLS Y +         +S H RS S       +KYSYS+R S  +SN 
Sbjct: 71   KPLSKQSTLNIANLSAYTD--------VASTHNRSSSAASNSSPTKYSYSRRASQWSSNG 122

Query: 137  ------KLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIM 190
                  KL+RQ T Q                 KF  PDG I LE P DP E+E LFE+++
Sbjct: 123  GTAPSTKLSRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVL 182

Query: 191  YKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQH 250
            YKRN++QSL    Q+EL +Y  EKKWL+V+QDLQ+E+KK                     
Sbjct: 183  YKRNVYQSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKK--------------------- 221

Query: 251  PILTANSTLSSPKSAL----MTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIA 306
              +   S   SP +A     + +  SP++  +             G+S  +  N      
Sbjct: 222  -FMNNKSVSKSPAAASTGISLIAPESPSTGHFASNSSINESL--AGSSRSRAQN------ 272

Query: 307  GGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLR 366
                  P  +  + G     +S +TL  D ++  P +YV++I+ + ++   + DLWV+LR
Sbjct: 273  ------PGTSDQFYGSNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAKRLNDLWVSLR 326

Query: 367  TEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQG 426
            TEQLDWV  F++ QG +A+ANV++ + Y+ +P   L  E+L+KE ++FKC +    L +G
Sbjct: 327  TEQLDWVVGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLKEG 386

Query: 427  LYEF---STHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFR 483
              E    ++ +++   + EGL S ++ TR++A+E+ V + +    + F  V+ ALD++ R
Sbjct: 387  ADEAVLSNSAKIIISAIIEGLLSLRVATRRIASELLVSLSQWALPHGFTHVMNALDQESR 446

Query: 484  IGQNLHM-------IQNFKKMPQYFSHLTLESH----LKIIQAWLFAVEQTLDGRGKMGS 532
               N+H+         N +      S L  +++    ++  + W+  VE TLDGRGKMGS
Sbjct: 447  FCDNVHLQARLLSQTSNKEIKNSLRSSLLADNNGDRIMRKFEQWMLVVEYTLDGRGKMGS 506

Query: 533  LVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKI 592
            LVGAS++F+  GGENAI+EY   T++ +NHLC    +V QR +LR +L+N G+ RI+NK+
Sbjct: 507  LVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDVKQRTILRARLKNAGLPRILNKM 566

Query: 593  KLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKL 652
            K L+Y+KV +Q+ +++++  DDF+           ++++DP+S+ +NLW++CKGT+ E+ 
Sbjct: 567  KRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINMQDPVSMTQNLWDLCKGTEAEEH 626

Query: 653  LVSLVQHLFLSSSKL-IEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLY 711
            L+SL+Q+L +S+ +L     ++P++ +KQLKL+D+LV+NVS+AS  D +S+ N AIQRLY
Sbjct: 627  LMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNVSMASV-DLQSSFNSAIQRLY 685

Query: 712  DAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILA 771
            DAMQTDE+ARRAILE+R   K+ EEI+AER++L EKL  AE GLVGQL+ EL  RD IL 
Sbjct: 686  DAMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSNAEGGLVGQLQEELKQRDHILE 745

Query: 772  KNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDLSKGTKDINPS-L 830
            K+QRV                       VELRK LT LNS+     D+        P  L
Sbjct: 746  KSQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALNSK---GGDIQLTEDGGQPKPL 802

Query: 831  NSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMT 890
                   IQ+ LQ  L +  K+   +S + G++L+PNKRL++LR +ME IEN+AR+LEMT
Sbjct: 803  KPERMLAIQRALQIKLEKTSKEITVESSRLGVSLEPNKRLRLLRSRMEEIENQARELEMT 862

Query: 891  NFAEFEKERLXXXXXXXXXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDI 950
            NF+E+   R                         TQ +++ KL  LRR LA +Q ESNDI
Sbjct: 863  NFSEY---REDADKEIEMAHEGTHMYPSDVDVGTTQDSNL-KLEQLRRKLASLQNESNDI 918

Query: 951  SKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAY 1010
            SKFNVE R +E+F+++K  AL RLK+LE  Y GFGI+++     E+P       ++    
Sbjct: 919  SKFNVEGRFHEMFSDQKIQALDRLKKLENDYSGFGINYDP---AESPSLKQEQGQDVNKS 975

Query: 1011 PSLDPKAYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDAS 1070
             +LDPK   + +DE    TD                                     D+S
Sbjct: 976  RTLDPKGPNNSVDESQLETDR-------------------------------ANASIDSS 1004

Query: 1071 PSQERRGE----YSELSAGSGPGSFLDALSQKYGTGQ----NVTASAGLRDNR--GSGHM 1120
            P+ E   E     ++ +     GSFL+ LSQKYG GQ    N  +  G R+N   GSG+ 
Sbjct: 1005 PASESLEEEDVHLTKSTTEEIGGSFLERLSQKYGKGQANLSNRNSVVG-RENSYPGSGYH 1063

Query: 1121 PSNVEKSFINRLRKSTASSAPYLEELTQK 1149
                 KSF+NR++KS   + PYLEEL+ K
Sbjct: 1064 ----RKSFMNRVKKS--DNVPYLEELSGK 1086

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/625 (58%), Positives = 474/625 (75%), Gaps = 10/625 (1%)

Query: 1327 SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEK 1386
            S+ KSA  SP+LPQSPSLF++YPRP KKLKQLHWEKID  ++SIW   KAEKFADDLYEK
Sbjct: 1314 SRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEK 1373

Query: 1387 GVLADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKIL 1446
            GVL+ LEKAFAAREIKSLA+++K+D  K++FLSRD+SQQFGINLHMYSSLSV ++V KIL
Sbjct: 1374 GVLSRLEKAFAAREIKSLASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKIL 1433

Query: 1447 KCDRDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQR 1506
            +CDRDFL TPSV++FLSK EI EVS NLARN+APY+ DWEG+  +E+AKPPEKDP +LQR
Sbjct: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493

Query: 1507 ADQIYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVF 1566
            AD++YL+L VNL+ YW SRMRAL V+T+YEK+Y++L+ KL  +D+A  ++Q+S+NLRNV 
Sbjct: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553

Query: 1567 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLK 1626
            +VILAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FNDFLK
Sbjct: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLK 1613

Query: 1627 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1686
            ELEPV+  VK+SIEQ+  DC++FSQS++NVERSV+IGNLSD +KFHP D+VL+K LP LP
Sbjct: 1614 ELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLP 1673

Query: 1687 EARRKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLA 1746
            EAR+KGDLL DE+KLT++EF++LM+ +GED+                + EYK+AQ  NL 
Sbjct: 1674 EARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLK 1733

Query: 1747 AEEEERLYEKHKKMVEEQQKRAQDKE-KHREHSALPXXXXXXXXXDRRAVMDKLLEQLKN 1805
             EEEER YE+ KK+VE+Q KR ++ E K++  +            + R VMD+LLE+LKN
Sbjct: 1734 LEEEERAYERRKKLVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKN 1793

Query: 1806 AGPAKSDPSSARKRALVRKKYISDKDNSAQVLN--DLNDEEG-SILYSPEATTPDTDTVI 1862
            AGPAKSDPSSARKRA+ RK+ +    +++ +L+  D+ D +G S++YSP+  + +     
Sbjct: 1794 AGPAKSDPSSARKRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNE 1853

Query: 1863 HAESPTPLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILD 1922
               SPTP           D  + S AS      ++TDRAR LL ELRG ++P  + S   
Sbjct: 1854 ADTSPTP------ERRVRDSNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMSAQH 1907

Query: 1923 EHLEKLRARKERANGETNTGNKLSF 1947
            + L KLRAR++  +  + + N+L+F
Sbjct: 1908 QRLSKLRARRKNDSSSSGSENRLNF 1932

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1119 (37%), Positives = 629/1119 (56%), Gaps = 103/1119 (9%)

Query: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS-----KYSYSKRTSSQASN- 136
            +PL+K++TLN  +LS Y      TDA  +  H RS S  S     KYSYS+R S  ++N 
Sbjct: 72   KPLSKQSTLNMASLSAY------TDAVGA--HNRSASNASVGSPTKYSYSRRASQWSNNN 123

Query: 137  ------KLTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLEMPSDPYEVEVLFEDIM 190
                  KL+RQ T Q                 KF  PDG + LE P DP E+E LFE+++
Sbjct: 124  SAVSGSKLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVL 183

Query: 191  YKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKXXXXXXXXXXXXXXXXXXDQH 250
            YKRN++QSL    Q EL +Y  EKKWL+V+QDLQ+E+KK                     
Sbjct: 184  YKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAV 243

Query: 251  PILTANSTLSSPKSALMTSASSPTSTVYXXXXXXXXXXXXVGTSTPKGHNNKKTIAGGLK 310
            P         SP ++  TS++SP  +               G S P      K     + 
Sbjct: 244  P--------DSPSASNFTSSTSPNGSF-------------TGLSRP------KISTSSVN 276

Query: 311  KQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQL 370
                  S   G     +S +TL  D ++  P +YV++I+ + ++   + DLWV+LRTEQL
Sbjct: 277  TSEQFYSSNLG----TSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQL 332

Query: 371  DWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEF 430
            DWV  F++ QG +A+ANV++ + Y+ +P   L  E+L+KE ++FKC +    L +G  E 
Sbjct: 333  DWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEA 392

Query: 431  ---STHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQN 487
               ++ R++   + EGL S ++ TR++A+E+ + + +    + F  V+ ALD++ R   N
Sbjct: 393  VMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFCDN 452

Query: 488  LHM-----IQNFKKMPQYFSHLTL------ESHLKIIQAWLFAVEQTLDGRGKMGSLVGA 536
            +H+      Q+  K P+  S +        +  ++  + W+  VE TLDGRGKMGSLVGA
Sbjct: 453  VHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGA 512

Query: 537  SDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLD 596
            S++F+  GGENAI+EY   T++ INHLC    +V QR +LR +L+N G+ RI+NK+KLL+
Sbjct: 513  SEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLN 572

Query: 597  YDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSL 656
            Y+KV +Q+  +D++  DDF+      +    VD+KDP+S+ +NLW +CKGTD E+ L SL
Sbjct: 573  YEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSL 632

Query: 657  VQHLFLSSSKLIEENQ-NPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQ 715
            +Q+L +S+ +L  +N+ +P++ +KQLKL+D+LV+NVS+AS  D +S+ N AIQRLYDAMQ
Sbjct: 633  LQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASV-DMQSSFNSAIQRLYDAMQ 691

