Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_14.3302.306ON45741816100.0
YNL016W (PUB1)2.306ON4532269971e-131
Skud_14.3122.306ON4592269861e-129
Smik_14.3132.306ON4512269701e-127
TDEL0G023602.306ON4022057506e-95
TBLA0B071702.306ON4702187253e-90
KNAG0A054402.306ON4422267112e-88
ZYRO0A02398g2.306ON4101977082e-88
CAGL0H10604g2.306ON4162196901e-85
NDAI0B034402.306ON4992146918e-85
Kpol_1043.342.306ON4421856772e-83
NCAS0B061402.306ON4432236693e-82
SAKL0E07128g2.306ON4011886629e-82
Ecym_33442.306ON4211836622e-81
KLTH0G10912g2.306ON4361866614e-81
TPHA0C035202.306ON4422216581e-80
Kwal_27.114472.306ON4391866536e-80
AGR390C2.306ON3781826478e-80
KLLA0E08779g2.306ON4752276532e-79
KAFR0J012602.306ON3651856223e-76
NDAI0C061008.229ON5851872132e-17
ZYRO0B11660g8.229ON5871972042e-16
KLLA0C17600g8.229ON5921612024e-16
TBLA0F037808.229ON5771882016e-16
TPHA0B034208.229ON5791902008e-16
Ecym_55628.229ON5802031991e-15
CAGL0E03245g4.61ON4252071961e-15
Ecym_80105.382ON6021781981e-15
SAKL0H17952g8.229ON5891891962e-15
Kpol_1032.498.229ON5801961962e-15
ADR307W5.382ON5661781953e-15
Ecym_62014.61ON4481821943e-15
TDEL0A013508.229ON5882071945e-15
CAGL0L11792g8.229ON5791661919e-15
KNAG0G018108.229ON5961691911e-14
NCAS0A036808.229ON5751601882e-14
KAFR0F031204.61ON4121791854e-14
KAFR0B025008.229ON5822071855e-14
Skud_7.4834.61ON3931821836e-14
KNAG0D032204.61ON3991821828e-14
Suva_7.4504.61ON3911831819e-14
KLLA0F14861g5.382ON5891751831e-13
NCAS0A058904.61ON4151791811e-13
Kwal_56.234868.229ON5871841821e-13
Smik_5.3378.229ON5771821821e-13
AGR122C8.229ON5852031821e-13
YER165W (PAB1)8.229ON5771951821e-13
SAKL0G08118g5.382ON5451711802e-13
Suva_5.2998.229ON5771951803e-13
YGR159C (NSR1)4.61ON4141801783e-13
Skud_5.3048.229ON5771661784e-13
Smik_6.2644.61ON3951821765e-13
AFR107W4.61ON3962151765e-13
TDEL0F029104.61ON4361801765e-13
Kwal_55.201545.382ON5221281766e-13
KAFR0D048305.382ON4061711756e-13
KLTH0G14344g8.229ON5871551767e-13
SAKL0H23562g4.61ON4211801748e-13
TDEL0E024505.382ON4721901741e-12
KLTH0E03520g5.382ON5161711741e-12
NDAI0D028404.61ON4261781731e-12
NCAS0H018105.382ON4431701712e-12
KLLA0C11495g4.61ON4452101694e-12
Skud_8.1475.382ON5131881686e-12
Skud_6.1071.357ON611721687e-12
TBLA0A099206.104ON5941441671e-11
TBLA0H017905.382ON6741851671e-11
CAGL0H02123g5.382ON5551921642e-11
Smik_8.1645.382ON5241931642e-11
TBLA0C043604.61ON4031791622e-11
Skud_2.3456.104ON6641451643e-11
KLTH0D03916g4.61ON5051791623e-11
TPHA0H015205.382ON4941881623e-11
Smik_2.3556.104ON7361451624e-11
TBLA0D049401.357ON665731624e-11
TPHA0K019104.61ON4161781604e-11
Suva_4.4706.104ON6631451624e-11
YBR212W (NGR1)6.104ON6721451624e-11
KNAG0B044405.382ON3971021604e-11
Kwal_0.3701.357ON560721606e-11
Kpol_224.18.797ON2171871537e-11
YHR086W (NAM8)5.382ON5231321598e-11
SAKL0A07370g6.104ON4901451598e-11
ZYRO0G07326g4.61ON468781571e-10
Kpol_530.466.104ON5871441571e-10
NCAS0B072401.357ON610721572e-10
NDAI0B045701.357ON464761562e-10
Kpol_1026.214.61ON4371791552e-10
Suva_15.2805.382ON5411361562e-10
KAFR0G023206.104ON6201451526e-10
Suva_6.951.357ON613721527e-10
ZYRO0A07018g5.382ON5581941517e-10
TDEL0G036706.104ON6171451518e-10
ZYRO0C05060g6.104ON7161451492e-09
NDAI0C018205.382ON4981751463e-09
AAR151W6.104ON4811451463e-09
Ecym_30826.104ON5861451463e-09
KLLA0C05522g6.104ON5401461463e-09
CAGL0K06655g6.104ON8021431456e-09
Kwal_26.7493singletonOFF2221371387e-09
Kwal_14.18516.104ON5351451438e-09
AEL016C1.357ON678721402e-08
ZYRO0G00814g1.357ON654751402e-08
Ecym_27461.357ON681721402e-08
Kpol_1008.231.357ON660721374e-08
Kpol_1075.1a8.229ON264801326e-08
KLTH0H06842g6.104ON5471201357e-08
Smik_7.3341.357ON611721321e-07
SAKL0D09680g1.357ON672721322e-07
YFR023W (PES4)1.357ON611721322e-07
Kwal_27.118328.491ON686831312e-07
KLTH0E14036g8.797ON2091891262e-07
CAGL0M03795g3.49ON5132151303e-07
ADR189W5.536ON269811264e-07
TDEL0D022501.357ON622721285e-07
KAFR0C044101.357ON589721285e-07
NCAS0C023808.491ON702831285e-07
NDAI0E030708.491ON701831285e-07
TBLA0A033005.382ON362751275e-07
Suva_16.2718.491ON686831286e-07
TDEL0H032407.159ON1671141216e-07
YHR015W (MIP6)1.357ON659751276e-07
KNAG0I015901.357ON590721276e-07
KLTH0H12958g1.357ON639731277e-07
TBLA0A078103.49ON4721721268e-07
KLLA0A08338g1.357ON766721278e-07
KAFR0H014508.491ON690831278e-07
TPHA0F028206.104ON6081441268e-07
Suva_8.3708.797ON2131821211e-06
Smik_16.1928.491ON690831251e-06
TDEL0B014608.491ON692831251e-06
KLLA0D11792g8.491ON685831242e-06
Skud_8.671.357ON652721242e-06
Skud_16.2388.491ON680831242e-06
CAGL0H04675g5.536ON274811212e-06
NCAS0A100103.49ON5061721232e-06
SAKL0B06270g8.797ON2091711192e-06
YPL043W (NOP4)8.491ON685831232e-06
KNAG0A022108.491ON682831232e-06
AGL250W8.491ON729831232e-06
CAGL0L12672g8.491ON682831232e-06
TPHA0A022201.357ON713721213e-06
Skud_15.4878.797ON2131821174e-06
TBLA0B080105.76ON939791214e-06
KAFR0C054305.536ON274841175e-06
KLTH0E11418g8.491ON693831205e-06
NCAS0C046003.49ON5811421205e-06
ZYRO0C02574g3.49ON5431721196e-06
Kpol_1018.1221.357ON634721196e-06
TDEL0B010108.797ON2101761156e-06
TPHA0P013103.49ON5181421197e-06
KNAG0C020301.357ON365771187e-06
TDEL0E006003.49ON5471721187e-06
TDEL0A039905.536ON278841168e-06
NDAI0G039703.49ON6071721188e-06
TPHA0D024005.536ON293851159e-06
Suva_15.1981.357ON662721171e-05
KNAG0A013703.49ON5451721171e-05
Kpol_1023.955.536ON274881141e-05
CAGL0J11154g2.80ON380781151e-05
Ecym_20503.49ON5411421162e-05
Ecym_25418.491ON675831162e-05
TBLA0B008102.80ON389781152e-05
Kwal_27.123378.797ON2091741112e-05
CAGL0E01947g3.49ON4521721152e-05
TPHA0F023102.80ON400781152e-05
Kpol_1041.42.80ON384781142e-05
TBLA0J018307.159ON140731072e-05
KLLA0C08019g7.250ON301711123e-05
ADR017W7.159ON1731081083e-05
TBLA0B085903.49ON6231421143e-05
Kpol_1076.113.49ON5261421143e-05
CAGL0I08943g1.357ON602721133e-05
Smik_8.801.357ON670721133e-05
TDEL0G016206.183ON584851133e-05
NDAI0F033202.80ON399781123e-05
ZYRO0F08294g8.491ON714821134e-05
TPHA0C017408.491ON697831134e-05
Kwal_55.219603.49ON5971421124e-05
NDAI0G059701.357ON611721124e-05
Kpol_1002.696.183ON590801124e-05
SAKL0C12672g3.49ON5511421124e-05
Ecym_74208.797ON2041741084e-05
ZYRO0D12782g5.536ON273841104e-05
Ecym_40715.536ON270841095e-05
KAFR0C016803.49ON4791421115e-05
KAFR0B044205.76ON6251961115e-05
KLTH0F18766g3.49ON5881421115e-05
TPHA0B043001.102ON334751105e-05
Kpol_1062.75.76ON760941117e-05
TBLA0B052106.183ON710871117e-05
KLLA0A05346g5.76ON874931117e-05
Smik_4.7035.536ON274841088e-05
Skud_4.7045.536ON274841088e-05
YDR429C (TIF35)5.536ON274841088e-05
KNAG0B036505.536ON279811088e-05
Suva_16.1236.183ON596961108e-05
KAFR0A074902.80ON381781099e-05
Ecym_11211.102ON324751089e-05
KAFR0H031101.408ON441761099e-05
KLTH0H00792g5.76ON835791109e-05
ABL059W8.797ON2041741051e-04
Suva_14.1662.80ON403781081e-04
NDAI0F027202.167ON226721061e-04
Smik_15.303.49ON5361421091e-04
SAKL0F03982g7.165ON110761001e-04
Skud_14.1592.80ON400781081e-04
AEL217W5.76ON8341071091e-04
SAKL0D08558g1.408ON464751081e-04
Skud_16.946.183ON614861091e-04
Suva_2.6055.536ON274841061e-04
YOL123W (HRP1)3.49ON5341421081e-04
Skud_15.303.49ON5391421081e-04
SAKL0H11330g8.491ON697831081e-04
KLLA0C12925g3.49ON5701421081e-04
Suva_15.373.49ON5511421081e-04
NDAI0F01720singletonON474751081e-04
YNL175C (NOP13)2.80ON403781071e-04
KAFR0A009801.357ON642721081e-04
Kwal_33.144632.80ON393781072e-04
KLLA0D13772g7.145ON345821062e-04
KLTH0B06886g2.80ON396781072e-04
Smik_14.1552.80ON403781062e-04
YPL184C (MRN1)6.183ON612861072e-04
ZYRO0F16214g1.102ON330751062e-04
NCAS0H025905.536ON270811052e-04
NCAS0G019502.80ON404781062e-04
SAKL0A05280g6.183ON582811062e-04
KLTH0F02838g1.102ON330751052e-04
Ecym_22336.183ON576811062e-04
ABL134C2.80ON375781052e-04
Kpol_150.17.159ON1381081002e-04
ZYRO0G08140g6.183ON632861062e-04
Kpol_1026.164.66ON277801042e-04
Smik_6.3906.183ON625861062e-04
CAGL0I09900g8.797ON2111811022e-04
TBLA0C056002.167ON215771022e-04
KAFR0B045402.167ON220841023e-04
KLTH0F13442g7.159ON134108993e-04
Kwal_0.250singletonOFF216751023e-04
TPHA0J022106.183ON593811053e-04
Kwal_YGOB_0.2501.408ON226751023e-04
Skud_9.1827.159ON149105993e-04
NCAS0A132207.159ON171761003e-04
Kwal_23.58647.250ON2781271033e-04
Kwal_27.110966.171ON201881013e-04
NCAS0H010406.183ON629811053e-04
Smik_16.575.76ON782791044e-04
CAGL0L03806g2.167ON255771024e-04
NDAI0F022606.183ON680811044e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_14.330
         (457 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   624   0.0  
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   388   e-131
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   384   e-129
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   378   e-127
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   293   6e-95
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   283   3e-90
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   278   2e-88
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   277   2e-88
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   270   1e-85
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   270   8e-85
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   265   2e-83
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   262   3e-82
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   259   9e-82
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   259   2e-81
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   259   4e-81
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   258   1e-80
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   256   6e-80
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   253   8e-80
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   256   2e-79
KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   244   3e-76
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}             87   2e-17
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    83   2e-16
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    82   4e-16
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    82   6e-16
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    82   8e-16
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    81   1e-15
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    80   1e-15
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...    81   1e-15
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    80   2e-15
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...    80   2e-15
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...    80   3e-15
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    79   3e-15
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    79   5e-15
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    78   9e-15
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    78   1e-14
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    77   2e-14
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    76   4e-14
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    76   5e-14
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    75   6e-14
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    75   8e-14
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    74   9e-14
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    75   1e-13
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             74   1e-13
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    75   1e-13
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    75   1e-13
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    75   1e-13
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    75   1e-13
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    74   2e-13
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    74   3e-13
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    73   3e-13
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    73   4e-13
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    72   5e-13
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    72   5e-13
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    72   5e-13
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    72   6e-13
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    72   6e-13
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    72   7e-13
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    72   8e-13
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...    72   1e-12
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    72   1e-12
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    71   1e-12
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     70   2e-12
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    70   4e-12
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    69   6e-12
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    69   7e-12
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    69   1e-11
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    69   1e-11
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    68   2e-11
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    68   2e-11
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    67   2e-11
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    68   3e-11
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    67   3e-11
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    67   3e-11
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    67   4e-11
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    67   4e-11
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    66   4e-11
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    67   4e-11
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    67   4e-11
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    66   4e-11
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    66   6e-11
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    64   7e-11
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    66   8e-11
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    66   8e-11
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    65   1e-10
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    65   1e-10
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    65   2e-10
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    65   2e-10
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    64   2e-10
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    65   2e-10
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    63   6e-10
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    63   7e-10
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    63   7e-10
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    63   8e-10
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    62   2e-09
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    61   3e-09
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    61   3e-09
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    61   3e-09
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    61   3e-09
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    60   6e-09
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    58   7e-09
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    60   8e-09
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    59   2e-08
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    59   2e-08
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    59   2e-08
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    57   4e-08
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    55   6e-08
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    57   7e-08
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    55   1e-07
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    55   2e-07
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    55   2e-07
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    55   2e-07
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    53   2e-07
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    55   3e-07
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    53   4e-07
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    54   5e-07
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    54   5e-07
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    54   5e-07
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    54   5e-07
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    54   5e-07
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    54   6e-07
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    51   6e-07
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    54   6e-07
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    54   6e-07
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    54   7e-07
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    53   8e-07
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    54   8e-07
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    54   8e-07
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    53   8e-07
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    51   1e-06
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    53   1e-06
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    53   1e-06
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    52   2e-06
Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W (...    52   2e-06
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    52   2e-06
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    51   2e-06
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    52   2e-06
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    50   2e-06
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    52   2e-06
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    52   2e-06
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    52   2e-06
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    52   2e-06
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    51   3e-06
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    50   4e-06
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    51   4e-06
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    50   5e-06
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    51   5e-06
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      51   5e-06
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    50   6e-06
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    50   6e-06
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    49   6e-06
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    50   7e-06
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    50   7e-06
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    50   7e-06
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    49   8e-06
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    50   8e-06
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    49   9e-06
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    50   1e-05
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    50   1e-05
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    49   1e-05
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    49   1e-05
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    49   2e-05
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    49   2e-05
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    49   2e-05
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    47   2e-05
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    49   2e-05
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    49   2e-05
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    49   2e-05
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    46   2e-05
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    48   3e-05
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    46   3e-05
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    49   3e-05
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    49   3e-05
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    48   3e-05
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    48   3e-05
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    48   3e-05
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      48   3e-05
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    48   4e-05
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    48   4e-05
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    48   4e-05
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    48   4e-05
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    48   4e-05
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    48   4e-05
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    46   4e-05
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    47   4e-05
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    47   5e-05
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    47   5e-05
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    47   5e-05
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    47   5e-05
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    47   5e-05
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    47   7e-05
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    47   7e-05
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    47   7e-05
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    46   8e-05
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    46   8e-05
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    46   8e-05
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    46   8e-05
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    47   8e-05
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    47   9e-05
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    46   9e-05
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    47   9e-05
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    47   9e-05
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    45   1e-04
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    46   1e-04
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      45   1e-04
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    47   1e-04
SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {O...    43   1e-04
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    46   1e-04
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    47   1e-04
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    46   1e-04
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    47   1e-04
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    45   1e-04
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    46   1e-04
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    46   1e-04
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    46   1e-04
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    46   1e-04
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    46   1e-04
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    46   1e-04
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    46   1e-04
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    46   1e-04
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    46   2e-04
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    45   2e-04
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    46   2e-04
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    45   2e-04
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    46   2e-04
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    45   2e-04
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    45   2e-04
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    45   2e-04
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    45   2e-04
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    45   2e-04
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    45   2e-04
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    45   2e-04
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    43   2e-04
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    45   2e-04
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    45   2e-04
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    45   2e-04
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    44   2e-04
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    44   2e-04
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    44   3e-04
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    43   3e-04
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    44   3e-04
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    45   3e-04
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    44   3e-04
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    43   3e-04
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    43   3e-04
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    44   3e-04
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    44   3e-04
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    45   3e-04
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    45   4e-04
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    44   4e-04
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     45   4e-04
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    44   4e-04
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    45   4e-04
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    44   4e-04
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    44   4e-04
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    44   4e-04
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    44   5e-04
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    44   5e-04
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    44   5e-04
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    43   5e-04
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    44   6e-04
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    44   6e-04
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    42   6e-04
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    44   6e-04
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    44   6e-04
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    44   7e-04
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    42   7e-04
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    44   8e-04
AAR022W Chr1 (381754..382098) [345 bp, 114 aa] {ON} Syntenic hom...    41   8e-04
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    43   8e-04
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    43   9e-04
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    41   9e-04
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    42   9e-04
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    43   0.001
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    44   0.001
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    41   0.001
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    43   0.001
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    43   0.001
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    43   0.001
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    41   0.001
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    43   0.001
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    43   0.001
KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} simila...    43   0.001
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    43   0.001
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    42   0.001
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    43   0.001
ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar...    42   0.001
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    43   0.001
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    42   0.001
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    43   0.001
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    41   0.001
SAKL0G12474g Chr7 complement(1060462..1061016) [555 bp, 184 aa] ...    41   0.002
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     42   0.002
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    42   0.002
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    42   0.002
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    42   0.002
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    41   0.002
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    42   0.002
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       42   0.002
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    42   0.002
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    40   0.002
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    41   0.002
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    41   0.003
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    42   0.003
KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.79...    41   0.003
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    41   0.003
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    42   0.003
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    42   0.003
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    42   0.003
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    41   0.003
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    42   0.003
Ecym_1261 Chr1 complement(536914..537255) [342 bp, 113 aa] {ON} ...    39   0.003
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    41   0.003
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    42   0.003
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     42   0.003
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    41   0.003
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    42   0.004
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    41   0.004
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    41   0.004
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    41   0.004
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    41   0.004
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    42   0.004
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    41   0.004
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    41   0.004
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    42   0.004
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    41   0.004
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    41   0.005
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    41   0.005
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    41   0.005
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    41   0.005
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    41   0.005
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    40   0.005
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    41   0.005
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    41   0.005
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    41   0.005
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    41   0.005
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    40   0.006
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    41   0.006
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    41   0.006
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    41   0.006
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    40   0.006
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    40   0.007
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    40   0.008
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    41   0.008
TDEL0F01800 Chr6 (337313..337972) [660 bp, 219 aa] {ON} Anc_6.17...    40   0.008
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    40   0.008
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    40   0.009
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    40   0.009
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    39   0.009
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    40   0.010
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    40   0.010
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    40   0.010
Smik_14.217 Chr14 complement(397474..398136) [663 bp, 220 aa] {O...    39   0.010
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    40   0.010
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    40   0.010
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    40   0.011
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    39   0.011
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    39   0.011
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    40   0.011
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    39   0.012
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    40   0.012
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    39   0.013
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    40   0.013
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    39   0.013
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    39   0.014
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    39   0.014
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    40   0.014
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    39   0.015
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    39   0.016
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    40   0.016
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    39   0.016
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    39   0.017
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    39   0.019
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    39   0.019
Kpol_479.17 s479 (36215..37738) [1524 bp, 507 aa] {ON} (36215..3...    39   0.019
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    39   0.019
YIR009W Chr9 (374525..374860) [336 bp, 111 aa] {ON}  MSL1U2B com...    37   0.020
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    39   0.020
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    39   0.021
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    39   0.021
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    39   0.021
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    39   0.021
Skud_14.222 Chr14 complement(408018..408680) [663 bp, 220 aa] {O...    38   0.022
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    38   0.024
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    39   0.025
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    38   0.026
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    39   0.027
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    39   0.029
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    39   0.029
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    38   0.032
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    39   0.034
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    39   0.034
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    39   0.035
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    37   0.036
KAFR0G02950 Chr7 complement(614874..615782) [909 bp, 302 aa] {ON...    38   0.037
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    38   0.039
Kpol_1066.35 s1066 complement(57266..58168) [903 bp, 300 aa] {ON...    38   0.040
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    38   0.042
Smik_9.209 Chr9 (350452..350787) [336 bp, 111 aa] {ON} YIR009W (...    36   0.043
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    37   0.045
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    37   0.046
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    38   0.046
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    38   0.047
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    37   0.047
Kwal_33.15208 s33 (1012397..1012957) [561 bp, 186 aa] {ON} YIR00...    37   0.050
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    38   0.053
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    38   0.053
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    38   0.057
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    38   0.063
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    37   0.065
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    37   0.067
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    37   0.067
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    38   0.068
Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947) ...    37   0.069
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    37   0.069
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    37   0.070
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    38   0.070
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    37   0.070
Kpol_365.5 s365 (9615..10148,10369..11028) [1194 bp, 397 aa] {ON...    37   0.074
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    37   0.076
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    37   0.076
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    37   0.077
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    37   0.079
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    37   0.081
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    36   0.083
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    37   0.085
KLTH0F13816g Chr6 (1135521..1135895) [375 bp, 124 aa] {ON} simil...    35   0.085
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    37   0.089
KNAG0B02500 Chr2 complement(487615..489711) [2097 bp, 698 aa] {O...    37   0.089
CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {...    37   0.090
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    37   0.10 
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    37   0.11 
NCAS0D03580 Chr4 complement(665299..666036) [738 bp, 245 aa] {ON...    36   0.12 
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    36   0.13 
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    35   0.13 
NDAI0I01310 Chr9 (316912..317745) [834 bp, 277 aa] {ON} Anc_6.17...    36   0.13 
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    36   0.13 
Smik_8.17 Chr8 (40206..42356) [2151 bp, 716 aa] {ON} YHL024W (REAL)    37   0.13 
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    37   0.13 
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    37   0.13 
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    36   0.14 
CAGL0J02200g Chr10 complement(217645..218079) [435 bp, 144 aa] {...    35   0.14 
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    36   0.15 
YHL024W Chr8 (56649..58790) [2142 bp, 713 aa] {ON}  RIM4Putative...    37   0.15 
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    37   0.15 
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    36   0.16 
ADR001C Chr4 complement(708435..709409) [975 bp, 324 aa] {ON} Sy...    36   0.16 
CAGL0F08217g Chr6 complement(814508..816544) [2037 bp, 678 aa] {...    36   0.16 
KLLA0B11594g Chr2 complement(1018044..1018388) [345 bp, 114 aa] ...    34   0.16 
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    36   0.17 
KAFR0L01600 Chr12 (289758..291470) [1713 bp, 570 aa] {ON} Anc_7....    36   0.17 
Suva_8.27 Chr8 (58726..60849) [2124 bp, 707 aa] {ON} YHL024W (REAL)    36   0.18 
KLTH0D12540g Chr4 complement(1025489..1026407,1026476..1026555) ...    36   0.21 
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    36   0.23 
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    36   0.23 
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    35   0.24 
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    35   0.25 
Kwal_55.20718 s55 (528743..530527) [1785 bp, 594 aa] {ON} YHL024...    36   0.25 
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    35   0.26 
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    35   0.26 
KNAG0B01400 Chr2 complement(261331..262335) [1005 bp, 334 aa] {O...    35   0.27 
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    35   0.28 
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    36   0.28 
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    35   0.29 
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      35   0.29 
KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2...    35   0.30 
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    35   0.31 
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...    35   0.32 
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    35   0.33 
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    35   0.33 
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    35   0.35 
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    35   0.35 
ZYRO0B02860g Chr2 (229241..231307) [2067 bp, 688 aa] {ON} weakly...    35   0.36 
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...    35   0.36 
KLLA0B10472g Chr2 complement(914512..915108) [597 bp, 198 aa] {O...    34   0.37 
TBLA0E01200 Chr5 complement(265315..266220) [906 bp, 301 aa] {ON...    35   0.38 
Kwal_55.20414 s55 (388156..389010) [855 bp, 284 aa] {ON} YFR032C...    35   0.38 
TPHA0C04450 Chr3 complement(964539..965540) [1002 bp, 333 aa] {O...    35   0.39 
Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)...    35   0.42 
NCAS0A14270 Chr1 (2808773..2810638) [1866 bp, 621 aa] {ON} Anc_7...    35   0.48 
SAKL0F11924g Chr6 (925625..927466) [1842 bp, 613 aa] {ON} some s...    35   0.49 
KLLA0B00847g Chr2 complement(65983..66792) [810 bp, 269 aa] {ON}...    34   0.49 
ZYRO0D15686g Chr4 complement(1313019..1314032) [1014 bp, 337 aa]...    34   0.52 
TPHA0E01030 Chr5 complement(211573..213444) [1872 bp, 623 aa] {O...    35   0.56 
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    35   0.56 
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    34   0.58 
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    35   0.59 
TBLA0A01040 Chr1 complement(235996..236433) [438 bp, 145 aa] {ON...    33   0.60 
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    34   0.63 
CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {...    34   0.71 
TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] ...    35   0.72 
Smik_6.375 Chr6 complement(611206..611835) [630 bp, 209 aa] {ON}...    33   0.75 
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    34   0.77 
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    34   0.78 
KAFR0F00290 Chr6 complement(71809..73851) [2043 bp, 680 aa] {ON}...    34   0.79 
Suva_2.67 Chr2 complement(120476..122566) [2091 bp, 696 aa] {ON}...    34   0.79 
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    33   0.81 
YNL197C Chr14 complement(267608..269593) [1986 bp, 661 aa] {ON} ...    34   0.94 
Smik_14.133 Chr14 complement(246884..248896) [2013 bp, 670 aa] {...    34   0.96 
Suva_14.144 Chr14 complement(262668..263831,264585..265394) [197...    34   0.96 
Skud_14.137 Chr14 complement(256539..258545) [2007 bp, 668 aa] {...    34   1.0  
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    33   1.1  
NCAS0D00290 Chr4 complement(39189..41069) [1881 bp, 626 aa] {ON}...    33   1.1  
Suva_16.131 Chr16 (221470..222099) [630 bp, 209 aa] {ON} YPL178W...    33   1.1  
TDEL0E00830 Chr5 (169821..170693) [873 bp, 290 aa] {ON} Anc_3.74...    33   1.1  
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...    34   1.2  
Smik_2.64 Chr2 complement(116553..118580) [2028 bp, 675 aa] {ON}...    33   1.2  
YPL178W Chr16 (212158..212784) [627 bp, 208 aa] {ON}  CBC2Small ...    33   1.2  
TDEL0C01770 Chr3 complement(309215..311113) [1899 bp, 632 aa] {O...    33   1.4  
KLTH0B04950g Chr2 (405537..407279) [1743 bp, 580 aa] {ON} some s...    33   1.5  
KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.82...    33   1.6  
Smik_13.481 Chr13 complement(785925..787286) [1362 bp, 453 aa] {...    33   1.7  
Kpol_311.2 s311 (3859..4536) [678 bp, 225 aa] {ON} (3859..4536) ...    32   1.9  
TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON...    32   1.9  
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    33   1.9  
Kpol_322.1 s322 complement(711..974) [264 bp, 87 aa] {ON} comple...    30   2.0  
SAKL0D01958g Chr4 (151411..154248) [2838 bp, 945 aa] {ON} some s...    33   2.1  
YMR268C Chr13 complement(802888..804222) [1335 bp, 444 aa] {ON} ...    33   2.1  
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    33   2.3  
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    32   2.3  
NDAI0A01780 Chr1 complement(395250..397340) [2091 bp, 696 aa] {O...    33   2.4  
Skud_2.52 Chr2 complement(106486..108513) [2028 bp, 675 aa] {ON}...    33   2.4  
NDAI0K00510 Chr11 (114005..115363) [1359 bp, 452 aa] {ON} Anc_8....    32   2.7  
TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.8...    32   2.7  
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    32   2.8  
Skud_4.30 Chr4 complement(50997..52952) [1956 bp, 651 aa] {ON} Y...    32   2.9  
Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON} Y...    32   2.9  
TPHA0H00860 Chr8 (176257..178023) [1767 bp, 588 aa] {ON} Anc_2.5...    32   3.1  
NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.5...    32   3.1  
YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}  WH...    32   3.3  
TBLA0A07650 Chr1 (1894958..1897168) [2211 bp, 736 aa] {ON} Anc_7...    32   3.4  
TPHA0F00350 Chr6 (75008..77479) [2472 bp, 823 aa] {ON} Anc_4.33 ...    32   3.6  
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    32   3.6  
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    32   3.6  
Kpol_478.5 s478 (22217..24601) [2385 bp, 794 aa] {ON} (22217..24...    32   3.7  
Suva_2.607 Chr2 (1081506..1082435) [930 bp, 309 aa] {ON} YDR432W...    32   3.8  
YBL051C Chr2 complement(122753..124759) [2007 bp, 668 aa] {ON}  ...    32   4.0  
Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON} Y...    32   4.0  
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    32   4.0  
Kpol_1030.41 s1030 complement(91357..93168) [1812 bp, 603 aa] {O...    32   4.0  
ACR235W Chr3 (771971..773707) [1737 bp, 578 aa] {ON} Syntenic ho...    32   4.2  
Kpol_1063.18 s1063 (40779..41780) [1002 bp, 333 aa] {ON} (40779....    31   4.8  
Kpol_1054.28 s1054 (68326..70377) [2052 bp, 683 aa] {ON} (68326....    32   5.1  
ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some s...    32   5.8  
Kwal_47.18572 s47 complement(878877..879968) [1092 bp, 363 aa] {...    31   6.2  
KAFR0K01170 Chr11 complement(242500..242925) [426 bp, 141 aa] {O...    30   7.9  
KLLA0F19558g Chr6 complement(1811729..1812886) [1158 bp, 385 aa]...    30   9.2  
Kwal_33.14810 s33 complement(824910..826634) [1725 bp, 574 aa] {...    31   9.3  