Query: 716  TDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQR 775
            TDE+ARRAILE+R   K+ EEI+A+RD+L EKL  AE GLVGQL++E+  RD IL K+QR
Sbjct: 692  TDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQR 751

Query: 776  VMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDL--SKGTKDINPSLNSS 833
            V                       VELRK LT +NS  E S ++   KG+++  P L   
Sbjct: 752  VNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRP-LRPE 810

Query: 834  EKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFA 893
             K  IQK LQ  L +  K+   +SK+ G++L+PNKRLK+LR +ME+IEN+AR+LEMTNF+
Sbjct: 811  RKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFS 870

Query: 894  EFEKERLXXXXXXXXXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKF 953
            +++K+ +                    S  K Q     KL +LR+ LA +Q ESNDISKF
Sbjct: 871  DYQKDDI----KEPEVSNEDDHKAVSESEEKAQQISALKLEELRKKLASLQQESNDISKF 926

Query: 954  NVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYPSL 1013
            NVE R +E+F+ +KSLAL RLK+LET YKGFGI+F+ +  +           +D A  +L
Sbjct: 927  NVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKAR-TL 985

Query: 1014 DPKAYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQ 1073
            DPK   + ++E++ I   L   +   K                           D+S  +
Sbjct: 986  DPKEALNIVEEVSNILSGLDSSKAAEKSNETPLRTATS---------------SDSSEDE 1030

Query: 1074 --ERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTA-----SAGLRDNRGSGHMPSNVEK 1126
              ++ G+     +     SFL++LSQKYG  QN  +     + G  +  GSG+      K
Sbjct: 1031 MDDKNGDKIAADSTLPTSSFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYH----RK 1086

Query: 1127 SFINRLRKSTASSAPYLEELTQKVNKVEPFKQNKDEDLV 1165
            SF+NR++++ A   PYL EL+ K+      K ++ E+ V
Sbjct: 1087 SFMNRVKRTGA--VPYLGELSGKIGSSSYIKPSEAEENV 1123

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/592 (60%), Positives = 441/592 (74%), Gaps = 33/592 (5%)

Query: 1335 SPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEK 1394
            SPLLPQSPSLFE+YPRP KKLKQLHWEKID  DNSIW + +AEKFADDLYEKGVL++LEK
Sbjct: 1357 SPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEK 1416

Query: 1395 AFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQ 1454
            AFAAREIKS   ++K++  K+TFLSRDISQQFGINLHMYSSL V+ +V KILKCD+DFL 
Sbjct: 1417 AFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLS 1476

Query: 1455 TPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQL 1514
            T S +EFLSKPEI EVS N+AR++APY+TDWEG+  +EDAK PEKDP++LQR+DQ++L L
Sbjct: 1477 TQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNL 1536

Query: 1515 MVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGN 1574
            +VNL+ YW SRMR L ++T+YEK+YN+L+ KLR +D+AVGA+Q+S+NLRNVF+VILAVGN
Sbjct: 1537 IVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGN 1596

Query: 1575 FMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDV 1634
            +MNDTSKQAQGFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYPSFN FL+ELEPVL V
Sbjct: 1597 YMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQV 1656

Query: 1635 VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDL 1694
            VK+SIEQL NDC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LP+LPEAR+K +L
Sbjct: 1657 VKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANL 1716

Query: 1695 LEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLY 1754
            L DEV+L++MEFE+LM+ +GED+                + EYKRAQ  N   +EEER Y
Sbjct: 1717 LADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAY 1776

Query: 1755 EKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKSDPS 1814
            E+ K M++EQQ+RA+  ++  E +            D R VMDKLLE+LKNAGP+K DPS
Sbjct: 1777 ERRKLMIQEQQRRAKLVQEGDE-TTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPS 1835

Query: 1815 SARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDT--DTVIHAESPTPLAT 1872
            SARKRAL RKK +  ++ S  +       EG  +   ++  PD   DT + A S +P   
Sbjct: 1836 SARKRALARKKLMGGREGSIIL-------EGLDVDDLQSAAPDVQPDTPLRAASASP--- 1885

Query: 1873 RGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEH 1924
                  P   P P+            DRAR LL ELR  + P  + S+LDEH
Sbjct: 1886 ------P---PDPA-----------ADRARHLLLELRNGEHPESRKSMLDEH 1917

 Score =  516 bits (1329), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 309/722 (42%), Positives = 443/722 (61%), Gaps = 40/722 (5%)

Query: 341  PIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRE 400
            P HYV++I++D++T  E+ DLW++LRTE +DWV  FID QG +A+AN L+  + + +   
Sbjct: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDI 355

Query: 401  HLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFV 460
                + LEKEN+++KC RVL+ L +G+ E    +L+  +V EGL S++L TR++ATE  +
Sbjct: 356  LHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLL 415

Query: 461  CMLEK-------KNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKII 513
             ML           ++    +L ALD++ +   N+H+     +  +  S  T  +   ++
Sbjct: 416  YMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVV 475

Query: 514  ----QAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDN 569
                + WL+ +E TLDGRG+MGSLVGASD++K  GGEN +LEY  ++M+ +N LCS   +
Sbjct: 476  AKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLLCSNHPD 533

Query: 570  VNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVD 629
            V QR LLR++L++ G+ RI+ K++LL Y  + +++  +++  LDD+N+ + ++     VD
Sbjct: 534  VQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVD 593

Query: 630  LKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVT 689
            +KDP +L ++ W   +GT+ E  L+SL+QHL    S+   E ++P++  KQLKL+D+LVT
Sbjct: 594  MKDPAALWQDFWTQHRGTEAEGHLLSLLQHL-FLWSRAFAEYRDPAESIKQLKLLDALVT 652

Query: 690  NVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLG 749
            NV+ +S  D ES  N AIQRLYDAMQTDEVARRAILESR LTKK EEI+AERD+L+ KL 
Sbjct: 653  NVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLS 711

Query: 750  KAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTIL 809
            +A++GLVGQL++E+   +RIL K+ RV                       VELRKMLTIL
Sbjct: 712  QAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTIL 771

Query: 810  NSRPEESSDLSKGTKDINPS-LNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNK 868
            NS+P   +  S       PS L   +K  IQK LQD L + +KD   DSK+      PN+
Sbjct: 772  NSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNR 831

Query: 869  RLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXXXSSVKTQGA 928
            RLKMLR +M+ IE EAR LEMTNFA+F+KE                           +G 
Sbjct: 832  RLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEPKLLSPPKIQRSL--------RGE 883

Query: 929  DMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDF 988
             + +L  LR+ LA IQ ESN++SKFNVEERVNELF EKK+ AL RL++LE KYKGFGIDF
Sbjct: 884  QVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDF 943

Query: 989  NVEEFIETPKKFSVDEEN---DAAYPS--------LDPKAYQSKLDEINRITDELLDLQT 1037
            N     E P+  S+   N   D   P+        LDP    +K++E+ +I D L  L+ 
Sbjct: 944  N-----EDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRLNKLKK 998

Query: 1038 QV 1039
             +
Sbjct: 999  DI 1000

 Score = 79.7 bits (195), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 92/187 (49%), Gaps = 30/187 (16%)

Query: 69  RRLNGPSRSTSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHA-------RSHSVQ 121
           +++  PS    + A+PLNK  T+N  NL Q ++G++ T A ++S  A             
Sbjct: 59  KKVTLPSNLDLSGAKPLNKLNTINASNLPQ-VSGEV-TQARSASGAALSSPSKYSYSKRS 116

Query: 122 SKYSYSKRTSSQASNK-------------------LTRQHTGQXXXXXXXXXXXXXXXXX 162
           S+++ SK+ +    ++                   LTRQ T Q                 
Sbjct: 117 SQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMTNQSNYSASSYTSLSLLH-- 174

Query: 163 KFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQD 222
           K T  DG + LE P DP E+E L+++++ KRNI QS+S     ELMSY  +KKWL+VKQD
Sbjct: 175 KATDIDGTLTLEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVKQD 234

Query: 223 LQNELKK 229
           LQ E KK
Sbjct: 235 LQTEYKK 241

 Score = 46.6 bits (109), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 21/80 (26%)

Query: 1089 GSFLDALSQKYGTGQNVTASAGLRDNRGSGHM----------------PSNVEKSFINRL 1132
             SFL+ LSQKYGTG    + +G      S HM                  N  KSF+NR+
Sbjct: 1086 ASFLETLSQKYGTG----SQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRM 1141

Query: 1133 RKS-TASSAPYLEELTQKVN 1151
            +++ T +S+ +LEELTQKV+
Sbjct: 1142 KRTITPTSSNFLEELTQKVS 1161

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/644 (59%), Positives = 469/644 (72%), Gaps = 28/644 (4%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            K +  SPLLPQSPSLFEKYPRP K+LKQLHWEKID  DNSIW + +AEKFADDLYE+GVL
Sbjct: 1385 KGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVL 1444

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
             +LEKAFAAREIKSL + RK+D  KVTFLSRDISQQFGINLHMYSSL+V  +V KILKCD
Sbjct: 1445 TELEKAFAAREIKSLIS-RKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCD 1503

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            +DFL T S +EFLSK EI EVS+N+AR +APY+TDWEG+  +E+AK PEKDPN+LQRADQ
Sbjct: 1504 KDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQ 1563

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            +YL L+VNL+ YW SRMRAL ++T+YEK+YN+L+ KLR +D+AVGA+Q+S+NLRNVF+VI
Sbjct: 1564 LYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVI 1623

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MND+SKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FL+ELE
Sbjct: 1624 LAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELE 1683

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            PVL VVK+SIEQL NDC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LPVLPEAR
Sbjct: 1684 PVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEAR 1743

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            ++ +LL DEV+L++MEFESLM+ +GEDS                + EYKRAQ  N   EE
Sbjct: 1744 KRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEE 1803

Query: 1750 EERLYEKHKKMVEEQQKRA----QDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKN 1805
            EER YE+ K M+EEQQKRA    Q         +           D R VMD+LLE+LKN
Sbjct: 1804 EERAYERRKIMIEEQQKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKN 1863

Query: 1806 AGPAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEE----------------GSILY 1849
            AGP+K+DPSSARKRAL RKK +  K + + +L+ L+ EE                 +IL 
Sbjct: 1864 AGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILG 1923

Query: 1850 SPEATTPDTDTV-----IHAESPTPL-ATRGFMNTPEDLPSPSKASALEDQEEITDRARM 1903
            SP +T   T  V      H     P+ A +G +++     S S +  + D++ +T RAR 
Sbjct: 1924 SPTSTVGATADVEGLNPDHDLPSAPISAEKGSVSSALSHSSESPSKKILDEDAVTHRARN 1983