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/418 (75%), Positives = 317/418 (75%)

Query: 18  PVAAETPLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRV 77
           PVAAETPLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRV
Sbjct: 18  PVAAETPLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRV 77

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYVGNLDKAITEDILKQYFQVGGPIA              YAFVEYHQSHDANIALQTLN
Sbjct: 78  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 137

Query: 138 GKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 197
           GKQIENNVVKINWAF       DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD
Sbjct: 138 GKQIENNVVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 197

Query: 198 MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRDXXXXXXXXXXXXXX 257
           MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD              
Sbjct: 198 MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRDNNNTNNYPQRRNYG 257

Query: 258 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMPLXXXXXXXXX 317
                                                          AMPL         
Sbjct: 258 NNNRGGFRQYNNNNNNNNMNMGMNMGMNMNMSSNRGMPPSSMGMPMGAMPLPSQGQPQQS 317

Query: 318 XTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPE 377
            TIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPE
Sbjct: 318 QTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPE 377

Query: 378 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPXXXXXXXXXPLIMN 435
           KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP         PLIMN
Sbjct: 378 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPQQQQQQGGQPLIMN 435

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  388 bits (997), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 195/226 (86%)

Query: 18  PVAAETPLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRV 77
           PVA ETP   E P SADPS+EQ+V+ EGNSEQ +D QGENDPSVVPANAITGGRETSDRV
Sbjct: 17  PVAVETPSAVEAPASADPSSEQSVAVEGNSEQAEDNQGENDPSVVPANAITGGRETSDRV 76

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYVGNLDKAITEDILKQYFQVGGPIA              YAFVEYHQSHDANIALQTLN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 138 GKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 197
           GKQIENN+VKINWAF       DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD
Sbjct: 137 GKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 196

Query: 198 MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           MQTGSSRGYGFVSFTSQDDAQ AMDSMQGQDLNGRPLRINWAAKRD
Sbjct: 197 MQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242

 Score =  236 bits (603), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 112/131 (85%), Gaps = 1/131 (0%)

Query: 305 AMPLXXXXXXXXXXTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ 364
           AMPL          TIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ
Sbjct: 303 AMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ 362

Query: 365 NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPXXX 424
           NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP   
Sbjct: 363 NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP-QQ 421

Query: 425 XXXXXXPLIMN 435
                 PLIMN
Sbjct: 422 QQQGGQPLIMN 432

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  384 bits (986), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 189/226 (83%), Positives = 194/226 (85%)

Query: 18  PVAAETPLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRV 77
           PVA E PLV E     DPSAEQNVS E NS QV+D+QGE+DPSVVPANAITGGRETSDRV
Sbjct: 17  PVAVEAPLVAEASAPVDPSAEQNVSGEVNSTQVEDDQGESDPSVVPANAITGGRETSDRV 76

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYVGNLDKAITEDILKQYFQVGGPIA              YAFVEYHQSHDANIALQTLN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 138 GKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 197
           GKQIENN+VKINWAF       DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD
Sbjct: 137 GKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 196

Query: 198 MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           MQTGSSRGYGFVSFTSQDDAQTAMD+MQGQDLNGRPLRINWAAKRD
Sbjct: 197 MQTGSSRGYGFVSFTSQDDAQTAMDTMQGQDLNGRPLRINWAAKRD 242

 Score =  240 bits (613), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 112/131 (85%)

Query: 305 AMPLXXXXXXXXXXTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ 364
           AMPL          TIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ
Sbjct: 309 AMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ 368

Query: 365 NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPXXX 424
           NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP   
Sbjct: 369 NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPQQQ 428

Query: 425 XXXXXXPLIMN 435
                 PLIMN
Sbjct: 429 QQQGGQPLIMN 439

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  378 bits (970), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/226 (82%), Positives = 193/226 (85%)

Query: 18  PVAAETPLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRV 77
           PVA ETP V E  ++AD  + Q VS E NSEQV+D QGENDPSVVPANAITGGRETSD+V
Sbjct: 15  PVAVETPSVVETSSAADHPSVQAVSGESNSEQVEDNQGENDPSVVPANAITGGRETSDKV 74

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYVGNLDKAITEDILKQYFQVGGPIA              YAFVEYHQSHDANIALQTLN
Sbjct: 75  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 134

Query: 138 GKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 197
           GKQIENN+VKINWAF       DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD
Sbjct: 135 GKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 194

Query: 198 MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD
Sbjct: 195 MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 240

 Score =  240 bits (612), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 112/131 (85%)

Query: 305 AMPLXXXXXXXXXXTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ 364
           AMPL          TIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ
Sbjct: 303 AMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQ 362

Query: 365 NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPXXX 424
           NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP   
Sbjct: 363 NFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPQQQ 422

Query: 425 XXXXXXPLIMN 435
                 PLIMN
Sbjct: 423 QQQGGQPLIMN 433

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  293 bits (750), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 162/205 (79%), Gaps = 3/205 (1%)

Query: 38  EQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ 97
           EQN + E  SE    E    +PSVVPANAI GGRETSD+VLYVGNLD +I E+ILKQYFQ
Sbjct: 8   EQNPTVE--SEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQ 65

Query: 98  VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXX 157
           VGGPIA              YAFVEY QSHDANIALQTLNGKQIENNVVKINWAF     
Sbjct: 66  VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQV 125

Query: 158 XXDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDD 216
             D+ TFNLFVGDLNV+VDDETLRNAFK+FP+YL GHVMWDMQTG SRGYGFVSF SQ++
Sbjct: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185

Query: 217 AQTAMDSMQGQDLNGRPLRINWAAK 241
           AQ AMD+MQG +LNGRPLRINWA+K
Sbjct: 186 AQKAMDAMQGHELNGRPLRINWASK 210

 Score =  202 bits (514), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 95/100 (95%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           +PP VNPQAVD +IR APPRVTTAYIGNIPHFA EADLIPL QNFGFI+DFKHYPEKGCC
Sbjct: 272 VPPPVNPQAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCC 331

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER++F+P
Sbjct: 332 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  283 bits (725), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 160/218 (73%)

Query: 26  VTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDK 85
            T   T++     +   +E +SEQ  D   E   +VVPANAI GGRETSD++LYVGNLDK
Sbjct: 33  TTTAETASSNMTTEQTPAESSSEQTGDNDTEESANVVPANAIRGGRETSDKILYVGNLDK 92

Query: 86  AITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNV 145
           +I ED LKQYFQVGGPIA              YAFVEY + HDAN+ALQTLNGK IE  +
Sbjct: 93  SINEDSLKQYFQVGGPIANVKIIVDKNNKYCNYAFVEYLKHHDANVALQTLNGKHIEKKI 152

Query: 146 VKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRG 205
           VKINWAF       DDTFNLF+GDLN++V+DE+L  AFKDFPS++  HVMWDMQTG SRG
Sbjct: 153 VKINWAFQSQQSSNDDTFNLFIGDLNIDVNDESLTAAFKDFPSFVQAHVMWDMQTGRSRG 212

Query: 206 YGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           YGF SF++Q+DAQ AMD MQG++LNGRP+RINWA+KRD
Sbjct: 213 YGFASFSTQNDAQLAMDQMQGKELNGRPIRINWASKRD 250

 Score =  175 bits (443), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 76/91 (83%), Positives = 83/91 (91%)

Query: 330 AVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHE 389
           AV+ +IR APPRVTTAYIGN+P FATEADLIPL QNFGFILDFKHYP++G CFIKYDTHE
Sbjct: 326 AVEDMIRRAPPRVTTAYIGNLPRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHE 385

Query: 390 QAAVCIVALANFPFQGRNLRTGWGKERSNFM 420
           QAAVCIVALANFP QGRNL+TGWGKE+  FM
Sbjct: 386 QAAVCIVALANFPLQGRNLKTGWGKEKPTFM 416

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  278 bits (711), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 166/226 (73%), Gaps = 4/226 (1%)

Query: 21  AETPLVTEV--PTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVL 78
           +E+P+ T    P+S +PS +Q  +SE +    ++E+   +P VVPANA  GGRETSDRVL
Sbjct: 23  SESPVTTAATAPSSIEPSQKQ-AASEADVVPEENEEANKEPPVVPANATHGGRETSDRVL 81

Query: 79  YVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNG 138
           YVGNLDK+ITEDILKQYFQV G I               YAFVEY ++HDA++ALQTLNG
Sbjct: 82  YVGNLDKSITEDILKQYFQVAGQIVDVKVMIDKKSNYVNYAFVEYAKAHDASVALQTLNG 141

Query: 139 KQIENNVVKINWAFXXXXXXXDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD 197
            QIENN VKIN AF       DD TFNLFVGDLN+++DD+TL  +FKDFPSY+  HVMWD
Sbjct: 142 IQIENNKVKINRAFQSQQSTTDDSTFNLFVGDLNIDIDDDTLSRSFKDFPSYIQAHVMWD 201

Query: 198 MQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           MQTG SRGYGFVSF  Q+ AQ AM+ MQG++LNGRP+RINWA KRD
Sbjct: 202 MQTGRSRGYGFVSFADQEQAQKAMEEMQGKELNGRPIRINWATKRD 247

 Score =  194 bits (492), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 91/100 (91%)

Query: 320 IGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKG 379
           +G  P VNPQAVD +IR APPRV+TAYIGNIPHFATEADLIPL Q+FGFILDF HYPEKG
Sbjct: 316 MGALPPVNPQAVDDMIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKG 375

Query: 380 CCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNF 419
           CCFIKYDTHEQAAVCIVALANF FQGRNLRTGWGKER+ F
Sbjct: 376 CCFIKYDTHEQAAVCIVALANFNFQGRNLRTGWGKERNTF 415

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  277 bits (708), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 156/197 (79%), Gaps = 2/197 (1%)

Query: 48  EQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX 107
           E+ D E+ E  P VVPANA  GGRETSDRVLYVGNLDK+ITE++L+QYFQVGG I+    
Sbjct: 29  ERSDSEERETTP-VVPANATKGGRETSDRVLYVGNLDKSITEEVLRQYFQVGGQISNVKV 87

Query: 108 XXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDD-TFNLF 166
                     YAFVEY +SHDANIALQTLNGKQIENNVV+INWAF       D+ T+NLF
Sbjct: 88  MIDKNNARANYAFVEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQALPDENTYNLF 147

Query: 167 VGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQG 226
           VGDL+V+VDDETL NAF+ FPS++ GHVMWDMQTG SRGYGFVSF  Q+ AQ AMDSMQ 
Sbjct: 148 VGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSMQS 207

Query: 227 QDLNGRPLRINWAAKRD 243
           Q+LNGRPLRINWA+KR+
Sbjct: 208 QELNGRPLRINWASKRE 224

 Score =  194 bits (492), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 94/100 (94%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           +PP VNPQAV+ +IR APPRVTT+YIGNIPHFAT++DLIPL QNFGFILDFKHYPEKGCC
Sbjct: 291 VPPPVNPQAVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCC 350

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           F+KYDTHEQAAVCIVALANF FQGRNLRTGWGKER+ F+P
Sbjct: 351 FVKYDTHEQAAVCIVALANFFFQGRNLRTGWGKERTTFVP 390

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  270 bits (690), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 133/219 (60%), Positives = 159/219 (72%), Gaps = 2/219 (0%)

Query: 26  VTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDK 85
           V E P       E+ VS E   +    E  ++ PSVVPA+A  GGRETSDRVLYVGNLDK
Sbjct: 9   VIETPEEVIEKPEE-VSQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDK 67

Query: 86  AITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNV 145
           +ITED+LKQYFQ GGPI               YAFVEY +SHDAN+ALQTLNG Q+EN  
Sbjct: 68  SITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKT 127

Query: 146 VKINWAFXXXXXXX-DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSR 204
           +KINWAF        DDTFNLFVGDLNV+VDDETL   F++FP+++  HVMWDMQTG SR
Sbjct: 128 LKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSR 187

Query: 205 GYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           GYGFVSF++Q++AQ AMD+MQG+DL+GR +RINWA KR+
Sbjct: 188 GYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKRE 226

 Score =  200 bits (509), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 88/109 (80%), Positives = 96/109 (88%)

Query: 327 NPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYD 386
           NPQA++ +IR APPRVTTAYIGNIPH+ATEADLIPL QNFGFILDF HYPEKGCCFIKYD
Sbjct: 299 NPQAIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYD 358

Query: 387 THEQAAVCIVALANFPFQGRNLRTGWGKERSNFMPXXXXXXXXXPLIMN 435
           THEQAAVCIVALANFPFQGRNLRTGWGKER+NFMP         P++M+
Sbjct: 359 THEQAAVCIVALANFPFQGRNLRTGWGKERTNFMPPQGAPGQQMPVMMD 407

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  270 bits (691), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 130/214 (60%), Positives = 157/214 (73%), Gaps = 1/214 (0%)

Query: 31  TSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITED 90
           T+     E N +     E+ + E+ E +P+VVPA+A  GGRETSDRVLYVGNLDK+I ED
Sbjct: 42  TNQQDGEESNQTEIATEEKGNGEEQEEEPNVVPASATHGGRETSDRVLYVGNLDKSINED 101

Query: 91  ILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINW 150
           +LKQYFQVGG I               YAFVEY +SHDAN+ALQTLNG QIEN ++KINW
Sbjct: 102 LLKQYFQVGGQITDVKIMVDKKNQNVNYAFVEYLKSHDANVALQTLNGIQIENKIIKINW 161

Query: 151 AFXXXXX-XXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFV 209
           AF        +DTFNLFVGDLN++VDDETL + FK+FPSY+  HVMWDMQT  SRGYGFV
Sbjct: 162 AFQSQQNLNSNDTFNLFVGDLNIDVDDETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFV 221

Query: 210 SFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           SF  +D AQ AMD+MQG+++NGRP+RINWA KR+
Sbjct: 222 SFADRDQAQNAMDTMQGKEINGRPIRINWATKRE 255

 Score =  200 bits (509), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           +P  VNPQAVD +IR APPRVTTAYIGNIPHFATEADLIPL Q FGFILDF HYPEKGCC
Sbjct: 345 VPGPVNPQAVDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCC 404

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER+ F+P
Sbjct: 405 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTTFIP 444

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  265 bits (677), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 129/185 (69%), Positives = 147/185 (79%), Gaps = 2/185 (1%)

Query: 60  SVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYA 119
           S+VPANAI GGRETSD++LYVGNLDK+I EDILKQYFQVGGPI               YA
Sbjct: 61  SIVPANAINGGRETSDKILYVGNLDKSINEDILKQYFQVGGPITNVKVINDKNNEAN-YA 119

Query: 120 FVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXX-XXXDDTFNLFVGDLNVNVDDET 178
           FVEY Q HDA+IAL+TLNGKQIENN +KINWAF        D+TFNLF+GDLNV+VDDET
Sbjct: 120 FVEYSQHHDASIALKTLNGKQIENNTLKINWAFQSQQNTTSDETFNLFIGDLNVDVDDET 179

Query: 179 LRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINW 238
           L  AFKDF S++  HVMWDMQTG SRGYGFVSF++ DDAQ AMD+MQG +LNGR LRINW
Sbjct: 180 LVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSFSNLDDAQVAMDTMQGSELNGRQLRINW 239

Query: 239 AAKRD 243
           A+KR+
Sbjct: 240 ASKRE 244

 Score =  190 bits (483), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 91/100 (91%), Gaps = 1/100 (1%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           LPP V+PQAVD +IR AP RVTT YIGNIPHFATEADLIPL QNFGFILDFKHYPEKG C
Sbjct: 304 LPP-VDPQAVDDMIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNC 362

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           FIKYDTHEQAAVCIV LANFPFQGRNL+TGWGKE+S FMP
Sbjct: 363 FIKYDTHEQAAVCIVVLANFPFQGRNLKTGWGKEKSTFMP 402

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  262 bits (669), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 133/223 (59%), Positives = 154/223 (69%), Gaps = 8/223 (3%)

Query: 22  ETPLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVG 81
           ET   +  P SADP +E   + E ++E         + SVVPA+A  GGRETSDRVLYVG
Sbjct: 36  ETAETSTEPESADPVSEAPAAGEQSAEN-------QESSVVPASATQGGRETSDRVLYVG 88

Query: 82  NLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQI 141
           NLDK+I ED+LKQYFQVGG I               YAF+EY +SHDAN+ALQTLNG QI
Sbjct: 89  NLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQI 148

Query: 142 ENNVVKINWAFXXXXXX-XDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQT 200
           E   V+INWAF        DDTFNLFVGDLNV+VDDETL +AF  FPSY+  HVMWDMQT
Sbjct: 149 EGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQT 208

Query: 201 GSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           G SRGYGFVSF  Q+ AQ AM+ MQG  +NGR +RINWA KR+
Sbjct: 209 GRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251

 Score =  191 bits (485), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 87/92 (94%)

Query: 329 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 388
           QA+D +IR APPRVTTAYIGNIPHFATEADLIPL QNFGFILDF HYPEKGCCFIKYDTH
Sbjct: 311 QAIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTH 370

Query: 389 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 420
           EQAAVCIVALANFPFQGRNLRTGWGKER+ F+
Sbjct: 371 EQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 24/59 (40%)

Query: 358 DLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 416
           D  P +     + D +    +G  F+ +   EQA   +  +   P  GR +R  W  +R
Sbjct: 192 DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  259 bits (662), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 118/188 (62%), Positives = 143/188 (76%)

Query: 56  ENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXX 115
           E  P + PAN   GGRETSD++LYVGNLDK+ITED+LKQYFQVGGP+A            
Sbjct: 24  EEQPQITPANVARGGRETSDKILYVGNLDKSITEDLLKQYFQVGGPVANVKILVDKNNQE 83

Query: 116 XXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVD 175
             YAFVEYH+ HDAN+A QTL+GK IENN +KINWAF       D++FNLFVGDLNV+VD
Sbjct: 84  ANYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAFQSHQVASDESFNLFVGDLNVDVD 143

Query: 176 DETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLR 235
           DETL NAF +F +++  HVMWDMQ+G SRGYGFVSF  Q+ AQ AM++ QG +LNGR +R
Sbjct: 144 DETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSFGEQEQAQKAMETKQGFELNGRAIR 203

Query: 236 INWAAKRD 243
           INWA+KR+
Sbjct: 204 INWASKRE 211

 Score =  181 bits (459), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 78/88 (88%), Positives = 83/88 (94%)

Query: 334 IIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAV 393
           +IR APPR+TTAYIGNIPHFATE DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAAV
Sbjct: 289 MIRRAPPRITTAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAV 348

Query: 394 CIVALANFPFQGRNLRTGWGKERSNFMP 421
           CIVALANFPFQGRNLRTGWGKE+  F+P
Sbjct: 349 CIVALANFPFQGRNLRTGWGKEKPTFIP 376

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  259 bits (662), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 124/183 (67%), Positives = 138/183 (75%)

Query: 61  VVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAF 120
           V P  A  GGRETSDR+LYVGNLDKAI ED LKQYFQVGGPIA              YAF
Sbjct: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107

Query: 121 VEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLR 180
           VEYHQ HDAN+A QTL+GKQIE NV+KINWAF       DDTFNLFVGDLNV+VDDETL 
Sbjct: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167

Query: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240
             FK+FPS++  HVMWDM +G SRGYGFVSF+ QD AQ AM+S QG  LNGR +RINWA+
Sbjct: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227

Query: 241 KRD 243
           KR+
Sbjct: 228 KRE 230

 Score =  176 bits (445), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 77/88 (87%), Positives = 81/88 (92%)

Query: 334 IIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAV 393
           +IR AP RVTTAYIGNIPHFA E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAAV
Sbjct: 305 MIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAV 364

Query: 394 CIVALANFPFQGRNLRTGWGKERSNFMP 421
           CIVALANFPFQGRNLRTGWGKE+  F+P
Sbjct: 365 CIVALANFPFQGRNLRTGWGKEKPAFIP 392

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  259 bits (661), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 120/186 (64%), Positives = 141/186 (75%)

Query: 58  DPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXX 117
           +P+V PANA  GGRETSDR+LYVGNLD A+TE++LKQYFQVGG IA              
Sbjct: 49  EPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILMDKNNKQAN 108

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDE 177
           YAFVE+HQ HDAN+A QTL+GKQIEN+V+KINWAF       +DTFNLFVGDLNV+VDDE
Sbjct: 109 YAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVSSEDTFNLFVGDLNVDVDDE 168

Query: 178 TLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
           TL   FKD P+++  HVMWDMQTG SRGYGFVSF  Q  AQ AM+  QG  +NGR +RIN
Sbjct: 169 TLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQGAVVNGRAIRIN 228

Query: 238 WAAKRD 243
           WA+KR+
Sbjct: 229 WASKRE 234

 Score =  187 bits (476), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           +PPQV PQAV+ ++RSAPPRVTT YIGNIPHFATE DLIPL QNFGFI+DFKHYP++GCC
Sbjct: 300 MPPQVPPQAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKHYPDRGCC 359

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           FIKY THEQAAVCI+ L NFPFQGRNLRTGWGKE+ +++P
Sbjct: 360 FIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGKEKPSYIP 399

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  258 bits (658), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 128/221 (57%), Positives = 159/221 (71%), Gaps = 8/221 (3%)

Query: 28  EVPTSADPSAEQNVSSEGNSEQVDDEQ----GENDPSVVPANAITGGRETSDRVLYVGNL 83
           E P +A+  +++N   E    Q D E      E+D  VVPANAI GGRETSD++LYVGNL
Sbjct: 29  ETPVAAE--SQENQEDENQDRQKDQESVGTAAEDDSDVVPANAINGGRETSDKILYVGNL 86

Query: 84  DKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIEN 143
           DK+I E+ LKQYFQ+GGPI+              YAFVEY Q HDA++A + LNGK IE 
Sbjct: 87  DKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLNGKTIET 145

Query: 144 NVVKINWAFXXXXXXXDDT-FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGS 202
            V+KINWAF       D++ FNLFVGDLNV+VDDETL +AF +FPS++  HVMWDMQTG 
Sbjct: 146 KVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGR 205

Query: 203 SRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           SRGYGF+SF++Q+DAQTAMD MQ  +LNGR +RINWA+KR+
Sbjct: 206 SRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246

 Score =  186 bits (471), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 1/100 (1%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           LPP VNPQAVD +IR AP RVTT YIGNIPHFATEADLIPL QNFGFILDFK+YPEKG C
Sbjct: 305 LPP-VNPQAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC 363

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           FIKYDTHEQAAVCIV LAN+PFQGRNL+TGWGKE++ F+P
Sbjct: 364 FIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAVFIP 403

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  256 bits (653), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 119/186 (63%), Positives = 141/186 (75%)

Query: 58  DPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXX 117
           +P+V PANA  GGRETSDR+LYVGNLD A+TED+LKQYFQVGG IA              
Sbjct: 44  EPAVTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEAN 103

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDE 177
           YAFVE+HQ HDA++A QTL+GKQIEN+V+KIN+AF       +DTFNLFVGDLNV+VDDE
Sbjct: 104 YAFVEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDE 163

Query: 178 TLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
           TL N FK  P+++  HVMWDMQTG SRGYGFVSF  Q  AQ AM+  QG  +NGR +RIN
Sbjct: 164 TLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRIN 223

Query: 238 WAAKRD 243
           WA+KR+
Sbjct: 224 WASKRE 229

 Score =  184 bits (468), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           LPPQV PQA++ +IRSAP RVTT YIGNIPHFA+E DLIPL QNFGFI+DFKHYP++GCC
Sbjct: 303 LPPQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDRGCC 362

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           FIKY THEQAA+CI+ L NFPFQGRNLRTGWGKE+  ++P
Sbjct: 363 FIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEKPTYVP 402

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  253 bits (647), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 137/182 (75%)

Query: 62  VPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFV 121
            P  A  GGRETSDR+LYVGNLDK I E  LKQYFQVGGPIA              YAFV
Sbjct: 21  TPVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFV 80

Query: 122 EYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
           EY Q  DAN+A QTL+GKQIENNV+KINWAF       DDTFNLFVGDLNV+VDDETL +
Sbjct: 81  EYRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            FK+FP+++  HVMWDMQ+G SRGYGFVSF  Q++AQ AMD+ QG +LNGR +R+NWAAK
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 242 RD 243
           R+
Sbjct: 201 RE 202

 Score =  181 bits (460), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           +P  VNPQAV+ +IR AP RVTTAYIGNIPHFA E DLIPL QNFGFI+DFKHY EKGCC
Sbjct: 250 VPSPVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCC 309

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
           FIKYDTH+QAA+CIVALANFPFQGR LRTGWGKE+ +F+P
Sbjct: 310 FIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPSFVP 349

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  256 bits (653), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 126/227 (55%), Positives = 155/227 (68%), Gaps = 4/227 (1%)

Query: 18  PVAAET-PLVTEVPTSADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDR 76
           P AA T P   E P S  P+++ N    G+ E+  +E  E D S  P  A  GGRE SD+
Sbjct: 41  PGAATTAPATEEAPASEKPASQDN---NGDGEKQQEEGDEEDDSAAPVLATQGGREKSDK 97

Query: 77  VLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           +LYVGNL K+I +D+LKQYFQ+GG I+              YAFVEY + HDAN+A QTL
Sbjct: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           NGK++E  V+KINWAF       D+TFNLFVGDLNV+VDD TL   FK+FPS++  HVMW
Sbjct: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           DMQ+G SRGYGFVSF  QD AQ AM++ QG +LNGR LRINWA+KR+
Sbjct: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKRE 264

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 80/99 (80%), Positives = 90/99 (90%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           +PP V+P+AV+ ++R APPRVTTAYIGNIPHFA E DLIPL QNFGFI+DFKHYPEKGCC
Sbjct: 338 VPPPVDPEAVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCC 397

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFM 420
           FIKYDTHEQAA+CIVAL NFPFQGRNLRTGWGKE+  F+
Sbjct: 398 FIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEKPTFI 436

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 23/57 (40%)

Query: 360 IPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 416
            P F     + D +    +G  F+ +   +QA V +     F   GR LR  W  +R
Sbjct: 207 FPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  244 bits (622), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 116/185 (62%), Positives = 135/185 (72%), Gaps = 1/185 (0%)

Query: 60  SVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYA 119
           +V+PA+A  GGRETSD+VLY+GNLDK+I ED LKQYFQV G I               YA
Sbjct: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYA 74

Query: 120 FVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDT-FNLFVGDLNVNVDDET 178
           F+EY  +HDAN+ALQTLNG QIEN  +KINWAF       DDT FNLF+GDLNVNVDD T
Sbjct: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134

Query: 179 LRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINW 238
           L NAFK  P +L  HVMWDMQT  SRGYGFVSF + ++AQ AMD MQG ++NGR +RINW
Sbjct: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194

Query: 239 AAKRD 243
           A KR+
Sbjct: 195 ATKRE 199

 Score =  190 bits (482), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (92%)

Query: 326 VNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKY 385
           VNPQAV+ +IR APPRVTTAYIGNIPHFATE DLIPL QNFGFILDF HYPEKGCCFIKY
Sbjct: 243 VNPQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKY 302

Query: 386 DTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFM 420
           DTHEQAAVCIVAL+NF FQGRNLRTGWGKERS F+
Sbjct: 303 DTHEQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 346 YIGNIPHFATEADLIPLFQNFGFILDFKHYPEK-----GCCFIKYDTHEQAAVCIVALAN 400
           YIGN+     E  L   FQ  G I+D K   +K        FI+Y T+  A V +  L  
Sbjct: 34  YIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNG 93

Query: 401 FPFQGRNLRTGWG 413
              + +N++  W 
Sbjct: 94  IQIENKNIKINWA 106

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 24/56 (42%)

Query: 361 PLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 416
           P F     + D +    +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 95/187 (50%), Gaps = 5/187 (2%)

Query: 49  QVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXX 107
           ++DD Q +   +  P++A T   E S   LYVG+LD +++E +L   F  +G   +    
Sbjct: 16  KIDDSQEQQTATSTPSSATT---ENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVC 72

Query: 108 XXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFV 167
                     YA+V ++       A++ LN   I+  + +I W+          + N+F+
Sbjct: 73  RDAITKTSLGYAYVNFNDHEAGKKAIEKLNYTPIKGRLCRIMWSQRDPALRKKGSANIFI 132

Query: 168 GDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQ 227
            +L+ ++D++ L + F  F + LS  +  D +TG S+G+GFV F     A+ A+D++ G 
Sbjct: 133 KNLHSDIDNKALYDTFSVFGNILSSKIATD-ETGKSKGFGFVHFEDDTAAKEAIDALNGM 191

Query: 228 DLNGRPL 234
            LNG+ +
Sbjct: 192 LLNGQEI 198

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N++   T++   + F   G +               + FV++    DA  A++ LN
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
           G Q ++  + ++ A        +                   NLF+ +L+ ++DDE L+ 
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM   + G SRG+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 242 RD 243
           +D
Sbjct: 402 KD 403

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VGDL+ +V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ 
Sbjct: 41  SLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKKAIEK 100

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GR  RI W+ +
Sbjct: 101 LNYTPIKGRLCRIMWSQR 118

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 97/197 (49%), Gaps = 3/197 (1%)

Query: 43  SEGNSEQVDDEQGENDPSVVPANAITGGR--ETSDRVLYVGNLDKAITEDILKQYFQ-VG 99
           ++  +EQ++    +  P   P +  +  +  ETS   LYVG LD  ++E +L   F  +G
Sbjct: 5   ADKTAEQLEQLNLQEAPQTAPTSTDSDSQKVETSTASLYVGELDPTVSEALLYDIFSPIG 64

Query: 100 GPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXX 159
              +              YA+V ++       A++ LN   I+    +I W+        
Sbjct: 65  SVSSIRVCRDAITKTSLGYAYVNFNDYEAGRQAIEKLNYTPIKGQPCRIMWSQRDPSLRK 124

Query: 160 DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQT 219
             + N+F+ +L+ ++D++ L + F  F + LS  +  D  TG+S+G+GFV F S + A+ 
Sbjct: 125 KGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATDEVTGNSKGFGFVHFESDEAARE 184

Query: 220 AMDSMQGQDLNGRPLRI 236
           A+D++ G  LNG+ + +
Sbjct: 185 AIDAINGMLLNGQEVYV 201

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 77/182 (42%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +Y+ N+     E   +++F+   P+               + FV Y     A  A++ LN
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
           G +     + +  A        +                   NLF+ +L+ ++DDE LR 
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 344 EFSPFGTITSVKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

Query: 242 RD 243
           +D
Sbjct: 403 KD 404

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%)

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           T +L+VG+L+  V +  L + F    S  S  V  D  T +S GY +V+F   +  + A+
Sbjct: 39  TASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDYEAGRQAI 98

Query: 222 DSMQGQDLNGRPLRINWAAK 241
           + +    + G+P RI W+ +
Sbjct: 99  EKLNYTPIKGQPCRIMWSQR 118

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 78/161 (48%), Gaps = 2/161 (1%)

Query: 72  ETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDAN 130
           E ++  LYVG LD  ITE +L   F   GPI+               YA+V Y       
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 131 IALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL 190
            A+Q LN  +I     +I W+          + N+F+ +L+  +D++ L   F  F   L
Sbjct: 106 KAIQELNYAEINGRPCRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVL 165

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
           S  V  D + G+SRG+GFV F  + DA+ A++++ G  +NG
Sbjct: 166 SCKVALD-ENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNG 205

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D   T++  +Q F   G I               + FV +   + A  A++ LN
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 138 GKQIENNVVKINWA----------------FXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
           GK+ ++  + +  A                +           NLF+ +L+ ++DDE L+ 
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM D Q G+S+G+GFV F+S ++A  AM     Q + G+PL +  A +
Sbjct: 353 EFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

Query: 242 RD 243
           +D
Sbjct: 412 KD 413

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VG+L+ N+ +  L + F       S  V  D  T +S GY +V++T  +  + A+  
Sbjct: 51  SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE 110

Query: 224 MQGQDLNGRPLRINWAAK 241
           +   ++NGRP RI W+ +
Sbjct: 111 LNYAEINGRPCRIMWSER 128

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 92/188 (48%), Gaps = 2/188 (1%)

Query: 50  VDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXX 108
           + DEQ    P+     A +   E     LYVG LD +++E +L   F  +G   +     
Sbjct: 17  IQDEQPAATPATTAIEAESPNVENVTASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCR 76

Query: 109 XXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVG 168
                    YA+V ++       A++ LN   I+    +I W+          + N+F+ 
Sbjct: 77  DAITKTSLGYAYVNFNDHEAGKTAIEKLNYTAIKGRPCRIMWSQRDPSMRKKGSGNIFIK 136

Query: 169 DLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQD 228
           +L+ ++D++TL   F  F + LS  +  D +TG S+G+GFV F +++ A+ A+D++ G  
Sbjct: 137 NLHPDIDNKTLYETFSVFGNILSCKIAND-ETGKSKGFGFVHFENEEAAREAIDAINGML 195

Query: 229 LNGRPLRI 236
           LNG+ + +
Sbjct: 196 LNGQEVYV 203

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (43%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV NLD   TE+  +  F+  G I               + FV++    DA  A++ LN
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
             + +   + +  A        +                   NLF+ +L+ ++DDE L+ 
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

Query: 242 RD 243
           +D
Sbjct: 405 KD 406

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 76/178 (42%), Gaps = 7/178 (3%)

Query: 71  RETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           R+     +++ NL   I    L + F V G I               + FV +     A 
Sbjct: 126 RKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIANDETGKSKGFGFVHFENEEAAR 185