Query: 1904 LLKELRGSDAPVK-QNSILDEHLEKLRARKERANGETNTGNKLS 1946
            LL+ELR SD   + + S+LDEH EK+R R+ +   E + GN  S
Sbjct: 1984 LLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTS 2027

 Score =  555 bits (1431), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 327/732 (44%), Positives = 464/732 (63%), Gaps = 38/732 (5%)

Query: 335  DRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIY 394
            D ++  P HYV++I++D++T  E+ DLWV+LRTE +DWV  FID QG +A+AN L+    
Sbjct: 286  DPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQ 345

Query: 395  KTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKM 454
            + +    L  +LLEKE +++KC RVL+ L +G+    + +L+   V EGL S +L TR++
Sbjct: 346  RESLESLLDSDLLEKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRI 405

Query: 455  ATEIFVCMLE----KKNKNRFEA---VLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLE 507
            ATE  + ML     K     F+A   VL ALD++ +   ++H+     +  +  S  T  
Sbjct: 406  ATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGR 465

Query: 508  SHLKII----QAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHL 563
            + L +I    + WL+ +E TLDGRG+MGSLVGAS+++KNG  EN +LEY  ++M+ IN L
Sbjct: 466  ADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKNG--ENTVLEYLLYSMILINLL 523

Query: 564  CSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASN 623
            CS   +++QR LLR++L++ G+ R++ K++LL Y  + +++  +++  LDD+N  + +S 
Sbjct: 524  CSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASST 583

Query: 624  KAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKL 683
               +VD+KDP SL  N W   KGT++E  L+SL+QHLFL SSK   E+ +P++ SKQLKL
Sbjct: 584  VDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKL 643

Query: 684  MDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDS 743
            +D+LV+NV+ +S  D ES  N AIQRLYDAMQTDEVARRAILESR LTKK EE++AERD 
Sbjct: 644  LDALVSNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDH 702

Query: 744  LSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELR 803
            L  KL +A+ GLVGQL+ E+    RIL K+ RV                       VELR
Sbjct: 703  LQTKLAQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELR 762

Query: 804  KMLTILNSRPEESSDLSKGTKDIN---PS-LNSSEKANIQKVLQDGLSRAKKDYKDDSKK 859
            KMLTILNS+P ++S+ +     IN   PS L   +K  IQK LQD L + +KD   DS++
Sbjct: 763  KMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRR 822

Query: 860  FGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLXXXXXXXXXXXXXXXXXXX 919
            FG    PN+RLKMLR +M++IE EA  LEMTNFAEF+KE                     
Sbjct: 823  FGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKE------TKVEDLPRLQSPPKI 876

Query: 920  XSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELET 979
              +V+++   + +L  LR+ LA IQ ESN+ISKFNVEERVNELF EKK+ AL RL++LE 
Sbjct: 877  ERNVRSE--KVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEE 934

Query: 980  KYKGFGIDFNVEE--FIETPKK----FSVDEENDAAYPS------LDPKAYQSKLDEINR 1027
            KY+ FGIDFN+E    IET ++     SV E +++  P+      LDP    +K++E+ +
Sbjct: 935  KYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTK 994

Query: 1028 ITDELLDLQTQV 1039
            I +EL  L+ QV
Sbjct: 995  ILEELNRLKCQV 1006

 Score = 83.6 bits (205), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 87/175 (49%), Gaps = 16/175 (9%)

Query: 69  RRLNGPSRSTSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSK 128
           ++++ PS    + A+PL+K +TLNT +LSQY +    +  P+      S S  S    S 
Sbjct: 64  KKVSIPSSLDLSTAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGSPSKYSYSKRSS 123

Query: 129 RTSSQASNK--------------LTRQHTGQXXXXXXXXXXXXXXXXXKFTTPDGKIHLE 174
           + S   SNK              L+RQ T Q                 K T  DG + LE
Sbjct: 124 QWSGGNSNKQLLLLPQPQHSQHTLSRQPTNQSNNSDNSFSSVTLLQ--KITDSDGNLSLE 181

Query: 175 MPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKK 229
            P  P E+E L+++++ KRNI  S+S     ELM Y  +KKWL+VKQDLQ ELK+
Sbjct: 182 KPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKR 236

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 63/132 (47%), Gaps = 22/132 (16%)

Query: 1069 ASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTAS--------------AGLRDN 1114
             SPS     E S+    +   SFL++LSQKYGTG N+  +              AG    
Sbjct: 1089 VSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQ 1148

Query: 1115 RGSGHMPSNVEKSFINRLRK-STASSAPYLEELTQKVNKVEPFKQNKDEDLVKDLSTEND 1173
            R SG+      KSF+NR++K ST  S+ +++E++QK+    P    +  D +++ +T + 
Sbjct: 1149 RNSGYH----RKSFVNRMKKNSTPKSSSFVDEVSQKMT---PVHVAQSPDSLQNTATSSS 1201

Query: 1174 IADGTFVSDKVG 1185
                    D VG
Sbjct: 1202 TPQSAKSEDAVG 1213

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/583 (57%), Positives = 438/583 (75%), Gaps = 20/583 (3%)

Query: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389
            K+ VTSPLLPQSPSLFE+YPRP KKLKQLHWEKID+  +SIW + +AEK ADDL+E+GVL
Sbjct: 1211 KATVTSPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVL 1270

Query: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449
            + LEKAFAARE KSL  K KE  +K+TFLSRD+SQQFGINLHM+S+L V D+V K++KCD
Sbjct: 1271 SQLEKAFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCD 1330

Query: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509
            R+FL TPSV+EFLSKP I EV+ NLAR + PYSTDWEG+  ++DAKPPEKDPN+LQRADQ
Sbjct: 1331 REFLSTPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQ 1390

Query: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569
            +Y++ M+NL+ YWGSRMRA+T++T+YEK+Y++L+ KLRK+DRAV  +++S++LR+VF+VI
Sbjct: 1391 LYVEFMINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVI 1450

Query: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
            LAVGN+MND+SKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKIIR NYP ++ F++ELE
Sbjct: 1451 LAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELE 1510

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
            P+  V K+SIEQLV DCK+FSQS++NVERS+EIGNLSD SKFHPLD+VL K +PVLPEAR
Sbjct: 1511 PIFSVTKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEAR 1570

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
            +K DLL DE+KL+++EFE+LM+ +GED+                + E+K+A++ N+  EE
Sbjct: 1571 KKADLLSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEE 1630

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPA 1809
            EER YE+ KKM+E+QQ++ Q+ +       L          D R  ++KLL++LKNA P+
Sbjct: 1631 EERAYERRKKMIEDQQRKQQEADSKATAKNL---STSQEPSDDRDDIEKLLDKLKNAAPS 1687

Query: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTP 1869
            K DPSS RKRAL RKK + D  + A + +++  +      + EA      T+   ESPT 
Sbjct: 1688 KGDPSSTRKRALARKKLL-DGKSGASIFDNITADS-----TIEAFVEQNRTL--TESPTA 1739

Query: 1870 LATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSD 1912
              +            P   S    +++  DRAR LL ELRG D
Sbjct: 1740 KKSASL---------PETESLSSSKQDPADRARNLLLELRGPD 1773

 Score =  569 bits (1467), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 358/867 (41%), Positives = 517/867 (59%), Gaps = 72/867 (8%)

Query: 315  LNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVD 374
            LN+ Y G    N S  +L    ++ PP +YV++I++ K+   E+ DLWV+LRTE LDWV 
Sbjct: 243  LNTQYEGMLHTNESQGSLLSP-SHFPPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVI 301

Query: 375  AFIDHQGHIAMANVLMNSIYK--TAPREHLT-KELLEKENSFFKCFRVLSMLSQGLYEFS 431
            +F++ QG +A+AN+++ S+++  T  +  +T  + LE+E + FKC RVL  + + L E  
Sbjct: 302  SFLEAQGQVAIANLIITSMHQDTTDNQNAVTDPQFLERETALFKCLRVLLNIRECLEEAV 361

Query: 432  THRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKN--KNR------FEAVLTALDKKFR 483
               L+T+ + EGL STK+ TR++ATE  + ++ K    K+R      F  V+ +L+ +  
Sbjct: 362  NSTLVTNALVEGLLSTKIPTRRLATETLIYLVTKDEDFKSRTAGLDCFSLVMESLNHETS 421

Query: 484  IGQNLHMIQNFKKM----PQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDE 539
            + QN+HM   F       P+  S+  L    KI+Q WL+ VEQTLDGRGKMGSLVGASDE
Sbjct: 422  LVQNIHMKAKFSTNDSTDPE--SNPQLYQVCKILQQWLYVVEQTLDGRGKMGSLVGASDE 479

Query: 540  FKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDK 599
            ++N  GEN+I EY   ++V I+ LC  +++V +R ++RT+L++ G+ RI+ K++LLDY  
Sbjct: 480  YRNNTGENSIYEYLVDSIVLIDQLCLNNEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPP 539

Query: 600  VIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQH 659
            +   +  +++  +DD+N  +++     NVD+ DP+S+L+ L    KGT+ E  L+S++Q+
Sbjct: 540  LSTMLLQFEDAAIDDYNSLIDSQKFTENVDMDDPVSILQKLTSSFKGTEAESYLLSMLQN 599

Query: 660  LFLSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEV 719
            LFLSS+K  +E+ +P K  +QLKL+DSL++NV++ +T D ESN N+AIQRLYD+MQTDE+
Sbjct: 600  LFLSSNKNAQESDDPGKNVQQLKLIDSLISNVAI-TTLDSESNFNVAIQRLYDSMQTDEI 658

Query: 720  ARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMXX 779
            ARRAILESR LTKKLEE++AERD L++K+ KAE+GLVGQL+ EL  RD IL K QRV   
Sbjct: 659  ARRAILESRELTKKLEEVKAERDYLNDKISKAENGLVGQLQKELAERDLILDKTQRVTEQ 718

Query: 780  XXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDLSKGT---KDINPSLNSSEKA 836
                                +ELRKMLTI+NS+   S DL  G+    D  P LN   K 
Sbjct: 719  LQSELEELKKRHLLEKHEHEIELRKMLTIVNSK--TSDDLESGSTVQNDPKP-LNPERKT 775

Query: 837  NIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFE 896
             IQ VLQ  L + ++D  ++S++ G  +    RLK+LR +ME+IEN+AR+LEMTNFA+ +
Sbjct: 776  AIQNVLQRSLQKTEQDLLNESRRLGTAVGSKSRLKLLRSKMEDIENQARELEMTNFADVK 835

Query: 897  KERLXXXXXXXXXXXXXXXXXXXXSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVE 956
             ++                       VK Q A   KL +LR+ LA IQ ESNDI+KFN+E
Sbjct: 836  PKQ----------------NQKFKEQVKGQQA--TKLAELRKKLAIIQNESNDITKFNIE 877

Query: 957  ERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPK 1016
             RVNELF +KK  AL RLK+LE KY GF ID     F + P+   +  ++    PSLDP 
Sbjct: 878  ARVNELFQDKKLAALDRLKDLENKYNGFHID-----FADDPELKELLTQSSNGGPSLDPT 932

Query: 1017 AYQSKLDEINRITDELLDLQTQVKQXXXXXXXXXXXXXXXXXXXXXXXIYQDASPSQERR 1076
              Q K++E+N I DEL  L+ ++K                            +  S    
Sbjct: 933  IVQRKVEEMNSIIDELNALKEEMKNRPKTGSSSSSSSSLSSASSSSEDGSSQSQASHGS- 991

Query: 1077 GEYSELSAGSGPGSFLDALSQKYGTG-QNVTASAGLRDNR-----GSGHMPSNVEKSFIN 1130
                 +S GS   SFL++LSQKY TG Q  T++ G R  R     GSG+      KSF+N
Sbjct: 992  ---DIVSNGS---SFLESLSQKYSTGQQTATSTNGGRVGRETRYPGSGYH----RKSFLN 1041

Query: 1131 RLRKSTASSA-------PYLEELTQKV 1150
            RL+ +T +         P+L EL  KV
Sbjct: 1042 RLKNTTVNPTATSEHLPPFLTELKSKV 1068

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 88/150 (58%), Gaps = 10/150 (6%)

Query: 82  ARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQ 141
           ++PLNK ++LNT NLS Y    +  +A + SQ A   +  +KYSYS+R+S     +LTR 
Sbjct: 76  SKPLNKISSLNTHNLSHYT---MDPEANSRSQSASLLTSPTKYSYSRRSS-----QLTRS 127

Query: 142 HTGQXXXXXXXXXXXXXXXXX--KFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSL 199
            T +                   +F T DG + L+ P +P E+  LF D++ KRN+F S+
Sbjct: 128 STNKSIISSSAVSVSSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSV 187

Query: 200 SGDKQEELMSYSTEKKWLIVKQDLQNELKK 229
           S   Q+++++Y  EKKWL+VKQDLQ+E K+
Sbjct: 188 SSQDQKDMLNYPIEKKWLMVKQDLQSEFKR 217

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  302 bits (773), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 158/424 (37%), Positives = 269/424 (63%), Gaps = 13/424 (3%)

Query: 1354 KLKQLHWEKIDSTDNSIWGSGKAEKFADD-LYEKGVLADLEKAFAAREI---KSLATKRK 1409
            KL+Q+HW+ I+    + W   +  K     L E GV  ++E+ F  ++    K    K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1410 EDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEITE 1469
            ++L+KV+FLSRD++QQFGINLHM+S+ +V +LV K+L C+ + ++  SV+EF +K ++T 
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1470 VSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMRAL 1529
            +S ++ +N+ PYST+      +   + P KD ++L+RAD+I+L+L  NL  YW +RMR L
Sbjct: 979  ISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1530 TVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKLS 1589
             ++ +YEK+Y ++L KL+K+D A  A++ S  L+ +  +I+ +GN+MN+  +QA+G KLS
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1590 TLQRLTFIK-DTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCKD 1648
            +L +L F+K  TNN+M+FL+Y+E+I+R  Y      + +L  +  + K++++Q+  DC++
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1649 FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEFES 1708
            F++ I N+ERS + G+LS +  FHP D ++ KT   +P A+RK  LL D+ KLT+ + E 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1709 LMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQKRA 1768
            LM   GE+                 V+ +K+A  +N+  EE ER+YE+ KK++E +++  
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKERSC 1270

Query: 1769 QDKE 1772
             + E
Sbjct: 1271 GNME 1274

 Score = 54.3 bits (129), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 116/237 (48%), Gaps = 17/237 (7%)

Query: 549 ILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYD 608
           + +YC  T+  IN +   + +  ++ LL  K + CGI R+  K K      + D+I  Y 
Sbjct: 317 LTDYCLSTLFLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKY- 375

Query: 609 NNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLI 668
             ++++  +   +      +D+    S+LK L    + T  E  L  L++ +       I
Sbjct: 376 -KEVEEEVITRSSPELPTFLDISYG-SILKTLILETRSTPLEHPLYQLLEGVLQ-----I 428

Query: 669 EENQNPSKLSKQLKLMDSLVTNV---SVASTADE--ESNMNMAIQRLYDAMQTDEVARRA 723
              +  S+  K  KL  S++  +   +  S + E  ES +  ++ ++ D++Q+DE+ARRA
Sbjct: 429 SVTRTSSESIKLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDSLQSDEIARRA 488

Query: 724 ILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLE---NELHGRDRILAK-NQRV 776
           + E  +L + ++++ AE +SL E+    +  ++ QLE     L  +D  L + N+R+
Sbjct: 489 MKELNSLQETVDQLTAEVESLKEERKVTKGEVIMQLEEARESLRDKDETLKQLNERI 545

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  300 bits (767), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 154/423 (36%), Positives = 254/423 (60%), Gaps = 12/423 (2%)

Query: 1353 KKLKQLHWEKIDSTDNSIWGSGKA-EKFADDLYEKGVLADLEKAFAAREIKSLATKRK-- 1409
            KK+KQ+HWEKI+  +N+ W + +  E+   +L   G+   +E  F  + +  +  K+K  
Sbjct: 818  KKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKVV 877

Query: 1410 -EDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEIT 1468
                + ++FLSRD++QQFGINLH++  LS  +LV K+L+CD D L+  SV+EF  K E+T
Sbjct: 878  SSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEMT 937

Query: 1469 EVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMRA 1528
             ++ +L R+  PYSTD+     +     P K+P++LQRAD+I+L+L  NL  YW  R + 
Sbjct: 938  HINPSLVRHLTPYSTDY-----MNPESVPTKNPDELQRADKIFLKLSFNLRSYWNERSQC 992

Query: 1529 LTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL 1588
            L ++ +YEK+Y +LL KL+K+D A+  +  S+  +N+  +I+ +GNFMN  ++   G +L
Sbjct: 993  LLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIRL 1050

Query: 1589 STLQRLTFIKDTN-NSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCK 1647
            S L +L FIK  N N+++FL+Y+E++IR++Y     F+ +L  V ++ K+S++Q+   C+
Sbjct: 1051 SALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQCE 1110

Query: 1648 DFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEFE 1707
            +F   I  +  ++  G LSD  K HP D++L K    +  AR KG+LL D  KL+  +FE
Sbjct: 1111 EFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDFE 1170

Query: 1708 SLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQKR 1767
             +M+ YGED                    +K+   +N+  EE ER+Y + KK++E   ++
Sbjct: 1171 KVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKKIMEASTRK 1230

Query: 1768 AQD 1770
              D
Sbjct: 1231 DSD 1233

 Score = 37.4 bits (85), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 101/207 (48%), Gaps = 21/207 (10%)

Query: 549 ILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYD 608
           I +Y    +  IN +     +   +  +  +L+   +  ++  ++ +D + + +Q++L+ 
Sbjct: 339 ISDYFSSMLFLINSIVQGFQSFTTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFK 398

Query: 609 NNKLDDFNVKLEASNKAFNVDLKDPL-SLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKL 667
           +    + N+ LE +++   V +  P  S+L+ L  +   T  E  + SL+  +  S +K 
Sbjct: 399 DT---EENI-LEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLDLILKSVNK- 453

Query: 668 IEENQNPSKLSKQLKLMDSLVT----NVSVASTADEESNMNMAIQRLYDAMQTDEVARRA 723
               +  S+ SK L+ M+S +     N +       E+    ++  L D++Q+DE+A+RA
Sbjct: 454 ----KTYSESSKLLQFMESFLQYSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEIAKRA 509

Query: 724 ILESRTLTKKLEEIQAERDSLSEKLGK 750
           +LE       L+E Q++ + LS +L K
Sbjct: 510 MLE-------LDEKQSQMNILSNQLTK 529

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  291 bits (744), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 165/476 (34%), Positives = 276/476 (57%), Gaps = 32/476 (6%)

Query: 1349 PRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAF----AAREIKSL 1404
            P+   +LKQ+HWEK+D    ++W         D L ++GV + +EK F      ++ K L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1405 ATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464
            A    +   K++FL+RDI+QQFGINLHMYS LSV + V K+LKC+ D +Q  SV+ F +K
Sbjct: 875  AENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTK 933

Query: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524
             ++T++   L R +APYST++     L D   PEKDP +L+RAD IYL+L  NL  YW +
Sbjct: 934  EDLTQIPSGLERKFAPYSTNY-----LTD-DSPEKDPRELERADHIYLELFYNLRSYWSA 987

Query: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584
            R   L V+T+YE++Y +L+ KL K+D A+  L +S  ++ +  +I  +GN+MN  S    
Sbjct: 988  RSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VT 1045

Query: 1585 GFKLSTLQRLTFIKDTN-NSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLV 1643
            G KL++L +L+F+K ++  +++FL++VE+++R ++P    F +++  V D+ KV++E + 
Sbjct: 1046 GIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1644 NDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTI 1703
             +C++F++ + +V  S+  G LSD +K HP D +  K    +  A+ K +LL ++ +LT 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1704 MEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEE 1763
                 LM+ YGE+                    +K+   +N+  EE  RLYE+ K ++E+
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1764 QQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKSDPSSARKR 1819
            + K+ ++    +EHS            D    +D L+ +L++A   K  P+  R+R
Sbjct: 1226 RNKKIEE----QEHS-----------DDEINAVDDLITKLRDA--KKQHPAPLRRR 1264

 Score = 37.0 bits (84), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 102/230 (44%), Gaps = 29/230 (12%)

Query: 549 ILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENC-GILRIMNKIKLLDYDKVIDQIELY 607
           ++EYC   M  +N +     +  ++  +    EN      ++  I+ LD +    QI+ Y
Sbjct: 266 LVEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKY 325

Query: 608 DNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKL 667
            + KL+     +   N      L+D +S  + L ++   T N  L   L  +LF    ++
Sbjct: 326 RDVKLE-----IMTRNSCVPSILED-VSYSQVLTDLVIQTKNTALESGL-GNLFTLVFQV 378

Query: 668 IEENQNPSKLSKQLKLMDSLVTNVS-VASTADEESNMNM----AIQRLYDAMQTDEVARR 722
           I   +  ++  K LKL+  LV  ++ V +  D   N +     AI  L D +Q++++ RR
Sbjct: 379 IH-TKKLNECIKFLKLIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQSEDLTRR 437