Query: 131 IALQTLNGKQIENNVVKI--NWAFXXXXXXXDDT----FNLFVGDLNVNVDDETLRNAFK 184
            A+  +NG  +    V +  + +        D+      N++V +L++   +E   N FK
Sbjct: 186 EAIDAINGMLLNGQEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFK 245

Query: 185 DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
            + +  S  +  D + G SRG+GFV F + +DA  A++++   +  G+ L +  A K+
Sbjct: 246 PYGTITSVALEKDAE-GKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGRAQKK 302

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 44/80 (55%)

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           T +L+VG+L+ +V +  L + F    S  S  V  D  T +S GY +V+F   +  +TA+
Sbjct: 42  TASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAI 101

Query: 222 DSMQGQDLNGRPLRINWAAK 241
           + +    + GRP RI W+ +
Sbjct: 102 EKLNYTAIKGRPCRIMWSQR 121

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 5/100 (5%)

Query: 322 LPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDF-----KHYP 376
           + P V+ +     +  A    T  Y+ N+   ATE D   LF+ +G I            
Sbjct: 203 VAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGK 262

Query: 377 EKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 416
            +G  F+ ++ HE A   + AL +  ++G+ L  G  +++
Sbjct: 263 SRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGRAQKK 302

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 81.6 bits (200), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 91/190 (47%), Gaps = 3/190 (1%)

Query: 56  ENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPI-AXXXXXXXXXXX 114
           E  P+     A     +T+   LYVG LD +++E +L   F   GP+ +           
Sbjct: 30  EGTPAASETEANNSNVDTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKT 89

Query: 115 XXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNV 174
              YA+V ++       A++ LN   I+    +I W+            N+F+ +L+ ++
Sbjct: 90  SLGYAYVNFNDHESGRTAIEKLNYSPIKGKPCRIMWSQRDPALRKKGAGNIFIKNLHPDI 149

Query: 175 DDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
           D++ L + F  F + LS  +  D +TG S+G+GFV F   + A  A+D++ G  LNGR +
Sbjct: 150 DNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDNAAVEAVDAINGMMLNGREV 208

Query: 235 RI-NWAAKRD 243
            +    +K+D
Sbjct: 209 YVAQHVSKKD 218

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 76/182 (41%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D    ED     F   GPI               + F+ +    DA  A++ LN
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
             + +   + +  A        +                   NLFV +L+ ++DDE L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F S  S  VM + + G S+ +GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 353 EFAPFGSITSAKVMRN-EEGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

Query: 242 RD 243
           +D
Sbjct: 412 KD 413

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 69/171 (40%), Gaps = 7/171 (4%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +++ NL   I    L   F V G I               + FV + + + A  A+  +N
Sbjct: 140 IFIKNLHPDIDNKALHDTFSVFGNILSCKIATDETGKSKGFGFVHFEEDNAAVEAVDAIN 199

Query: 138 GKQIENNVVKINWAFXXXXXXXD------DTFNLFVGDLNVNVDDETLRNAFKDFPSYLS 191
           G  +    V +                  +  N++V +++V+  ++     F  +    S
Sbjct: 200 GMMLNGREVYVAQHVSKKDRESKLEEVKANFTNVYVKNVDVDTPEDEFTALFSKYGPITS 259

Query: 192 GHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
             +  D + G  RG+GF++F + DDA  A++ +   +  G+ L +  A K+
Sbjct: 260 IAMEKDSE-GKFRGFGFINFENHDDAAKAVEELNDLEFKGQKLYVGRAQKK 309

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 99/203 (48%), Gaps = 3/203 (1%)

Query: 43  SEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGP 101
           ++  +EQ++  + E   +     + T   ETS   LYVG LD +++E +L   F  +G  
Sbjct: 5   TDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELDPSVSEALLYDIFSPIGSV 64

Query: 102 IAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDD 161
            +              YA+V +H       A++ LN   I+    +I W+          
Sbjct: 65  SSIRVCRDAITNTSLGYAYVNFHDHEAGRKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKG 124

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           + N+++ +L+  +D+++L   F  F + LS  V  D   G SRG+GFV F ++ DA+ A+
Sbjct: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-DNGVSRGFGFVHFENESDARDAI 183

Query: 222 DSMQGQDLNGRPLRINW-AAKRD 243
           +++ G  +N + + + W  +K+D
Sbjct: 184 EAVNGMLMNDQEVYVAWHVSKKD 206

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D   +++  +Q F   G I               + F+ +     A  A+  LN
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
                   + +  A        +                   NLF+ +L+ ++DDE L++
Sbjct: 281 ESDFRGQTLYVGRAQKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLKD 340

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM D + GSSRG+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 341 EFAPFGTITSVKVMKD-EAGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQR 399

Query: 242 RD 243
           ++
Sbjct: 400 KE 401

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 103/207 (49%), Gaps = 25/207 (12%)

Query: 49  QVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXX 107
           + +DE+ E+ P      A T G   +   ++VG L  +I ++ LKQ F+ +GG +A    
Sbjct: 156 KAEDEEEESSPK----KAKTDGEPAT---VFVGRLSWSIDDEWLKQEFEHIGGVVAARVM 208

Query: 108 XXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWA---------------F 152
                     Y +V++     A  A++ ++GK+I+   + ++ +               F
Sbjct: 209 YERGTDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRF 268

Query: 153 XXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFT 212
                   DT  LF+G+L+ N D + +   F  F   +S  +    +T   +G+G+V +T
Sbjct: 269 GDIPSEPSDT--LFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYT 326

Query: 213 SQDDAQTAMDSMQGQDLNGRPLRINWA 239
           S DDA+ A++++QG+ ++ RP+R++++
Sbjct: 327 SIDDAKKALEALQGEYIDNRPVRLDYS 353

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 49/78 (62%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+ ++DDE L+  F+     ++  VM++  T  SRGYG+V F  +  A+ A+  M
Sbjct: 178 VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKEM 237

Query: 225 QGQDLNGRPLRINWAAKR 242
            G++++GRP+ ++ +  +
Sbjct: 238 HGKEIDGRPINVDMSTSK 255

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 92/178 (51%), Gaps = 9/178 (5%)

Query: 70  GRETSDRVLYVGNLDKAITEDILKQ-YFQVGGP-IAXXXXXXXXXXXXXXYAFVEYHQSH 127
           G ET+   LY+G+LD + TE+ +KQ +  +G P +               Y FVE+  + 
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGEPNVQVKLIKNSGPMNNSGYCFVEFPSNL 106

Query: 128 DANIALQTLNGKQIE---NNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF- 183
            A  AL    G  I    +  +K+NWA        +  F++FVGDL  NV +  L   F 
Sbjct: 107 SATNALLK-TGLPIPVDPSRSLKLNWASFATAPGTE--FSIFVGDLAPNVSESQLFELFI 163

Query: 184 KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
             + S L+  +++D  TG S+GYGFV F ++ + Q ++  MQG  LNGR +R++  +K
Sbjct: 164 SRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTSK 221

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 43/101 (42%), Gaps = 9/101 (8%)

Query: 324 PQVNPQAVDHI--IRSAP-------PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKH 374
           PQ  PQ    I  ++  P       P  TT +IG +    TE +L   FQ FG I+  K 
Sbjct: 258 PQTLPQQSQFIYPVQQQPVLSQFTDPNNTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKI 317

Query: 375 YPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 415
              KGC F++Y     A   I  +  FP     +R  WG+ 
Sbjct: 318 PVGKGCGFVQYVDRSSAENAIAKMQGFPIGNSRIRLSWGRS 358

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V +E LR  F+ F     G +++ ++    +G GFV +  +  A+ A+  M
Sbjct: 288 VFIGGLSSLVTEEELRAYFQPF-----GQIVY-VKIPVGKGCGFVQYVDRSSAENAIAKM 341

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 342 QGFPIGNSRIRLSWG 356

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   +TE+ L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 285 NTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGC-----GFVQYVDRSSAENAIA 339

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ ++++W 
Sbjct: 340 KMQGFPIGNSRIRLSWG 356

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 91/189 (48%), Gaps = 5/189 (2%)

Query: 49  QVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXX 107
           +++D+Q     S    NA     +TS   LYVG LD  +TE +L   F  +G   +    
Sbjct: 16  KINDDQQTAPTSTESENAKV---DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVC 72

Query: 108 XXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFV 167
                     YA+V +H       A+Q LN   I+    +I W+          + N+F+
Sbjct: 73  RDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFI 132

Query: 168 GDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQ 227
            +L+  +D++ L + F  F + LS  +  D + G+S+G+GFV F  +  A+ A+D++ G 
Sbjct: 133 KNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGM 191

Query: 228 DLNGRPLRI 236
            LNG+ + +
Sbjct: 192 LLNGQEVYV 200

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 78/182 (42%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D   T++  +  F   G I               + F+ +     A  A+  LN
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
               ++  + +  A        +                   NLFV +L+ ++DDE LR+
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM D   G+S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 242 RD 243
           +D
Sbjct: 402 KD 403

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VG+L+  V +  L + F    S  S  V  D  T +S GY +V+F   D  +TA+  
Sbjct: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GRP RI W+ +
Sbjct: 101 LNYTTIKGRPCRIMWSQR 118

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 12/196 (6%)

Query: 37  AEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYF 96
           A Q  SS G++ +V             +N    G       LYVG LD +++E +L   F
Sbjct: 22  ASQEESSSGSAAEVSS----------ASNGGNSGTAVDSASLYVGELDPSVSEALLYDIF 71

Query: 97  QVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXX 155
              GP++               YA+V ++      +A++ LN   I+    +I W+    
Sbjct: 72  SPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAIEKLNYTPIKGKPCRIMWSQRDP 131

Query: 156 XXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
               + + N+F+ +L+ ++D++ L + F  F + LS  +  D +TG S+G+GFV F    
Sbjct: 132 SMRKNGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDT 190

Query: 216 DAQTAMDSMQGQDLNG 231
            A  A+D++ G  LNG
Sbjct: 191 AASEAIDAINGMMLNG 206

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D   TE+  ++ F+  GPI               + FV Y     A  A+  LN
Sbjct: 234 VYVKNVDLEATEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELN 293

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
             + ++  + +  A        +                   NLFV +L+  +DDE L+ 
Sbjct: 294 DLEFKSQKLYVGRAQKKYERLQELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKK 353

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F+ F +  S  VM + +TG S+G+GFV F+S ++A  A+     Q + G+PL +  A +
Sbjct: 354 EFESFGTITSVKVMRN-ETGKSKGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQR 412

Query: 242 RD 243
           +D
Sbjct: 413 KD 414

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D+ +L+VG+L+ +V +  L + F       S  V  D  T +S GY +V+F   D  + A
Sbjct: 49  DSASLYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVA 108

Query: 221 MDSMQGQDLNGRPLRINWAAK 241
           ++ +    + G+P RI W+ +
Sbjct: 109 IEKLNYTPIKGKPCRIMWSQR 129

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 88/178 (49%), Gaps = 9/178 (5%)

Query: 70  GRETSDRVLYVGNLDKAITEDILKQYFQVGGP--IAXXXXXXXXXXXXXXYAFVEYHQSH 127
           G +TS   LY+G+LD + TE  +KQ +   G   +               Y FVE+  + 
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNL 105

Query: 128 DANIALQTLNGKQI---ENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF- 183
            A  AL    G  I    +  +K+NWA           F++FVGDL  NV +  L   F 
Sbjct: 106 AATNALLK-TGLPIPVDASRTLKLNWA--SFATTPGSEFSIFVGDLAPNVTESQLFELFI 162

Query: 184 KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
             + S L+  +++D  TG S+GYGFV F ++ + Q ++  MQG  LNGR +R++  +K
Sbjct: 163 SRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSK 220

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 36/78 (46%)

Query: 338 APPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVA 397
           A P  TT +IG +    TE +L   FQ FG I+  K    KGC F++Y     A   I  
Sbjct: 277 ADPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAK 336

Query: 398 LANFPFQGRNLRTGWGKE 415
           +  FP     +R  WG+ 
Sbjct: 337 MQGFPIGNSRVRLSWGRS 354

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+ A+  M
Sbjct: 284 VFIGGLSSLVTEDELRAYFQPF-----GQIVY-VKIPVGKGCGFVQYVDRSSAENAIAKM 337

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 338 QGFPIGNSRVRLSWG 352

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   +TED L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 281 NTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGC-----GFVQYVDRSSAENAIA 335

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ V+++W 
Sbjct: 336 KMQGFPIGNSRVRLSWG 352

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 92/182 (50%), Gaps = 18/182 (9%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK  F+ +GG I+              Y +V++     A  A++ 
Sbjct: 212 TIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEKAIKE 271

Query: 136 LNGKQIENNVVKINWA---------------FXXXXXXXDDTFNLFVGDLNVNVDDETLR 180
           + GK+I+   + ++ +               F        DT  LF+G+L+ N D + + 
Sbjct: 272 MQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDT--LFLGNLSFNADRDNIF 329

Query: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240
             FKD+ S +S  +    +T   +G+G+V + S ++AQ A+D +QG+ ++ RP+R+++++
Sbjct: 330 ELFKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLDFSS 389

Query: 241 KR 242
            R
Sbjct: 390 PR 391

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 105/207 (50%), Gaps = 7/207 (3%)

Query: 43  SEGNSEQVDDEQGENDP--SVVPANAITGGR--ETSDRVLYVGNLDKAITEDILKQYFQ- 97
           +E  +EQ++    +++P  +V PA+     +  ETS   LYVG LD +++E +L   F  
Sbjct: 5   TEKTAEQLEQLNIQDEPQQNVAPASNEPESQKVETSSASLYVGELDPSVSEALLYDIFSP 64

Query: 98  VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXX 157
           +G   +              YA+V ++       A++ LN   I+    +I W+      
Sbjct: 65  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEKLNYAPIKGVPCRIMWSQRDPSM 124

Query: 158 XXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDA 217
               + N+F+ +L+ ++D++ L + F  F + LS  +  D + G+SRG+GFV F   + A
Sbjct: 125 RKKGSGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATD-EAGNSRGFGFVHFEDDEAA 183

Query: 218 QTAMDSMQGQDLNGRPLRI-NWAAKRD 243
           + A+D++ G  LNG+ + +    +K+D
Sbjct: 184 KEAIDAINGMLLNGQEVYVAQHVSKKD 210

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 77/182 (42%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+     ++  +++F   GPI               + FV Y   +DA  A++ LN
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 138 GKQIENNVVKINWA----------------FXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
               +   + +  A                F           NLFV +L+  +DD+ L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 345 EFAPYGTITSVKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

Query: 242 RD 243
           +D
Sbjct: 404 KD 405

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 78.2 bits (191), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 83/166 (50%), Gaps = 2/166 (1%)

Query: 72  ETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           ET    LYVG+LD +++E  L   F  +G   +              YA+V ++    A 
Sbjct: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90

Query: 131 IALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL 190
            A++ LN   I+  + +I W+            N+F+ +L+ ++D++ L + F  F + L
Sbjct: 91  TAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNIL 150

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 236
           S  V  D +TG S+G+G+V F   + A  A+D++ G  LNG+ + +
Sbjct: 151 SSKVATD-ETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYV 195

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 75/182 (41%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +Y+ N++   T+   ++     G                 + FV +    DA   ++ LN
Sbjct: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
             + +   + +N A        +                   NLF+ +L+ ++DD+ L  
Sbjct: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 242 RD 243
           +D
Sbjct: 397 KD 398

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 67/171 (39%), Gaps = 7/171 (4%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +++ NL   I    L   F V G I               + +V + +   A+ A+  LN
Sbjct: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDALN 184

Query: 138 GKQIENNVVKINWAFXXXXXXXD------DTFNLFVGDLNVNVDDETLRNAFKDFPSYLS 191
           G  +    + +                  +  N+++ ++N    D+        F    S
Sbjct: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDS 244

Query: 192 GHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
             V+     G ++G+GFV+F + +DA   ++ +   +  G+PL +N A K+
Sbjct: 245 -VVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VGDL+ +V +  L + F    +  S  V  D  T +S GY +V+F   D A+TA++ 
Sbjct: 36  SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEK 95

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + G+  RI W+ +
Sbjct: 96  LNFTPIKGKLCRIMWSQR 113

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 5/102 (4%)

Query: 320 IGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFI--LDFKHYPE 377
           I + P ++ +  +          T  YI NI    T+ +   L   FG    +  +  PE
Sbjct: 193 IYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPE 252

Query: 378 ---KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 416
              KG  F+ +  HE A  C+  L N  F+G+ L     +++
Sbjct: 253 GENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 82/169 (48%), Gaps = 2/169 (1%)

Query: 69  GGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXYAFVEYHQSH 127
           G  + +   LYVG LD +++E +L   F   G +A               YA+V +    
Sbjct: 40  GDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVNFSDHE 99

Query: 128 DANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFP 187
               A++ LN   I+  + +I W+            N+F+ +LN ++D++ L + F  F 
Sbjct: 100 AGKQAIEKLNYTPIKGKLCRIMWSQRDPSLRKKGHGNIFIKNLNQDIDNKALFDTFSVFG 159

Query: 188 SYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 236
           + LS  +  D +TG S+G+GFV F  +  A  A+D++ G  LNG+ + +
Sbjct: 160 NILSSKIATD-ETGKSKGFGFVHFEEESAANEAIDALNGMLLNGQEIYV 207

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D   T++  K++F   G +               + FV Y   +DA  A++ LN
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 138 GKQIENNVVKINWA------FXXXXXXXDDT----------FNLFVGDLNVNVDDETLRN 181
           G + ++  + +  A              + T           NLFV +L+ ++DDE L+ 
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM   + G S+G+GFV F+S ++A  A+     Q + G+PL +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

Query: 242 RD 243
           +D
Sbjct: 409 KD 410

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 69/170 (40%), Gaps = 5/170 (2%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +++ NL++ I    L   F V G I               + FV + +   AN A+  LN
Sbjct: 137 IFIKNLNQDIDNKALFDTFSVFGNILSSKIATDETGKSKGFGFVHFEEESAANEAIDALN 196

Query: 138 GKQIENNVVKI--NWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVM 195
           G  +    + +  +          ++T   F      N+D ET    FK+F   +     
Sbjct: 197 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNIDLETTDEEFKEFFGKIGTVTS 256

Query: 196 WDMQTG---SSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
             ++ G     +G+GFV++   +DA  A++ + G +   + L +  A K+
Sbjct: 257 VALERGPDGKLKGFGFVNYEDHNDAVKAVEELNGAEFKDQELFVGRAQKK 306

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VG+L+ +V +  L + F    S  S  V  D  T +S GY +V+F+  +  + A++ 
Sbjct: 48  SLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVNFSDHEAGKQAIEK 107

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + G+  RI W+ +
Sbjct: 108 LNYTPIKGKLCRIMWSQR 125

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 2/160 (1%)

Query: 78  LYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           LYVG LD  ++E +L   F  +G   +              YA+V ++       A++ L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N   I+  + +I W+          + N+F+ +L+ ++D++ L   F  F + LS  +  
Sbjct: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 236
           D +TG S+G+GFV F  +  A+ A+D++ G  LNG+ + +
Sbjct: 157 D-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N++   T++   + F   G +               + FV++ +  DA  A++ LN
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
           G + ++  + ++ A        +                   NLFV +L+ ++DDE L+ 
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM     G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 242 RD 243
           +D
Sbjct: 397 KD 398

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VG+L+  V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ 
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GR  RI W+ +
Sbjct: 96  LNYTPIKGRLCRIMWSQR 113

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 89/179 (49%), Gaps = 13/179 (7%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK  F+ +GG I               Y +V++     A  A++ 
Sbjct: 166 TIFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKE 225

Query: 136 LNGKQIENNVVKINWAFXXXXXXXDD------------TFNLFVGDLNVNVDDETLRNAF 183
           ++GK+I+   +  + +        +D            +  LF+G+L+ N D + +   F
Sbjct: 226 MHGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMF 285

Query: 184 KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
             F   +S  +    +T   +G+G+V +T+ +DA+ A+D++QG+ ++ RP+R++++  R
Sbjct: 286 SKFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFSTPR 344

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 102/207 (49%), Gaps = 14/207 (6%)

Query: 33  ADPSAEQNVSSEGNSEQ--VDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITED 90
           AD +AEQ        EQ  + DEQ +N PS   +       +++   LYVG+LD +++E 
Sbjct: 5   ADKAAEQ-------LEQLNIKDEQ-QNAPSSTGSEGQQS--DSNSTSLYVGDLDPSVSEA 54

Query: 91  ILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKIN 149
           +L   F  +G   +              YA+V +       +A++ LN   I+  + +I 
Sbjct: 55  LLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAGKVAIERLNYTPIKGRLCRIM 114

Query: 150 WAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFV 209
           W+            N+F+ +LN ++D++ L + F  F + LS  +  D + G+S+G+GFV
Sbjct: 115 WSQRDPALRKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIATD-ENGNSKGFGFV 173

Query: 210 SFTSQDDAQTAMDSMQGQDLNGRPLRI 236
            F  +  A+ A+D++ G  LNG+ + +
Sbjct: 174 HFEEEAAAKEAIDALNGMLLNGQEIYV 200

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 66/142 (46%), Gaps = 17/142 (11%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNVVKINWA------FXXXXXXXDDT--------- 162
           + FV Y    DA  A++ LN  + +   + +  A              + T         
Sbjct: 263 FGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQ 322

Query: 163 -FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
             NLF+ +L+ ++DDE L+  F  F +  S  VM   + G S+G+GFV F+S ++A  A+
Sbjct: 323 GVNLFIKNLDDSIDDEKLKEEFAPFGTITSTKVMR-TENGKSKGFGFVCFSSPEEATKAI 381

Query: 222 DSMQGQDLNGRPLRINWAAKRD 243
                Q + G+PL +  A +++
Sbjct: 382 TEKNQQIVAGKPLYVAIAQRKE 403

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           ++ +L+VGDL+ +V +  L + F    S  S  V  D  T +S GY +V+F   +  + A
Sbjct: 38  NSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAGKVA 97

Query: 221 MDSMQGQDLNGRPLRINWAAK 241
           ++ +    + GR  RI W+ +
Sbjct: 98  IERLNYTPIKGRLCRIMWSQR 118

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 71/177 (40%), Gaps = 5/177 (2%)

Query: 71  RETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           R+  +  +++ NL+  I    L   F V G I               + FV + +   A 
Sbjct: 123 RKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIATDENGNSKGFGFVHFEEEAAAK 182

Query: 131 IALQTLNGKQIENNVVKI--NWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDF-- 186
            A+  LNG  +    + +  + +        + T   F      NV  +T    FK+   
Sbjct: 183 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEKTRANFTNVYVKNVPLDTTEEEFKELFE 242

Query: 187 -PSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
            P   S  V+   + G  +G+GFV++ + +DA  A++ +   +  G+ L +  A K+
Sbjct: 243 KPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 343 TTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEK------GCCFIKYDTHEQAAVCIV 396
           T+ Y+G++    +EA L  +F   G +   +   +       G  ++ +  HE   V I 
Sbjct: 40  TSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAGKVAIE 99

Query: 397 ALANFPFQGRNLRTGWGK 414
            L   P +GR  R  W +
Sbjct: 100 RLNYTPIKGRLCRIMWSQ 117

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 378 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFM 420
           KG  F+ Y+ HE A   +  L N  F+G+ L  G  +++   M
Sbjct: 261 KGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKKYERM 303

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 90/182 (49%), Gaps = 18/182 (9%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK+ F+ +GG I+              Y +V++     A  A+Q 
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAEKAIQE 201

Query: 136 LNGKQIE---------------NNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLR 180
           + GK+I+               NN       F        DT  LF+G+L+ N D +T+ 
Sbjct: 202 MQGKEIDGRPINCDLSTSKPAGNNTNDRAKKFGDTPSEPSDT--LFLGNLSFNADRDTIF 259

Query: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240
             F      +S  +    +T   +G+G+V F+S +D++ A++S+QG+ ++ RP+R+++++
Sbjct: 260 ELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSS 319

Query: 241 KR 242
            R
Sbjct: 320 PR 321

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 89/182 (48%), Gaps = 18/182 (9%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            L+VG L  ++ ++ LK  F  +GG ++              Y +V++     A  AL+ 
Sbjct: 150 TLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKE 209

Query: 136 LNGKQIENNVVKINWA---------------FXXXXXXXDDTFNLFVGDLNVNVDDETLR 180
           + GK+I+   + ++ +               F        DT  LF+G+L+ + D + L 
Sbjct: 210 MQGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDT--LFLGNLSFDADRDNLY 267

Query: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240
             F  F   +S  +    +T   +G+G+V +T+ +DA+ A+D++QG+ +N RP+R++++ 
Sbjct: 268 EIFGKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDRPVRLDFST 327

Query: 241 KR 242
            R
Sbjct: 328 PR 329

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 90/183 (49%), Gaps = 19/183 (10%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK+ F+ +GG I+              Y +V++     A  A+Q 
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAEKAIQE 197

Query: 136 LNGKQIE----------------NNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETL 179
           + GK+I+                NN       F        DT  LF+G+L+ N D +T+
Sbjct: 198 MQGKEIDGRPINCDISTSKPAGNNNNNDRAKKFGDTPSEPSDT--LFLGNLSFNADRDTI 255

Query: 180 RNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWA 239
              F      +S  +    +T   +G+G+V +T+ DDA+ A+D++QG+ ++ RP+R++++
Sbjct: 256 FEMFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYS 315

Query: 240 AKR 242
           + R
Sbjct: 316 SPR 318

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 84/175 (48%), Gaps = 14/175 (8%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGP-------IAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           LY+G+L+   TE+ +K  + + G        I               Y FVE+     A+
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 131 IALQTLNGKQI---ENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF-KDF 186
            AL   +G ++    N  +K+NWA           F LFVGDL  NV +  L   F   +
Sbjct: 118 NALMK-SGLRVPMDSNYALKLNWA--SFATAPGSEFTLFVGDLAPNVTEAQLFELFISRY 174

Query: 187 PSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            S L+  +++D  TG S+GYGFV F ++ + Q A+  MQG  LNGR +R+   +K
Sbjct: 175 SSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSK 229

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 313 PNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKMQ 372

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 373 GFPIGNSRIRLSWGRS 388

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  + ++ LR+ F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 318 VFIGGLSTLITEDELRSYFQPF-----GQIVY-VKIPVGKGCGFVQYVDRISAETAISKM 371

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 372 QGFPIGNSRIRLSWG 386

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   ITED L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 315 NTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGC-----GFVQYVDRISAETAIS 369

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ ++++W 
Sbjct: 370 KMQGFPIGNSRIRLSWG 386

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 90/179 (50%), Gaps = 13/179 (7%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK+ F+ +GG ++              Y +V++     A  A++ 
Sbjct: 163 TIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKE 222

Query: 136 LNGKQIENNVVKINWAFXXXXXXXDD------------TFNLFVGDLNVNVDDETLRNAF 183
           + GK+I+   + ++ +        +D            +  LF+G+L+ N D + +   F
Sbjct: 223 MQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELF 282

Query: 184 KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
             +   +S  +    +T   +G+G+V +T+ +DA+ A++ +QG+ ++ RP+R++++  R
Sbjct: 283 SKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYSTPR 341

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 90/184 (48%), Gaps = 5/184 (2%)

Query: 49  QVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXX 107
           ++ DEQ    P+   + +  G  E S   LYVG LD ++TE +L   F  +G   +    
Sbjct: 16  RIQDEQ-PTGPTSTDSESTKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVC 72

Query: 108 XXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFV 167
                     YA+V +H  +    A++ LN   I+    +I W+          + N+F+
Sbjct: 73  RDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFI 132

Query: 168 GDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQ 227
            +L+  +D++ L + F  F + LS  +  D +TG SR +GFV F  ++ A+ A+D++ G 
Sbjct: 133 KNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFEEEEAAKEAIDAINGM 191

Query: 228 DLNG 231
            LNG
Sbjct: 192 LLNG 195

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 77/182 (42%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D    +D  ++ F   G I               + FV +   + A  A++ LN
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
                   + +  A        +                   NLFV +L+ ++DDE L+ 
Sbjct: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM D   GSS+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 242 RD 243
           ++
Sbjct: 402 KE 403

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VG+L+ +V +  L + F    S  S  V  D  T +S GY +V+F   +   TA++ 
Sbjct: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GRP RI W+ +
Sbjct: 101 LNYTPIKGRPCRIMWSQR 118

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 73/177 (41%), Gaps = 5/177 (2%)

Query: 71  RETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           R+     +++ NL  AI    L   F V G I               + FV + +   A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 131 IALQTLNGKQIENNVVKI--NWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF-KDFP 187
            A+  +NG  +    V +  + +        D+  + F      N+D ET ++ F K F 
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFS 242

Query: 188 SY--LSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
            Y  ++  V+     G  RG+GFV+F   + A  A++ +   D NG+ L +  A K+
Sbjct: 243 QYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 83/182 (45%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYV N++   T++  ++ F   GPI               + FV Y    DA  A++TLN
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 138 GKQIEN---------------NVVKINW-AFXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
             ++                 +V+K  + A+           NLFV +L+ +VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 242 RD 243
           +D
Sbjct: 400 KD 401

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 93/191 (48%), Gaps = 2/191 (1%)

Query: 47  SEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXX 105
           +EQ+++   ++D     A +     E S   LYVG+L+ +++E  L   F  +G   +  
Sbjct: 9   AEQLENLNIQDDQKQATAGSEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIR 68

Query: 106 XXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNL 165
                       YA+V ++       A++ LN   I+  + +I W+          + N+
Sbjct: 69  VCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNI 128

Query: 166 FVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQ 225
           F+ +L+ ++D++ L + F  F   LS  +  D + G S+G+GFV F  +  A+ A+D++ 
Sbjct: 129 FIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALN 187

Query: 226 GQDLNGRPLRI 236
           G  LNG+ + +
Sbjct: 188 GMLLNGQEIYV 198

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 76/179 (42%), Gaps = 7/179 (3%)

Query: 71  RETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           R+     +++ NL   I    L   F V G I               + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 131 IALQTLNGKQIENNVVKI--NWAFXXXXXXXDDT----FNLFVGDLNVNVDDETLRNAFK 184
            A+  LNG  +    + +  + +        ++T     NL+V ++N    DE  +  F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHFTNLYVKNINSETTDEQFQELFA 240

Query: 185 DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
            F   +S  +  D   G  +G+GFV++ + +DA  A++++   +LNG  L +  A K++
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVETLNDSELNGEKLYVGRAQKKN 298

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VGDL  +V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ 
Sbjct: 39  SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GR  RI W+ +
Sbjct: 99  LNYTPIKGRLCRIMWSQR 116

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 98/203 (48%), Gaps = 3/203 (1%)

Query: 43  SEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGP 101
           ++  +EQ++  + E   +     + T   ETS   LYVG L+  ++E +L   F  +G  
Sbjct: 5   TDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSV 64

Query: 102 IAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDD 161
            +              YA+V +H       A++ LN   I+    +I W+          
Sbjct: 65  SSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKG 124

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           + N+++ +L+  +D+++L   F  F + LS  V  D + G SRG+GFV F ++ DA+ A+
Sbjct: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAI 183

Query: 222 DSMQGQDLNGRPLRINW-AAKRD 243
           +++ G  +N + + +    +K+D
Sbjct: 184 EAVDGMLMNDQEVYVALHVSKKD 206

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D+  +++  ++ F   G I               + FV +     A  A+  LN
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
             + +   + +  A        +                   NLFV +L+ ++DDE L+ 
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM D +TG+SRG+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 242 RD 243
           ++
Sbjct: 400 KE 401

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 95/195 (48%), Gaps = 2/195 (1%)

Query: 43  SEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGP 101
           ++  +EQ+++   ++D       + +   E S   LYVG+L+ +++E  L   F  +G  
Sbjct: 5   TDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSV 64

Query: 102 IAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDD 161
            +              YA+V ++       A++ LN   I+  + +I W+          
Sbjct: 65  SSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKG 124

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           + N+F+ +L+ ++D++ L + F  F   LS  +  D + G S+G+GFV F  +  A+ A+
Sbjct: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAI 183

Query: 222 DSMQGQDLNGRPLRI 236
           D++ G  LNG+ + +
Sbjct: 184 DALNGMLLNGQEIYV 198

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 83/182 (45%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYV N++   T++  ++ F   GPI               + FV Y +  DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 138 GKQIEN---------------NVVKINW-AFXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
             ++                 +V+K  + A+           NLFV +L+ +VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 242 RD 243
           +D
Sbjct: 400 KD 401