Query: 723 AILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAK 772
           A++E +TL K + E+ +                + +LENE H   R + +
Sbjct: 438 AMVEIKTLEKNITELNSH---------------IAELENEAHMDKRTIIQ 472

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  290 bits (742), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 153/438 (34%), Positives = 256/438 (58%), Gaps = 19/438 (4%)

Query: 1335 SPLLPQSPSL--FEKYPRPHKKLKQLHWEKIDSTDNSIWG--SGKAEKFADDLYEKGVLA 1390
            SP  P  P L        P  KLKQ+HW+KID    ++W   S +  K + +L   G+  
Sbjct: 940  SPGAPDIPKLGNVTLLSAPKLKLKQIHWDKIDDIKETVWCDQSQRVSK-STELASFGIFQ 998

Query: 1391 DLEKAFAAREIKSLATKRKEDL-----QKVTFLSRDISQQFGINLHMYSSLSVADLVKKI 1445
            ++++ F              +L      KV+ LSR+++Q+FGINLH++S  +V +L  K+
Sbjct: 999  EIDELFQLNPTSPAIANATANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKV 1058

Query: 1446 LKCDRDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQ 1505
            L CD + L+  SV+EF  K EI  +  ++ + +APYS ++         + P++DPN+L 
Sbjct: 1059 LNCDNEVLKNQSVIEFFCKEEINNIPKSVQQLFAPYSANYI------TGEQPDRDPNELD 1112

Query: 1506 RADQIYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNV 1565
            RAD+IYL+L  NL  YWG+R + L V+ +++K+Y ++L KL ++D A  ALQ S  L+ +
Sbjct: 1113 RADRIYLELFYNLRSYWGARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKEL 1172

Query: 1566 FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIK-DTNNSMTFLNYVEKIIRLNYPSFNDF 1624
            F +I+ +GN+MN   +   G +LS+L +L F K  T+N+M+F++ +E+I+R  YPS +DF
Sbjct: 1173 FFIIVEIGNYMNQ--RPVAGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDF 1230

Query: 1625 LKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPV 1684
            ++ L+ +L+V  + ++ +  +  +F   I ++ER   IG LSD S+FHP DK ++KT   
Sbjct: 1231 VEGLDKILEVQNIIVQHVQQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESK 1290

Query: 1685 LPEARRKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQN 1744
            +  A++K DLL+D+  LT+ +FE LM  +GE+                 +  +++A  +N
Sbjct: 1291 ILLAKKKADLLKDQCTLTMSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKEN 1350

Query: 1745 LAAEEEERLYEKHKKMVE 1762
               EE  R+YEK ++ +E
Sbjct: 1351 SEREEMTRIYEKRRRALE 1368

 Score = 56.6 bits (135), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 111/247 (44%), Gaps = 30/247 (12%)

Query: 516 WLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRML 575
           WL AVE T+    +    V +     N   +  +++YC  TM  IN L         +  
Sbjct: 289 WLEAVETTIKDETQWHDDVPS-----NQKPQQLMIDYCVSTMFLINSLIQGIPTYRGKSR 343

Query: 576 LRTKLENCGILRIMNKI----KLLDYDKVIDQIELYDNNKLDDFNVKLEASNKA-FNVDL 630
           L   L++ GI RI ++I    +  D + ++D+I  Y + +  + N K         NV  
Sbjct: 344 LIRLLKDAGIHRIFHRIVSSGEKFDSEILLDEISKYQSRE-GEINSKFVIDTPTHLNVSF 402

Query: 631 KDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTN 690
           K   S +K +  + +GT  E  +      L L S + I  ++  ++ +K L+L  S+   
Sbjct: 403 K---SQIKTIVTLTQGTSLESYMT-----LVLDSIRQIVTSRTSAEATKLLQLFQSIFKY 454

Query: 691 VSVASTADEESNMNMAIQ----RLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSE 746
           +   S  DEE    +A+Q    +L D +Q+ +V +RA+ E       LEE++ + + +  
Sbjct: 455 LIEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQE-------LEEMKVKMEEMKR 507

Query: 747 KLGKAEH 753
            + K EH
Sbjct: 508 VIAKLEH 514

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  286 bits (733), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 160/460 (34%), Positives = 264/460 (57%), Gaps = 20/460 (4%)

Query: 1354 KLKQLHWEKIDSTDNSIWGSGKAE-KFADDLYEKGVLADLEKAF-----AAREIKSLATK 1407
            KLKQ+HW+KID    ++W   K     + +L   GV  ++E+ F     A +   ++ T 
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1408 RKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEI 1467
            +     KVT LS D++QQFGINL+++S+ SV +LV+K+L CD + ++  SV+EF SK +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1468 TEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMR 1527
              +  ++ R +APY T++           PEKD   L RAD+IYL+L  NL  YW  R +
Sbjct: 935  NHIPQSIQRMFAPYETNYLT------GDKPEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1528 ALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFK 1587
             L  + +YEK+Y ++L KL+++D    A++ S  L+ +  +I+ VGN+MN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1588 LSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDC 1646
            LS+L +L F K + +N+++F++ +E I+RLNYP  + F+ +LE +LDV  + ++ +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1647 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEF 1706
            ++F + I  +ERS+ +G LSDSSKFHP DK LI T   +  A +K DLL+ +  LT+ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1707 ESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQK 1766
            + LM  +GED                    +K+A  +N+  E E R   + ++ + E+  
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENI--EREVRRVCESRRYLLEKTG 1224

Query: 1767 RAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNA 1806
             +  +    E   LP         D +  ++ L+++L+N 
Sbjct: 1225 NSHIRVDRSERCTLP---SLPADSDDQQAVEILIKRLRNV 1261

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  286 bits (731), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 153/429 (35%), Positives = 250/429 (58%), Gaps = 15/429 (3%)

Query: 1349 PRPH--KKLKQLHWEKIDSTDNSIWGSG-KAEKFADDLYEKGVLADLEKAFAAREI---K 1402
            P+P   K LKQ+HW+K+++ DN+IW    +  +   +L    +   +E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1403 SLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFL 1462
            S   K KE     +FLSRD++QQFGINLHMYS+ +  + +  +L C  + ++  SV+EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1463 SKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYW 1522
             K ++  +  +++RNYAPYS      RD    + P KD ++L+RAD+++L+L  NL  YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYS------RDYLSGEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1523 GSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQ 1582
              R + L ++ +YE++Y +L+ KL+K+D A+  L  S   R+   ++L +GN+MN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1583 AQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQ 1641
             +G K+S+L +L FIK + NN+++FL+++EK+IR  YP    F+ +L  V D+ KV++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1642 LVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKL 1701
            +  +C +F   + +V  SV  G LS S K HP D +L K    +  A+ K +LL+D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1702 TIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMV 1761
            T  +   L+  YGED                 ++ +K+   +N+  EE ER+YE+ K M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1762 EEQQKRAQD 1770
            E Q K+  D
Sbjct: 1405 ESQSKKEGD 1413

 Score = 42.0 bits (97), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%), Gaps = 4/63 (6%)

Query: 700 ESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSE--KLGKAEHGLVG 757
           ES +  +I  L D +Q+DE+ARRA+ E ++L + ++ +Q+E  SL E  +L K E  L+ 
Sbjct: 504 ESTVQNSINELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGE--LIA 561

Query: 758 QLE 760
           QL+
Sbjct: 562 QLK 564

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  285 bits (730), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 152/447 (34%), Positives = 263/447 (58%), Gaps = 27/447 (6%)

Query: 1341 SPSLFEKYPRPHK---KLKQLHWEKIDSTDNSIWGSGKAE-KFADDLYEKGVLADLEKAF 1396
            +P++  + P P     KLKQ+HW+KI++   ++W   +     + +L   G+  ++E+ F
Sbjct: 1149 APTMLTQQPSPPSTRIKLKQIHWDKIENIKETVWCDEQQRVSKSSELESLGIFKEIEELF 1208

Query: 1397 AAREIK--------SLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKC 1448
               EIK        + A+  K    +++ LSR+++Q+FGINLH++S  +V +LV K+L C
Sbjct: 1209 ---EIKPASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSC 1265

Query: 1449 DRDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDW-EGIRDLEDAKPPEKDPNDLQRA 1507
            D + ++   V+EF  K E   V  ++ R + PY T++  G R       PEKDP +L+RA
Sbjct: 1266 DSEVMKNQGVLEFFCKEEANNVPQSIQRLFGPYETNYLTGER-------PEKDPAELERA 1318

Query: 1508 DQIYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFN 1567
            D+IYL+L  NL  YW +R   L V++++E++Y ++L KL+++D A  A+Q S+ L+ +F 
Sbjct: 1319 DRIYLELFYNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFF 1378

Query: 1568 VILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLK 1626
            +I+ +GN+MN   K  QG +LS+L +L F K   +N+++F++ +E+I+R  YPS +DF++
Sbjct: 1379 IIVEIGNYMNQ--KPVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVE 1436

Query: 1627 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1686
             +  +  V  + ++ +  +  +F   I N++RS+  G LSD SKFHP D+ L +T   L 
Sbjct: 1437 GINSITGVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLA 1496

Query: 1687 EARRKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLA 1746
            +A++K  LL D+  LTI +FE LM  +GE+                 +  +++A  +N  
Sbjct: 1497 QAKKKARLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTE 1556

Query: 1747 AEEEERLYEKHKKMVEEQQKRAQDKEK 1773
             EE +R YEK ++++ EQ    QD+ +
Sbjct: 1557 REELDRTYEKRRRLL-EQTAALQDRRR 1582

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  281 bits (720), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 154/479 (32%), Positives = 277/479 (57%), Gaps = 30/479 (6%)

Query: 1345 FEKYPRPH-KKLKQLHWEKIDSTDNSIWGSGKAEK-FADDLYEKGVLADLEKAFAAREI- 1401
            F   P+P  K LKQ+HW+KI+   +++W          +DL EKGV  ++   F  + + 
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVR 851

Query: 1402 ---KSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSV 1458
               KS  T  K++ +KV+ LSRD++QQFGINLHM+SS SV DL+ K+L+CD D ++  SV
Sbjct: 852  MKKKSNVTASKKN-EKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSV 910

Query: 1459 VEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNL 1518
            +EF +K +   +  ++ R++ PY++DW+        K P++D + L+RAD+IYL++  N+
Sbjct: 911  LEFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFYNM 964

Query: 1519 EQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMND 1578
              YW  R  +L +  +YEK+Y ++L +L+K+D     ++ S+ L+  F +++ +GNFMN+
Sbjct: 965  RYYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN 1024

Query: 1579 TSKQAQGFKLSTLQRLTFIK-DTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKV 1637
              K+ QG KLS+L +L+ +K +++ +++FL+ +E+IIR  YP   DF ++L  + D+ K+
Sbjct: 1025 --KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKI 1082

Query: 1638 SIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLED 1697
            +IE + ++  ++ + I+ ++ S E G LS + K HP DK   K    LP A RK +LL +
Sbjct: 1083 NIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHN 1142

Query: 1698 EVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKH 1757
            + KLT+ +F S M+  GED                 +  + +   +N   E   R++E+ 
Sbjct: 1143 QCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQR 1202

Query: 1758 KKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKSDPSSA 1816
            ++++++     Q ++   + +A                +D L+++L++  P ++ P S+
Sbjct: 1203 QQLLQKASTETQVEKSADDEAA--------------DTIDILIKKLRSVDPQQTIPGSS 1247

 Score = 37.4 bits (85), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 55/270 (20%), Positives = 121/270 (44%), Gaps = 33/270 (12%)

Query: 506 LESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNG----GGENAILEYCQWTMVFIN 561
           LES     ++W+ AVE TL               F N       +  +++Y   T++ + 
Sbjct: 271 LESLDLCYESWIQAVEMTLRNPEDYA--------FNNSLILPKPKELLVDYSISTLLLVQ 322

Query: 562 HLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEA 621
            +     + + ++    + +  GI R+   +K LD   +   I+LY         ++L+ 
Sbjct: 323 SIQQLLPSNDLKLACFKRWKRAGIHRVFRLMKDLDSSALNQDIDLY-------IELELKV 375

Query: 622 SNKAFNVDLKDPLSL---LKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLS 678
            +K F  +    +S    +K+L E  K T  E  + ++++ +     +L+ E      + 
Sbjct: 376 QDKQFKNEFLSEISYGPQIKSLIEYTKDTPLETPICNIIETIL----ELVNERTTEGSI- 430

Query: 679 KQLKLMDSLVTNV---SVASTADE---ESNMNMAIQRLYDAMQTDEVARRAILESRTLTK 732
           K   + +S++T +   ++  + DE   E     ++  + D +Q+ ++A+RA++E     K
Sbjct: 431 KLFYVFNSILTYLCEHTLDGSFDETNTEQVFMTSLDHIMDNLQSHQIAKRAMMELDEKKK 490

Query: 733 KLEEIQAERDSLSEKLGKAEHGLVGQLENE 762
           + + IQ + D+L +    ++  L+ +LEN+
Sbjct: 491 EFDGIQLQLDTLLQDKQVSKGDLLQKLENK 520

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  280 bits (715), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 153/423 (36%), Positives = 252/423 (59%), Gaps = 10/423 (2%)

Query: 1350 RPHKKLKQLHWEKIDSTDNSIWGSGKAEK-FADDLYEKGVLADLEKAFAAREI-----KS 1403
            +P KKLKQ+HW+K++  +++IW + +  +     L   GVL ++E  F  +E      KS
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1404 LATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLS 1463
             AT+     + V+FLSRD++Q FGINLHM+S+LSV + VKK+L CD D ++   V+EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1464 KPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWG 1523
            + E+  +S +  R YAPY   +    D  +    E  P  L+R D+I+L+L   L  YW 
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWS 1045

Query: 1524 SRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQA 1583
             R   L VV +YEK+Y +++ KL+K++ A+  L+ES  L+N   +I+ +GN+MN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1584 QGFKLSTLQRLTFIKDTNN-SMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQL 1642
             G K+S+L +L FIK ++N +++FL+Y+E++IR  YP    F+ +L+ V D+ K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1643 VNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLT 1702
              +C ++   I  +  +V+ G LSD +K +P D VL K       A  K  LLE ++KL+
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1703 IMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVE 1762
              +   LM+ YGED                 +  +K+   +N+  EE +R+YE+ +K++E
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1763 EQQ 1765
            ++Q
Sbjct: 1284 DKQ 1286

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  277 bits (709), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 249/426 (58%), Gaps = 13/426 (3%)

Query: 1350 RPHKKLKQLHWEKIDSTDNSIWG-SGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKR 1408
            +P + LKQ+HWEK++  + ++W    + ++   +L   G+ + +E++F  +E     TK 
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1409 KEDLQKV---TFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKP 1465
            K+  +K    +FL RD++QQFGINLHM+S  S    V K+L+CD + +Q  + +EF ++ 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1466 EITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSR 1525
            ++  V+ +L R + PYSTD+      ED   P KDP +L R D+I+L+L  NL+ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1526 MRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQG 1585
               L  +T+YE++Y + + +L+K+D  +  L+     +++  +I+ +GN+MN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1586 FKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1644
             KLS+L +L F+K + + + +FL+++E+IIR+ YP    F  +L  V D+ K+S++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1645 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIM 1704
            +C +F   I  V  +++ G LSD S+ HP D ++ K    +  A+ K DLL+D+ KL  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1705 EFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQ 1764
            + + LM  +GED                    +K+   +N+  E+ +R+YE+ K M+E +
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1765 QKRAQD 1770
            Q+ A +
Sbjct: 1210 QRTASN 1215

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  275 bits (704), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 147/413 (35%), Positives = 238/413 (57%), Gaps = 29/413 (7%)

Query: 1354 KLKQLHWEKIDSTDNSIWG--------SGKAEKFADDLYEKGVLADLEKAFAAREIKSLA 1405
            KLKQ+HW+KID+   ++W         S K E F       GV  ++E  F         
Sbjct: 771  KLKQIHWDKIDNIKETVWNEHNERISTSTKLETF-------GVFKEIEDLFKVVPATPKT 823

Query: 1406 TKRKEDLQ-----KVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVE 1460
                   Q     K+  LS D++Q FGINLH++S  S  +L+  +L C  + LQ   V+E
Sbjct: 824  ASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIE 883

Query: 1461 FLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQ 1520
            F SK +I  +  +  R +APY T++         K P+KDP  L+RAD+IYL+L  NL  
Sbjct: 884  FFSKDDINHIPQSTQRMFAPYETNYL------TGKTPDKDPAVLERADRIYLELFYNLRS 937

Query: 1521 YWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTS 1580
            YW +R + L V+ +YE++Y ++L KL+++D A  A++ S  L+ +F +I+ +GN+MN+  
Sbjct: 938  YWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN-- 995

Query: 1581 KQAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSI 1639
            KQA G +LS++ +L F K + +N+++F++ +E+IIR  YP  ++F ++LE V D+  + +
Sbjct: 996  KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIV 1055

Query: 1640 EQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEV 1699
            + +  + ++F + I N+ERS+ +G LSDSS+FHP D+ L KT   +  AR+K +LL D+ 
Sbjct: 1056 QHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQS 1115

Query: 1700 KLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEER 1752
             LT+ +FE L+  +GED+                V  +K+A  +N+  EE  R
Sbjct: 1116 TLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREEIRR 1168

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  274 bits (701), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 250/419 (59%), Gaps = 14/419 (3%)

Query: 1353 KKLKQLHWEKIDSTDNSIWGSGKA-EKFADDLYEKGVL---ADLEKAFAAREIKSLATKR 1408
            ++LKQ+HW+KI+    +IW   +     A  L E G+L   +DL K   +   K+  T R
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKA-NTGR 977

Query: 1409 KEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEIT 1468
              +   +  L RD++QQFGINLHM+S+LSV D V K+L CDR  +   SV+EF ++ ++ 
Sbjct: 978  LNEEGPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1469 EVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMRA 1528
             +  +L+  + PYS+D+         K P KD + L+RAD+I+L L  NL  YW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSYWRQRSIC 1091

Query: 1529 LTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL 1588
            L  + +YEK+Y +++ KL++VD A+  ++ S  L++   +I+ +GN+MN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1589 STLQRLTFIKDTNN-SMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCK 1647
            S+LQ+L F+K + + +++FL+ VE+ +R+   +   F+ EL  VLD+  + + Q+  D +
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1648 DFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEFE 1707
            ++ + I  V++S++ G LSDS  FHP D++LIK  P +  A RK  LL+++ KLT+   E
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1708 SLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQK 1766
            +LM+ YGED                 + ++K+A  +N+  EE ER+Y   K++++++ K
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELLQQKTK 1328

 Score = 43.9 bits (102), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 103/213 (48%), Gaps = 12/213 (5%)

Query: 551 EYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNN 610
           +YC  ++  IN +   + +V +++    +L+   I R+   +  L++ ++  +I+ Y + 
Sbjct: 348 DYCLTSLFLINSILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEIDKYKSL 407

Query: 611 KLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEE 670
           + +     ++ +N  F   L   +S  K L  I   T ++  L   +  LF + SK +  
Sbjct: 408 EEE----VIQKTNPEFPQLLN--VSYGKFLTNIIHQT-HQNPLEHCMHQLFETLSKTLVA 460

Query: 671 NQNPSKLSKQLKLMDSLVTNVSVASTADEESNM----NMAIQRLYDAMQTDEVARRAILE 726
                 L K L L  S++  +   S  +E  N+    N+++  L D +Q+DE+A+RA+ E
Sbjct: 461 RTMSDNL-KVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIAKRAMSE 519

Query: 727 SRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQL 759
                K++E +++E  +L +     + G++ +L
Sbjct: 520 LELAQKEIENLESEIRALRKDKEITKGGVLSEL 552

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  270 bits (691), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 144/432 (33%), Positives = 242/432 (56%), Gaps = 31/432 (7%)

Query: 1349 PRP-HKKLKQLHWEKIDSTDNSIWGSG-KAEKFADDLYEKGVLADLEKAFAAREIKSLAT 1406
            P P  K+LKQ+HW+K++   +++W  G + ++    L   G+ + +E  F  +    +A 
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1407 K---------------RKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRD 1451
            K                  +L+K++FLSRD++QQFGINLHM+S LS  + V K+LKCD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1452 FLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIY 1511
             +Q  ++++F  K E+  +  +L   Y PYS    G           K  +DLQRAD+I+
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1512 LQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILA 1571
            L+L +NL  YW  R ++L  +++YE++Y +L+ KL+ +D  +  L  SD  +N+  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1572 VGNFMNDTSKQAQGFKLSTLQRLTFIKD-TNNSMTFLNYVEKIIRLNYPSFNDFLKELEP 1630
            +GN MN   +  +G KL +L +L F++  T+ +M+FL+++EKIIR+ YP    F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1631 VLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARR 1690
            V D+ K+S+E +  +C +F   I N+    + G LS+     P D+++ K    +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1691 KGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEE 1750
            K +LL D+ KLT+++   LM+ YGED                 +  +K+   +N+  EE 
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1751 ERLYEKHKKMVE 1762
            ER+YE+ K ++E
Sbjct: 1277 ERVYEQRKNLLE 1288