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 75/179 (41%), Gaps = 7/179 (3%)

Query: 71  RETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           R+     +++ NL   I    L   F V G I               + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 131 IALQTLNGKQIENNVVKI--NWAFXXXXXXXDDT----FNLFVGDLNVNVDDETLRNAFK 184
            A+  LNG  +    + +  + +        ++T     NL+V ++N    DE  +  F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 185 DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
            F   +S  +  D   G  +G+GFV++   +DA  A++++   +LNG  L +  A K++
Sbjct: 241 KFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VGDL  +V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ 
Sbjct: 39  SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GR  RI W+ +
Sbjct: 99  LNYTPIKGRLCRIMWSQR 116

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 85/171 (49%), Gaps = 10/171 (5%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGP---IAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           LY+G+LD +  E  +K  +   G    +               + FVE+    +A+ AL 
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGEQNILVKLIRNAGTTTTNSGFCFVEFPSHLNASNALL 116

Query: 135 TLNGKQIENNV---VKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF-KDFPSYL 190
             NG  + N V   +K+NWA         + +++FVGDL  NV +  L   F   + S L
Sbjct: 117 K-NGLPVPNAVNKFLKLNWA--SISTTPGNEYSIFVGDLAPNVTEAQLFELFISRYSSTL 173

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
           +  +++D  TG S+GYGFV F ++ +   A+  MQG  LNGR +R++  +K
Sbjct: 174 NSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSK 224

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 278 PNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQ 337

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 338 GFPIGNSRIRLSWGRS 353

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 283 VFIGGLSSLVTEDELRTYFQPF-----GSIVY-VKIPVGKGCGFVQYIDRISAETAIAKM 336

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 337 QGFPIGNSRIRLSWG 351

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   +TED L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 280 NTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGC-----GFVQYIDRISAETAIA 334

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ ++++W 
Sbjct: 335 KMQGFPIGNSRIRLSWG 351

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 95/195 (48%), Gaps = 2/195 (1%)

Query: 43  SEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGP 101
           ++  +EQ+++   ++D       +     E S   LYVG+L+ A++E  L   F  +G  
Sbjct: 5   TDKTAEQLENLNIQDDQKQAATGSEGQSVENSSASLYVGDLEPAVSEAHLYDIFSPIGSV 64

Query: 102 IAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXXXXXDD 161
            +              YA+V ++       A++ LN   I+  + +I W+          
Sbjct: 65  SSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKG 124

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           + N+F+ +L+ ++D++ L + F  F   LS  +  D + G+S+G+GFV F  +  A+ A+
Sbjct: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGNSKGFGFVHFEEEVAAKEAI 183

Query: 222 DSMQGQDLNGRPLRI 236
           D++ G  LNG+ + +
Sbjct: 184 DALNGMLLNGQEIYV 198

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYV N++   T++  ++ F   GPI               + FV Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 138 -----------GKQIENN----VVKINW-AFXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
                      G+  + N    V+K  + A+           NLFV +L+  VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDTVDDEKLEE 340

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 341 EFAPYGTITSAKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 242 RD 243
           +D
Sbjct: 400 KD 401

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 76/179 (42%), Gaps = 7/179 (3%)

Query: 71  RETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           R+     +++ NL   I    L   F V G I               + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGNSKGFGFVHFEEEVAAK 180

Query: 131 IALQTLNGKQIENNVVKI--NWAFXXXXXXXDDT----FNLFVGDLNVNVDDETLRNAFK 184
            A+  LNG  +    + +  + +        ++T     NL+V ++N    DE  +  F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEMFV 240

Query: 185 DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
            F   +S  +  D   G  +G+GFV++ + +DA  A++++   DLNG  L +  A K++
Sbjct: 241 KFGPIVSASLEKDA-DGQLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKKN 298

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VGDL   V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ 
Sbjct: 39  SLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GR  RI W+ +
Sbjct: 99  LNYTPIKGRLCRIMWSQR 116

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 89/180 (49%), Gaps = 16/180 (8%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK+ F+ +GG I               Y +V++     A  A+Q 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 136 LNGKQIENNVVKINWA-------------FXXXXXXXDDTFNLFVGDLNVNVDDETLRNA 182
           + GK+I+   +  + +             F        DT  LF+G+L+ N D + +   
Sbjct: 229 MQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDT--LFLGNLSFNADRDAIFEL 286

Query: 183 FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           F      +S  +    +T   +G+G+V F++ +DA+ A+D++QG+ ++ RP+R+++++ R
Sbjct: 287 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 346

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 82/166 (49%), Gaps = 2/166 (1%)

Query: 72  ETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           E S   LYVG+L+ +++E  L   F  +G   +              YA+V ++      
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 131 IALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL 190
            A++ LN   I+  + +I W+          + N+F+ +L+ ++D++ L + F  F   L
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 236
           S  +  D + G S+G+GFV F  +  A+ A+D++ G  LNG+ + +
Sbjct: 154 SSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           LYV N++   T++  +  F   GPI               + FV Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 138 -----------GKQIENN----VVKINW-AFXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
                      G+  + N    V+K  + A+           NLFV +L+ +VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  + +  S  VM   + G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 341 EFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 242 RD 243
           +D
Sbjct: 400 KD 401

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 7/179 (3%)

Query: 71  RETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           R+     +++ NL   I    L   F V G I               + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 131 IALQTLNGKQIENNVVKI--NWAFXXXXXXXDDT----FNLFVGDLNVNVDDETLRNAFK 184
            A+  LNG  +    + +  + +        ++T     NL+V ++N    DE  ++ F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQDLFI 240

Query: 185 DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
            F   +S  +  D   G  +G+GFV++ + +DA  A++++   DLNG  L +  A K++
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKKN 298

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +L+VGDL  +V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ 
Sbjct: 39  SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98

Query: 224 MQGQDLNGRPLRINWAAK 241
           +    + GR  RI W+ +
Sbjct: 99  LNYTPIKGRLCRIMWSQR 116

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 90/182 (49%), Gaps = 18/182 (9%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK+ F+ +GG I+              Y +V++     A  A+Q 
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 207

Query: 136 LNGKQIENNVVKINWA---------------FXXXXXXXDDTFNLFVGDLNVNVDDETLR 180
           + GK+I+   +  + +               F        DT  LF+G+L+ N D + + 
Sbjct: 208 MQGKEIDGRPINCDMSTSKPASNNNNDRAKKFGDTPSEPSDT--LFLGNLSFNADRDVIF 265

Query: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240
             F      +S  +    +T   +G+G+V F++ +DA+ A+D++QG+ ++ RP+R+++++
Sbjct: 266 ELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSS 325

Query: 241 KR 242
            R
Sbjct: 326 PR 327

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 101/215 (46%), Gaps = 21/215 (9%)

Query: 44  EGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYF-QVGGPI 102
           EG+ E+      E++   V     T G+  +   ++VG L  ++ ++ LK  F  +GG +
Sbjct: 138 EGSKEESKKRSAESEDDAVAKKQKTDGQPAT---IFVGRLSWSVDDEWLKTEFDHIGGVV 194

Query: 103 AXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWA----------- 151
                          Y +V++     A  A++ ++GK+I+   +  + +           
Sbjct: 195 GARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPRED 254

Query: 152 ----FXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYG 207
               +        DT  LF+G+L+ N D + L   F    + +S  +    ++   +G+G
Sbjct: 255 RAKKYGDTPSQPSDT--LFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFG 312

Query: 208 FVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           +V + S ++AQ A+D++QG+ ++ RP+RI++++ R
Sbjct: 313 YVQYGSVEEAQAALDALQGEYIDNRPVRIDFSSPR 347

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 87/180 (48%), Gaps = 14/180 (7%)

Query: 77  VLYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK  F  +GG ++              Y +V++     A  A++ 
Sbjct: 188 TIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVKE 247

Query: 136 LNGKQIENNVVKINWAFXXXXXXXDD-------------TFNLFVGDLNVNVDDETLRNA 182
           ++GK+I+   +  + +         D             +  LF+G+L+ N D + +   
Sbjct: 248 MHGKEIDGRPINCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIYEM 307

Query: 183 FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           F  F   +S  +    +T   +G+G+V + + DDA+ A+D++QG+ ++ RP+R++++  R
Sbjct: 308 FSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYSTPR 367

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 7/128 (5%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENN---VVKINWAFXXXXXXXDDTFNLFVGDLNVNV 174
           Y FVE+    +A+ AL   NG  I N    ++K+NWA         + +++FVGD+  NV
Sbjct: 90  YCFVEFPSHTNASNALLK-NGLVIPNTGNRILKLNWA--SFATTPGNEYSVFVGDVAPNV 146

Query: 175 DDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRP 233
            +  L   F   + S L+  +++D  TG S+GYGFV F  + + Q ++  MQG  LNGR 
Sbjct: 147 TEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRA 206

Query: 234 LRINWAAK 241
           +R++  +K
Sbjct: 207 IRVSTTSK 214

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAETAIAKMQ 329

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 330 GFPIGNSRIRLSWGRS 345

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 275 VFIGGLSSLVTEDELRAFFQPF-----GSIVY-VKIPVGKGCGFVQYVDRLSAETAIAKM 328

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 329 QGFPIGNSRIRLSWG 343

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   +TED L+ +FQ  G I                 FV+Y     A  A+ 
Sbjct: 272 NTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGC-----GFVQYVDRLSAETAIA 326

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ ++++W 
Sbjct: 327 KMQGFPIGNSRIRLSWG 343

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 83/171 (48%), Gaps = 15/171 (8%)

Query: 77  VLYVGNLDKAITEDILKQ-YFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
           VLY+G+LD +  E ++ Q +  +G P                Y F+ +  S  A+ AL  
Sbjct: 33  VLYMGDLDLSWDERVVSQIWASLGEP-------NVSVKMMNRYCFITFLDSLTASNALLK 85

Query: 136 LNGKQIEN---NVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF-KDFPSYLS 191
            NG  I       +K+NWA         + +++FVGDL+ NV +  L + F   + S   
Sbjct: 86  -NGMLIPGYGGKRLKLNWA--QASSNASNGYSIFVGDLSPNVTEAQLFDLFINKYASTDH 142

Query: 192 GHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
             +++D  TG SRGYGFV F S  D Q A+  MQG  LNGR ++I     +
Sbjct: 143 AKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNGRAIKIGMTGNK 193

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +    TE +L   F+ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 241 PNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQ 300

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 301 GFPIANSRIRLSWGRS 316

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+  V ++ LR  FK F     G +++ ++    +G GFV +  +  A+ A+  M
Sbjct: 246 VFVGGLSSLVTEDELREYFKPF-----GTIVY-VKIPVGKGCGFVQYIDRVSAENAISKM 299

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 300 QGFPIANSRIRLSWG 314

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 74  SDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIAL 133
           ++  ++VG L   +TED L++YF+  G I                 FV+Y     A  A+
Sbjct: 242 NNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGC-----GFVQYIDRVSAENAI 296

Query: 134 QTLNGKQIENNVVKINWA 151
             + G  I N+ ++++W 
Sbjct: 297 SKMQGFPIANSRIRLSWG 314

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 78/155 (50%), Gaps = 2/155 (1%)

Query: 78  LYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           LYVG LD ++TE +L   F  +G   +              YA+V +H  +    A++ L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N   I+    +I W+          + N+F+ +L+  +D++ L + F  F + LS  +  
Sbjct: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT 161

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
           D +TG SR +GFV F  ++ A+ A+D++ G  LNG
Sbjct: 162 D-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNG 195

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 17/182 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           +YV N+D   T++  ++ F   G I               + FV +   + A  A + LN
Sbjct: 223 VYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGKLRGFGFVNFEDHNAALKACEELN 282

Query: 138 GKQIENNVVKINWAFXXXXXXXD----------------DTFNLFVGDLNVNVDDETLRN 181
               +   + +  A        +                   NLFV +L+ +VDD+ L  
Sbjct: 283 DTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSVDDQKLEE 342

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F +  S  VM D + G+S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-EAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 242 RD 243
           ++
Sbjct: 402 KE 403

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           L+VG+L+ +V +  L + F    S  S  V  D  T +S GY +V+F   +  +TA++ +
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 225 QGQDLNGRPLRINWAAK 241
               + GRP RI W+ +
Sbjct: 102 NYTPIKGRPCRIMWSQR 118

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 86/180 (47%), Gaps = 14/180 (7%)

Query: 77  VLYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK  F  +GG ++              Y +V++   H A  A++ 
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 136 LNGKQIENNVVKINWAFXXXXXXXDD-------------TFNLFVGDLNVNVDDETLRNA 182
           ++GK+I+   +  + +         D             +  LF+G+L+ N D + L   
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 183 FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           F      +S  +    +T   +G+G+V + S DDA+ A +++QG+ ++ RP+R++++  R
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSIPR 353

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 86/190 (45%), Gaps = 11/190 (5%)

Query: 64  ANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX-----XXXXXXXXXXY 118
            N    G ++ +  LY+G+LD +  E++++  +   G                      Y
Sbjct: 36  GNVRLSGSQSRNNQLYMGDLDPSWDENVIRSIWNSLGESNVEIKLMWNNRNAGVRTHLGY 95

Query: 119 AFVEYHQSHDANIALQTLNGKQIE---NNVVKINWAFXXXXXX-XDDTFNLFVGDLNVNV 174
            FV++     A+ AL   NG  I    +  +++NW+          +  ++FVGDL  NV
Sbjct: 96  CFVQFSSRSQASNALLK-NGMAIPGYPSKTLRLNWSSASGNSADGSNEISVFVGDLAPNV 154

Query: 175 DDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRP 233
            +  L   F    PS  +  VM+D  TG S+GY FV F +Q+D Q A+  M G  L GR 
Sbjct: 155 TESDLFELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRA 214

Query: 234 LRINWAAKRD 243
           +R+  A  ++
Sbjct: 215 IRVGSAGHQN 224

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%)

Query: 343 TTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 402
           TT ++ ++ H  TE +L   FQ FG ++  K    K C F++Y     A + I+ L  FP
Sbjct: 279 TTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENKQCGFVQYVDRASAEMAILKLQGFP 338

Query: 403 FQGRNLRTGWGK 414
            +G  ++  WG+
Sbjct: 339 IRGSRIKISWGR 350

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 8/89 (8%)

Query: 63  PANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVE 122
           P N+ T   + ++  L+V +L   +TE+ LK +FQ  G +                 FV+
Sbjct: 269 PLNSFT---DRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENKQC-----GFVQ 320

Query: 123 YHQSHDANIALQTLNGKQIENNVVKINWA 151
           Y     A +A+  L G  I  + +KI+W 
Sbjct: 321 YVDRASAEMAILKLQGFPIRGSRIKISWG 349

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFV  L+  V +  L+  F+ F     G+V++  +   ++  GFV +  +  A+ A+  +
Sbjct: 281 LFVSSLSHMVTENELKAFFQPF-----GNVIY-AKLPENKQCGFVQYVDRASAEMAILKL 334

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G  ++I+W 
Sbjct: 335 QGFPIRGSRIKISWG 349

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 85/171 (49%), Gaps = 10/171 (5%)

Query: 78  LYVGNLDKAITEDILKQ-YFQVGGP--IAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           LY+G+LD +  E+ ++  +  +G P                  Y FVE+    +A+ AL 
Sbjct: 45  LYMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEFPSHLNASNALL 104

Query: 135 TLNGKQI---ENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF-KDFPSYL 190
             NG  I    N  +K+NWA         +  ++FVGD+  NV +  L   F   + S L
Sbjct: 105 K-NGLLIPNARNRYLKLNWA--SFATAPGNEHSVFVGDIAPNVSEAQLFELFISRYASTL 161

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
           +  +++D  TG S+GYGFV F  + + Q A+  MQG  LNGR +R++  +K
Sbjct: 162 NAKIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSK 212

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    +E +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 329

Query: 400 NFPFQGRNLRTGWGKE 415
            +P     +R  WG+ 
Sbjct: 330 GYPIGNSRIRLSWGRS 345

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 275 VFIGGLSSLVSEDELRAYFQPF-----GSIVY-VKIPVGKGCGFVQYVDRISAETAIAKM 328

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 329 QGYPIGNSRIRLSWG 343

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   ++ED L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 272 NTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGC-----GFVQYVDRISAETAIA 326