 Score = 38.9 bits (89), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 23/108 (21%)

Query: 668 IEENQNP-SKLSKQLKLMDSLV----------TNVS----VASTADEESNMNMAIQRLYD 712
           I ++Q P S+  K LKLM+SL+          TN S    + S  + +S    ++ +L D
Sbjct: 458 ILDSQRPYSESIKLLKLMNSLLFYLIDSFQVPTNPSFDENIESAENADSVFQDSVNKLLD 517

Query: 713 AMQTDEVARRAILESRTLTKKLEEI--------QAERDSLSEKLGKAE 752
           ++Q+DE+ARRA+ E   L KK+  +           +D L +KL ++E
Sbjct: 518 SLQSDEIARRAVTEIDDLNKKISHLNEKLDLVENCSKDHLIKKLDESE 565

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  269 bits (688), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 250/421 (59%), Gaps = 14/421 (3%)

Query: 1353 KKLKQLHWEKIDSTDNSIW--GSGKAEKFADDLYEKGVLADLEKAFAAREI---KSLATK 1407
            KKLKQ+HW+KI++  N++W    G+ +   + L   G+   ++  F+ +++      A  
Sbjct: 857  KKLKQIHWDKIENVKNTLWDHADGRQDTILE-LEHAGIFEKVQGMFSVQDLVVKPKRAVN 915

Query: 1408 RKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEI 1467
             +E  + ++FLSRD SQQ  INLH+++ L+  ++++K+L CD D +Q  SV+EF  K E+
Sbjct: 916  VRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKDEM 975

Query: 1468 TEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMR 1527
              +     R++ PYS D+     L  ++ P K+P++L+RAD+++L L  NL +YW  R +
Sbjct: 976  VNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYWAERSQ 1030

Query: 1528 ALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFK 1587
             L V+++YE+EY ++L  L+K+D A+  ++ S+  +    +I+ +GN+MN  +K  +G +
Sbjct: 1031 CLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEGIR 1088

Query: 1588 LSTLQRLTFIKDTNN-SMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDC 1646
            L++L +L FIK  +N + +FL++VEK++R++YP    F+ +L  V D+ K++I+Q+   C
Sbjct: 1089 LNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQLQC 1148

Query: 1647 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEF 1706
            +++   I  +  SV  G LSD ++ HP D++L K    +  A+ K +LL+ + KLT  +F
Sbjct: 1149 EEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNNDF 1208

Query: 1707 ESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQK 1766
               M  YGED                  + +++   +N+  EE +R YE+ KK+ E + K
Sbjct: 1209 RKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIAELRNK 1268

Query: 1767 R 1767
            +
Sbjct: 1269 K 1269

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  268 bits (686), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 143/431 (33%), Positives = 241/431 (55%), Gaps = 30/431 (6%)

Query: 1349 PRPHKKLKQLHWEKIDSTDNSIWGSG-KAEKFADDLYEKGVLADLEKAFAAREIKSLATK 1407
            P P ++LKQ+HW++++   +++W    + ++   +L   GV + +E  F  R    +A+K
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1408 RK---------------EDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDF 1452
                              +L+KV+FLSRD++QQFGINLHM+S LS  + V K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1453 LQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYL 1512
            +Q  ++++F  K E+T +  +L   Y PYS   EG           K  +DLQRAD+I+L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1513 QLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAV 1572
            +L +NL  YW  R + L  +++YE++Y +LL KL+K+D  +  L  S   +N+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1573 GNFMNDTSKQAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPV 1631
            GN MN   K  +G KL +L +L F++ + + +M+FL+++EKIIR+ YP    F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1632 LDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRK 1691
             D+ K+S+E +  +C +F   I N+    + G LS      P D+++ K    +  A+ K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1692 GDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEE 1751
             +LL  + KLT+++   LM+ YGED                 +  +K+   +N+  EE E
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1752 RLYEKHKKMVE 1762
            R+YE+ K ++E
Sbjct: 1278 RVYEQRKSLLE 1288

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  268 bits (686), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 150/419 (35%), Positives = 248/419 (59%), Gaps = 16/419 (3%)

Query: 1354 KLKQLHWEKIDSTDNSIWGS-GKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRKEDL 1412
            KLKQ+HW+K++    +IW   G+ +  A  L   G L ++ + F  R  +SL  K K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1413 Q----KVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEIT 1468
                 KV+ L RD++QQFGINLHM+S+LSV + V K+L CDRD +   SV+EF ++ +++
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1469 EVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMRA 1528
             +  ++A    PY+TD +        + P  D   L+RAD+I+L+L  NL  YW  R   
Sbjct: 1038 IIPRSIASKLEPYATDHQ------PNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1529 LTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL 1588
            L  +++YEK+Y +L+ KL++VD A+  ++ S  L++   +I+ +GN+MN   KQA G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1589 STLQRLTFIKDTNN-SMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCK 1647
            S+LQ+LTF+K + + +M+ L+ VE+ +R+   S   F+++L  VLD+  + + Q+  D  
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1648 DFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEFE 1707
            +++Q I  V++S+E G LS    FHP D++LIK  P +  A RK  LL ++  LT+   E
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1708 SLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQK 1766
            +LM+ YGED                 V+++K+   +N   E  ER+Y + K++++ + K
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSK 1328

 Score = 38.1 bits (87), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 17/82 (20%)

Query: 700 ESNMNMAIQRLYDAMQTDEVARRAILESRT-------LTKKLEEIQAERD-------SLS 745
           ES +++++ +L D +Q+DE+A RA+ E +T       L  +++ +Q ER        S  
Sbjct: 493 ESVISVSLNQLVDNLQSDEIAERAMSELKTAQNSIDQLNSEIQILQKERSVSKGSILSEL 552

Query: 746 EKLGK---AEHGLVGQLENELH 764
           EK+ K   A+  L+G+LE ELH
Sbjct: 553 EKIKKELFAKESLIGKLEKELH 574

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  266 bits (681), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 239/419 (57%), Gaps = 14/419 (3%)

Query: 1350 RPHKKLKQLHWEKIDSTDNSIWGSG-KAEKFADDLYEKGVLADLEKAFAAREIKSLATKR 1408
            +P + LKQ+HWEKID  + ++W    + E+   +L   G+   ++  F  +       K 
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1409 KEDLQKVT----FLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464
                +K T    FLSRD++QQFGINLHMYS   V + V K+L+CD D LQ  SV+EF + 
Sbjct: 908  DNSTKKTTQLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFNN 967

Query: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524
             E+T +  +L+R++APYS D+      ++ K P  DPN+L+R D+I+L+L  NL  YW  
Sbjct: 968  EELTNIPASLSRSFAPYSADF------QENKSPTVDPNELERPDRIFLELCYNLRSYWRE 1021

Query: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584
            R + L +  +YE++Y +L+ KL+ +D A+  ++ +  L+ +  +I+ +GN+MN   K   
Sbjct: 1022 RSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNVS 1079

Query: 1585 GFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLV 1643
            G +L++L +L+F+K + +N+++FL+++EK++R+ YP    F  +L     +  +S + + 
Sbjct: 1080 GIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHIQ 1139

Query: 1644 NDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTI 1703
            ++C+++   + +V R    G LS  S  HP D+++ K    +  A+ K  LL D+ KL  
Sbjct: 1140 SECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLIS 1199

Query: 1704 MEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVE 1762
             + + LM+ +GE+                    +K+   +N+  EE  R+YE+ KK+++
Sbjct: 1200 ADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLLD 1258

 Score = 34.3 bits (77), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 98/205 (47%), Gaps = 17/205 (8%)

Query: 550 LEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVID-QIELYD 608
           +++   T+  IN +     +  +++ L  +L+  GI R    +K    +++ID QIE+Y 
Sbjct: 387 IDFASTTLFLINSILQALTDKQRKLQLVKRLKENGIHRCFYLMKDNLKNEIIDEQIEIYI 446

Query: 609 NNK---LDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLF-LSS 664
           N +   +  F  K   ++  +   L+   S++ N     K T  E+   +L+Q +  +  
Sbjct: 447 NTEHVLIAQFADKPSLADLFYGNALE---SIVAN----TKNTSLEQPFGTLIQSISEMLK 499

Query: 665 SKLIEENQNPSKLSKQLKLM-DSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRA 723
           SK   E+    K+ K L +M   L +N+      D ES    +I  L D +++DE+A+RA
Sbjct: 500 SKTTSES---VKVLKALIIMFQFLESNLYNNMEFDPESVFQDSINTLVDNLESDEIAKRA 556

Query: 724 ILESRTLTKKLEEIQAERDSLSEKL 748
           + E   L   +  +Q E+  L EKL
Sbjct: 557 MGEINFLQDAVRSLQEEKGQL-EKL 580

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  264 bits (674), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 140/421 (33%), Positives = 241/421 (57%), Gaps = 14/421 (3%)

Query: 1353 KKLKQLHWEKIDSTDNSIWGSGKAEK-FADDLYEKGVLADLEKAFAAREI----KSLATK 1407
            KKLKQ+HW +++    +IW     ++    +L   GV   ++ +F  +++     +   K
Sbjct: 1141 KKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTDEAK 1200

Query: 1408 RKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEI 1467
             K+  Q  +FLSRD++QQFGINLH+++S  V++L++K+L+CD D  +  +++EF +K E 
Sbjct: 1201 TKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNKEEF 1260

Query: 1468 TEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMR 1527
            T +S ++ARNYAPY  D++            KD ++L+RAD+I+L+L  NL  YW  R +
Sbjct: 1261 THISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAYWAERSQ 1314

Query: 1528 ALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFK 1587
             L ++ +YEK+Y +L+ KL+++D AV  L  S   +    ++L +GNFMN   K A+G  
Sbjct: 1315 CLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPAEGIL 1372

Query: 1588 LSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDC 1646
            +S+L +L FIK + NN+++FL+++EK IR  +P    F+ +L  V ++  VS++ +  +C
Sbjct: 1373 ISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHITMEC 1432

Query: 1647 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEF 1706
            K+F   +     +V  G LS     HP D++L K    + +A+ K + L D+  LT    
Sbjct: 1433 KEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTNHSI 1492

Query: 1707 ESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQK 1766
              +++ YGED                    +K+   +N+  EE ERLYE+ K M++ + +
Sbjct: 1493 VKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYMLDNKLQ 1552

Query: 1767 R 1767
            +
Sbjct: 1553 K 1553

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  259 bits (662), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 146/490 (29%), Positives = 267/490 (54%), Gaps = 42/490 (8%)

Query: 1347 KYPRPHKKLKQLHWEKIDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAAREIKSLA 1405
            K P   K+LKQ+HW+K++   +++W  + + ++   +L   G+ + +E  F  +    +A
Sbjct: 870  KPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIA 929

Query: 1406 TKRK---------------EDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDR 1450
             KR                 +L+K++FLSRD++QQFGINLHM+S LS  + V K+L CD 
Sbjct: 930  NKRNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDN 989

Query: 1451 DFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQI 1510
            D +Q  ++++F  K E+  +  ++   Y PYS   +G           K  +DLQRAD+I
Sbjct: 990  DIVQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRI 1038

Query: 1511 YLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVIL 1570
            +L+L +NL  YW +R ++L  +++YE++Y +L+ KL+K+D A+  L  S   +++  +I 
Sbjct: 1039 FLELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIIT 1098

Query: 1571 AVGNFMNDTSKQAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629
             +GN MN   +  +G KL +L +L F++ + + +++FL+++EK+IR+ YP    F+ +L+
Sbjct: 1099 EIGNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLK 1156

Query: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689
             + D+ K+S+E + ++C +F + I ++    ++G LS      P D+++ K    +  A+
Sbjct: 1157 NIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAK 1216

Query: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEE 1749
             K +LL  + KLT+++   LM+ YGED                 +  +K+   +N+  EE
Sbjct: 1217 TKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEE 1276

Query: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPA 1809
             ER+YE+ K +++ +    +      E+             +R AV D L+ +L+     
Sbjct: 1277 MERVYEQRKSLLDMRTSSNKKSNGSDENDG--------EKVNRDAV-DLLISKLRE---V 1324

Query: 1810 KSDPSSARKR 1819
            K DP   R+R
Sbjct: 1325 KKDPEPLRRR 1334

 Score = 42.0 bits (97), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 75/155 (48%), Gaps = 35/155 (22%)

Query: 632 DPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLV--- 688
           +PL L   L    K +  E  +  ++Q L+    K+++  +  S+  K LKL++SL+   
Sbjct: 427 EPLCLENCLLLKAKDSPVEAPINEIIQSLW----KILDSQKPYSESIKLLKLINSLLFYL 482

Query: 689 -------TNVSVASTADEESNMNMAIQ----RLYDAMQTDEVARRAILESRTLTKKLEEI 737
                  TN S   T +   N++   Q    +L D++Q+DE+ARRA+ E       ++++
Sbjct: 483 IDSFQVSTNPSFDETLESAENVDYVFQDSVNKLLDSLQSDEIARRAVTE-------IDDL 535

Query: 738 QAERDSLSEKLGKAEHGLVGQLENELHGRDRILAK 772
            A+   L+EKL   E+          H +D ++AK
Sbjct: 536 NAKISHLNEKLNLVEN----------HDKDHLIAK 560

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  259 bits (662), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 147/473 (31%), Positives = 257/473 (54%), Gaps = 27/473 (5%)

Query: 1351 PHKKLKQLHWEKIDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAARE--IKSLATK 1407
            P K +KQ+HWEK+  T  S+W    +      +L   G+ +++E  F +++  IK    K
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1408 RKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEI 1467
             +   + +T L R+++QQFGINLHM+S +S  DL +K+L+CD    Q  SV+EF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1468 TEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMR 1527
            T +  N+ R + PYS D++          P KD ++L R D I+L L  NL  YW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKT-----PGSKPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1528 ALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFK 1587
             L ++ +YEK+Y +L+ KL ++D A+ A++ S  L++V  +I+A+GNFMN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1588 LSTLQRLTFIKDTNNS-MTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDC 1646
            LS+L +LT+IK  + S  +FL+++E++IR+ YP    F  +L  V ++  V+++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1647 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEF 1706
             D S  I  V RS++ G LS+    HP D +L K    +  A  K  +L+D+  LT ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1707 ESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQK 1766
            E L+  +GED                 +  +++   +N+  EE +R+YE+ +++++ + +
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDSKIQ 1378

Query: 1767 RAQDKEKHREHSALPXXXXXXXXXDRRAVMDKLLEQLKNAGPAKSDPSSARKR 1819
               D                    D++  +D+LL++L+        P++A +R
Sbjct: 1379 AQWDSS------------MDEIEEDQQDAVDQLLKKLRGV----EQPTTAVRR 1415

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  254 bits (648), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 137/417 (32%), Positives = 238/417 (57%), Gaps = 27/417 (6%)

Query: 1354 KLKQLHWEKIDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAAREIK------SLAT 1406
            +LKQ+HWEK++  ++++W  S + E+ A +L   G+   +   F  + IK      + A+
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1407 KRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPE 1466
            K+    Q  T L R+++QQFGINLHM+SSL   + V+K+L+C+ D +   SV+EF +K E
Sbjct: 912  KK----QNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1467 ITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRM 1526
            +T +  +L + + PY+   E I          K   +L+RAD+I+ +L   L  YW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---ENI----------KSKFELERADRIFFELCFQLHSYWRERS 1014

Query: 1527 RALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGF 1586
              L ++ +YEK+Y +L+ KL+KVD  +  L  S   R+   +I+ +GN+MN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1587 KLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVND 1645
            ++ +L +L F+K + +N+++FL+++EKIIR+ YP    F+ EL  + D+ K+SI+QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1646 CKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIME 1705
             ++F   I  +   +E G LS + +  P D++L KT   +  A+ K +L+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1706 FESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKMVE 1762
            +  +M+ +GED+                +  +K+   +N+  EE ER+YE+ +KM +
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD 1249

 Score = 43.1 bits (100), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 107/224 (47%), Gaps = 22/224 (9%)

Query: 549 ILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYD 608
           I EY    M  IN +       N++  +  KL++  + ++  ++  LD   + +QI  Y 
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 609 NNKLDDFNVKLEASNKAFNVDLKDPLSL--------LKNLWEICKGTDNEKLLVSLVQHL 660
            N   D N++L+  N+       +PLS+        L  L E  K T  E+ + +L+  +
Sbjct: 383 KN---DENIRLKIINE-------NPLSIPDISYGATLMLLIEKSKSTPLEEPIGALLDSV 432

Query: 661 F--LSSSKLIEENQNPSKLSKQLK-LMDSLVTNVSVASTADE-ESNMNMAIQRLYDAMQT 716
              L +    E  +  + +S  L  L+D L + +S A  A+  +  +  +I+RL D +++
Sbjct: 433 LKILDTRTYSESIKLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLES 492

Query: 717 DEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLE 760
           DEVARRA+ E R     ++++  E  +L  +   ++  ++ QLE
Sbjct: 493 DEVARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLE 536

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  249 bits (636), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 130/422 (30%), Positives = 238/422 (56%), Gaps = 26/422 (6%)

Query: 1354 KLKQLHWEKIDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRKEDL 1412
            +LKQ+HW+K++   +++W  + + ++   +L   G+ + +E  F  ++   +A+K+  + 
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1413 -----------QKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEF 1461
                         V+FLSRD++QQFGINLHM+S +S  + VKK+L CD + +   ++++F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1462 LSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQY 1521
              K E+  +  ++   Y PYS    G           K  +DLQRAD+I+L+L +NL  Y
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINLRSY 1049

Query: 1522 WGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSK 1581
            W +R ++L  +++YE++Y +L+ KL+K+D  +  L  S   +++  +I  +GN MN   K
Sbjct: 1050 WNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KK 1107

Query: 1582 QAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIE 1640
              +G KL +L +L F++ + + +++FL+++EK+IR  YP    F+ +L+ + D+ KVS+E
Sbjct: 1108 MVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSLE 1167

Query: 1641 QLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVK 1700
             +  +C++F   +       + G LS+     P D+++ K    +  A+ K DLL D+ K
Sbjct: 1168 HVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQCK 1227

Query: 1701 LTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXVNEYKRAQSQNLAAEEEERLYEKHKKM 1760
            LT+++   LM+ YGED                 +  +K+   +N+  EE ER+YE+ K +
Sbjct: 1228 LTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKNL 1287

Query: 1761 VE 1762
            +E
Sbjct: 1288 LE 1289

 Score = 34.7 bits (78), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 695 STADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGK 750
           +T + +S    +I +L D++Q+D++ARRA++E   L  K+  +  ER SL E   K
Sbjct: 505 NTQNVDSVFQDSIDKLLDSLQSDDIARRAVIEIDDLNCKISTLN-ERISLVENYSK 559

>KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {ON}
            Anc_6.223 YGL064C
          Length = 540

 Score = 39.3 bits (90), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 60/112 (53%), Gaps = 9/112 (8%)

Query: 1349 PRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKR 1408
            PR HK  K+L ++ +DST N   GS K +  A  LY     ++ E     R I  +   +
Sbjct: 324  PRLHKLPKKLDFKIVDSTLNPFKGS-KIKTLAQILYAVA-HSETEPGLEKRTI--VFVNK 379

Query: 1409 KEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVE 1460
            K D++K+    + +  ++G + H++  L+ +D V+K L+  RDFLQ P  +E
Sbjct: 380  KSDVEKIV---QVLKSEYG-HEHVFG-LTGSDTVEKRLETIRDFLQPPKRLE 426

>Ecym_2242 Chr2 (476716..478464) [1749 bp, 582 aa] {ON} similar to
            Ashbya gossypii AFL053W
          Length = 582

 Score = 33.9 bits (76), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 984  FGIDFNVEEFIETPKK------FSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDL 1035
            + ID NV+   + P+         +D  NDA  P L P  YQS + E   I D L+DL
Sbjct: 205  YEIDKNVKTLFDFPRMDAPPILLLLDRYNDALTPLLQPWTYQSMVHEYIGIKDNLVDL 262

>KAFR0E00590 Chr5 complement(127525..129801) [2277 bp, 758 aa] {ON}
            Anc_1.468 YJR042W
          Length = 758

 Score = 33.5 bits (75), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 1601 NNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSV 1660
            N+S  F+NYV K+  +     ND +  ++ +  ++  + EQ   +  + +   V  E  V
Sbjct: 101  NDSPAFINYVSKLFEIYDSMGNDRIYSVQTI-GLINSTFEQNHIETVNLAMEAVVTELEV 159

Query: 1661 EIGNLSDSSKFHPLDKVL 1678
             I +L+D+SK+  +DKVL
Sbjct: 160  YIDSLNDTSKYSNIDKVL 177

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 181,990,981
Number of extensions: 7850344
Number of successful extensions: 32221
Number of sequences better than 10.0: 193
Number of HSP's gapped: 33063
Number of HSP's successfully gapped: 263
Length of query: 1948
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1823
Effective length of database: 39,148,149
Effective search space: 71367075627
Effective search space used: 71367075627
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 74 (33.1 bits)