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ ++++W 
Sbjct: 327 KMQGYPIGNSRIRLSWG 343

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 87/178 (48%), Gaps = 12/178 (6%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK+ F+ +GG +               Y +V++     A  A+Q 
Sbjct: 172 TIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQE 231

Query: 136 LNGKQIENNVVKINWAFXXXXXXXDD-----------TFNLFVGDLNVNVDDETLRNAFK 184
           + GK+I+   + ++ +        D            +  LF+G+L+ N D + +   F 
Sbjct: 232 MQGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETFS 291

Query: 185 DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
            +   +S  +    +T   +G+G+V F++ +DA+ A++ +QG+ ++ R +R++++  R
Sbjct: 292 KYGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYSTPR 349

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 79/170 (46%), Gaps = 8/170 (4%)

Query: 73  TSDRVLYVGNLDKAITEDILKQYFQVGGP--IAXXXXXXXXXXXXXXYAFVEYHQSHDAN 130
           T    LY+G+LD    E++++Q ++  G   +               Y FVE+      N
Sbjct: 44  TGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGN 103

Query: 131 IALQTLNGKQIEN---NVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAF-KDF 186
            AL   NG  I       +K+NWA        +  F++FVGDL+ NV +  L   F   +
Sbjct: 104 NALLK-NGIVIPGFPQRRLKLNWA-SAGANGNNSGFSVFVGDLSPNVTEAQLFELFIGRY 161

Query: 187 PSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 236
           PS     V+ D  TG S+ YGFV F S  D Q  +  MQG  LNGR +++
Sbjct: 162 PSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKV 211

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    +E DL   FQ FG I+  K    KGC F++Y     A + I  + 
Sbjct: 280 PNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISKMQ 339

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 340 GFPLANSRIRLSWGRS 355

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++  + +G GFV +  +  A+ A+  M
Sbjct: 285 VFIGGLSSLVSEDDLRQYFQPF-----GDIIY-VKIPTGKGCGFVQYVDRLSAELAISKM 338

Query: 225 QGQDLNGRPLRINWA 239
           QG  L    +R++W 
Sbjct: 339 QGFPLANSRIRLSWG 353

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 74  SDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIAL 133
           ++  +++G L   ++ED L+QYFQ  G I                 FV+Y     A +A+
Sbjct: 281 NNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGC-----GFVQYVDRLSAELAI 335

Query: 134 QTLNGKQIENNVVKINWA 151
             + G  + N+ ++++W 
Sbjct: 336 SKMQGFPLANSRIRLSWG 353

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 96/210 (45%), Gaps = 23/210 (10%)

Query: 46  NSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAX 104
           N  + DD++ E   S  P   + G   T    ++VG L  +I ++ LK  F+ +GG I+ 
Sbjct: 171 NKRKADDDE-EKSESKKPKTELAGEPAT----IFVGRLSWSIDDEWLKTEFEPIGGVISA 225

Query: 105 XXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWA------------- 151
                        Y +V++     A  A++ ++GK+I+   +  + +             
Sbjct: 226 RVMYERGTDRSRGYGYVDFEDKSYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRA 285

Query: 152 --FXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFV 209
             F        DT  LF+G+L+   D + L   F  +   +S  +    +T   +G+G+V
Sbjct: 286 KKFGDVPSEPSDT--LFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYV 343

Query: 210 SFTSQDDAQTAMDSMQGQDLNGRPLRINWA 239
            + S +DA  A + +QG+ +N RP+R++++
Sbjct: 344 QYGSIEDATKAFEGLQGEYINNRPVRLDYS 373

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+ ++DDE L+  F+     +S  VM++  T  SRGYG+V F  +  A+ A+  M
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 225 QGQDLNGRPLRINWAAKR 242
            G++++GRP+  + +  +
Sbjct: 258 HGKEIDGRPINCDMSTSK 275

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 86/188 (45%), Gaps = 26/188 (13%)

Query: 73  TSDRVLYVGNLDKAITEDILKQYFQVGG------------PIAXXXXXXXXXXXXXXYAF 120
           T+   LY+G+LD    ++ ++Q +   G            P                Y F
Sbjct: 41  TTGNQLYMGDLDPTWDKNTIRQIWTSLGEANVNVRMMWNNPSNSGSRPSVGPKNNQGYCF 100

Query: 121 VEYHQS-HDANIALQTLNGKQIEN---NVVKINWA-------FXXXXXXXDDTFNLFVGD 169
           +++  S H AN  L+  NG  I N     +K+NWA                +++++FVGD
Sbjct: 101 IDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFVGD 158

Query: 170 LNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQD 228
           L  NV +  L   F + + S     ++ D  TG S+GYGFV FT+ D+ Q A+  MQG  
Sbjct: 159 LAPNVTESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQGVF 218

Query: 229 LNGRPLRI 236
           LNGR +++
Sbjct: 219 LNGRAIKV 226

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 302 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAEAAIAGMQ 361

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 362 GFPIANSRVRLSWGRS 377

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   +TED L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 304 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGC-----GFVQYVDRLSAEAAIA 358

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ V+++W 
Sbjct: 359 GMQGFPIANSRVRLSWG 375

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+ A+  M
Sbjct: 307 VFIGGLSSLVTEDELRAYFQPF-----GTIVY-VKIPVGKGCGFVQYVDRLSAEAAIAGM 360

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 361 QGFPIANSRVRLSWG 375

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 48/72 (66%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+  V +ETL+  F  FPS++S  V  D  T  S G+G+++F  +++A+ AM+ +
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 225 QGQDLNGRPLRI 236
              D+NGR +RI
Sbjct: 153 NYTDVNGREIRI 164

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/158 (18%), Positives = 64/158 (40%), Gaps = 4/158 (2%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++G+L + +TE+ LK  F +    ++              + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N   +    ++I  +        +   N+F  +L +N    T R  +  F  Y  G ++ 
Sbjct: 153 NYTDVNGREIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRY--GKIL- 209

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
             +  S +  GFV F ++  A+  +         G+ +
Sbjct: 210 SCKLDSRKDIGFVYFENEKTARNVIKMYNNTSFFGKKI 247

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 68/144 (47%), Gaps = 20/144 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQI---------------ENNVVKINWAFXXXXXXX--- 159
           Y FVE+    DA  AL +LN   I                N   ++NWA           
Sbjct: 131 YCFVEFANQVDAKFAL-SLNSSPIPNFYSSSISLHTNPNNNRNFRLNWASGATLNSSIPL 189

Query: 160 DDTFNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+  V +  L + F K F S  +  VM D  TG+SR +GF+ FT + + +
Sbjct: 190 TPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTDPITGTSRCFGFIRFTDELERK 249

Query: 219 TAMDSMQGQDLNGRPLRINWAAKR 242
            A+  M G   NGRPLR+ +A  R
Sbjct: 250 NALIEMNGIWCNGRPLRVAYATPR 273

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 27/185 (14%)

Query: 78  LYVGNLDKAITEDILKQYFQVGG------PIAXXXXXXXXXXXXXXYAFVEYHQSHDANI 131
           LY+G+LD    E  +KQ +   G       I               Y F+E+   ++A+ 
Sbjct: 64  LYMGDLDPMWDESTIKQIWNSLGENNIVVKIITNSNMTSMGRNNPGYCFIEFSNYNNASN 123

Query: 132 ALQTLNGKQI---ENNVVKINWAFXXXXXXXDDT----------------FNLFVGDLNV 172
           AL   NG  I    + V+K+NWA        +                  F++FVGDL  
Sbjct: 124 ALLK-NGLVIPGYNSKVLKLNWASMHTRSNGNTNCTANNNTSSNNSTNNDFSVFVGDLAP 182

Query: 173 NVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
           NV +  L + F + + S +   +++D  T  S+GYGFV F +  D Q +++ MQG  LNG
Sbjct: 183 NVTEAQLFDLFINRYSSTIHAKIVYDQMTNVSKGYGFVRFNNSADQQRSLNEMQGVFLNG 242

Query: 232 RPLRI 236
           R +R+
Sbjct: 243 RSIRV 247

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    +E +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 337 PNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQ 396

Query: 400 NFPFQGRNLRTGWGK 414
            FP     +R  WG+
Sbjct: 397 GFPIGNSRIRLSWGR 411

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V +  LR+ F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 342 VFIGGLSSLVSEGELRSYFQPF-----GTIVY-VKIPVGKGCGFVQYVDRSAAETAISKM 395

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 396 QGFPIGNSRIRLSWG 410

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   ++E  L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 339 NTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGC-----GFVQYVDRSAAETAIS 393

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ ++++W 
Sbjct: 394 KMQGFPIGNSRIRLSWG 410

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 84/192 (43%), Gaps = 22/192 (11%)

Query: 70  GRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXX-----XXXXXXXXXYAFVEYH 124
           G  T    LY+G+LD +  E ++K  +   G                      Y FVE+ 
Sbjct: 78  GASTPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFP 137

Query: 125 QSHDANIALQTLNGKQIENNV---VKINWAFXXXXXXXDDTF------------NLFVGD 169
               A+ AL   NG +I   V   +K+NW+          +             ++FVGD
Sbjct: 138 SPAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGD 196

Query: 170 LNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQD 228
           L  +V +  L + F   +PS +   VM+D  TG S+GYGFV F S  D Q A+  MQG  
Sbjct: 197 LAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCF 256

Query: 229 LNGRPLRINWAA 240
           LNGR ++I  A 
Sbjct: 257 LNGRAIKIGIAG 268

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +    TE +L   F+ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 324 PNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQ 383

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 384 GFPIANSRVRLSWGRS 399

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+  V ++ LR+ F+ F     G +++ ++  + +G GFV +  +  A+TA+  M
Sbjct: 329 VFVGGLSPLVTEDELRSYFEPF-----GTIIY-VKIPAGKGCGFVQYVERSSAETAITKM 382

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 383 QGFPIANSRVRLSWG 397

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  ++VG L   +TED L+ YF+  G I                 FV+Y +   A  A+ 
Sbjct: 326 NTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGC-----GFVQYVERSSAETAIT 380

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ V+++W 
Sbjct: 381 KMQGFPIANSRVRLSWG 397

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 87/193 (45%), Gaps = 29/193 (15%)

Query: 70  GRETSDRVLYVGNLDKAITEDILKQYFQVGG------------PIAXXXXXXXXXXXXXX 117
           G  T+   LY+G+LD    ++ ++Q +   G             +               
Sbjct: 48  GSGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNSLNNGSRSPMGSKNNQG 107

Query: 118 YAFVEYHQS-HDANIALQTLNGKQIEN---NVVKINWAFXXXXXXXDDTFN--------- 164
           Y FV++  S H AN  L+  NG  I N     +K+NWA        + TFN         
Sbjct: 108 YCFVDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWA-TSSYSSGNSTFNNVKSSNNCS 164

Query: 165 LFVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +FVGDL  NV +  L   F + + S     V+ D  TG S+GYGFV F + D+ Q+A+  
Sbjct: 165 VFVGDLAPNVTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQSALLE 224

Query: 224 MQGQDLNGRPLRI 236
           MQG  LNGR +++
Sbjct: 225 MQGVFLNGRAIKV 237

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIARMQ 369

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 370 GFPIANSRVRLSWGRS 385

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPF-----GTIVY-VKIPVGKGCGFVQYVDRLSAETAIARM 368

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 369 QGFPIANSRVRLSWG 383

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   +TED L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGC-----GFVQYVDRLSAETAIA 366

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ V+++W 
Sbjct: 367 RMQGFPIANSRVRLSWG 383

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 85/179 (47%), Gaps = 13/179 (7%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK  F+ +GG ++              Y +V++     A  A++ 
Sbjct: 162 TIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKE 221

Query: 136 LNGKQIENNVVKINWAFXXXXXXXDD------------TFNLFVGDLNVNVDDETLRNAF 183
           + GK+I+   +  + +         D            +  LF+G+L+ + D + +   F
Sbjct: 222 MQGKEIDGRPINCDMSTSKPASNGGDRAKKFGDTPSEPSETLFLGNLSFDADRDNIYEVF 281

Query: 184 KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
             +   +S  +    +T   +G+G+V +   + A+ A+D++QG+ +N RP+R++++  R
Sbjct: 282 SKYGEIISVRIPTHPETEQPKGFGYVQYGDVESAKKALDALQGEYINNRPVRLDFSTPR 340

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (47%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXXXDDT 162
           Y FVE+    DA  AL +LN   + N                  ++NWA          +
Sbjct: 129 YCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASGATLQSSIPS 187

Query: 163 ---FNLFVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TGSSR +GFV F ++D+ +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G+   GR LR+ +A  R+
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPRN 272

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +     E  L  LF+ FG IL+ +    K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 400 NFPFQGRNLRTGWGKERS 417
            F   G  +R  WG+  S
Sbjct: 416 GFIVGGSPIRLSWGRPSS 433

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L     +  LR+ FK F   L      +++  + +  GFV F  + DA+ ++  +
Sbjct: 361 VFVGGLVPKTAEFQLRSLFKPFGPIL------NVRIPNGKNCGFVKFEKRIDAEASIQGL 414

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 415 QGFIVGGSPIRLSWG 429

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 346 YIGNIPHFATEADLIPLFQN-FGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEADL+ LFQ  F  +   +    P  G      F+++   ++    ++ +
Sbjct: 194 FVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERRRALIEM 253

Query: 399 ANFPFQGRNLRTGWGKERSNFM 420
           +   FQGR LR  +   R+N M
Sbjct: 254 SGKWFQGRALRVAYATPRNNMM 275

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 87/179 (48%), Gaps = 18/179 (10%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  ++ ++ LK  F+ +GG I+              Y +V++     A  A++ 
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKE 316

Query: 136 LNGKQIENNVVKINWA---------------FXXXXXXXDDTFNLFVGDLNVNVDDETLR 180
           ++GK+I+   +  + +               F        DT  LF+G+L+ N D + + 
Sbjct: 317 MHGKEIDGRPINCDMSTSKPAGNPRNDRAKQFGDTPSQPSDT--LFLGNLSFNADRDNIF 374

Query: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWA 239
             F +    +S  +    +T   +G+G+V ++S D+AQ A +++QG  ++ RP+R++++
Sbjct: 375 ETFAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFS 433

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+ +VDDE L+  F+     +S  V+ +  T  SRGYG+V F ++  A+ A+  M
Sbjct: 258 IFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKEM 317

Query: 225 QGQDLNGRPLRINWAAKR 242
            G++++GRP+  + +  +
Sbjct: 318 HGKEIDGRPINCDMSTSK 335

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 82/188 (43%), Gaps = 27/188 (14%)

Query: 75  DRVLYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXX-----------XXXXXYAFVE 122
           + VLY+G LD +  E ++K  + +VG P                           Y FVE
Sbjct: 42  NNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKSNLGYCFVE 101

Query: 123 YHQSHDANIALQTLNGKQI---ENNVVKINW----------AFXXXXXXXDDTFNLFVGD 169
           +     A+ A+   NG  I   +    K+NW                    + +++FVGD
Sbjct: 102 FSTHETASNAIMK-NGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSNDYSVFVGD 160

Query: 170 LNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQD 228
           L  NV +  L N FK  + S LS  ++ D  T  S+GYGF+ F  Q+D   A+  MQ + 
Sbjct: 161 LGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDALSKMQNKI 220

Query: 229 LNGRPLRI 236
           LNGR +++
Sbjct: 221 LNGRGIKV 228

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 70  GRETSDRVLYVGNLDKAITEDILKQYFQ--VGGPIAXXXXXXXXXXXXXXYAFVEYHQSH 127
           G +++D  ++VG+L + +TE  L   F+      ++              Y F+++H  +
Sbjct: 148 GPQSNDYSVFVGDLGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQN 207

Query: 128 DANIALQTLNGKQIENNVVKI 148
           D N AL  +  K +    +K+
Sbjct: 208 DYNDALSKMQNKILNGRGIKV 228

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (47%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXXXDDT 162
           Y FVE+    DA  AL +LN   + N                  ++NWA          +
Sbjct: 129 YCFVEFETQTDAQFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPS 187

Query: 163 ---FNLFVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TGSSR +GFV F ++D+ +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G+   GR LR+ +A  R+
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPRN 272

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +    TE  L  LF+ FG IL+ +    K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 400 NFPFQGRNLRTGWGKERS 417
            F   G  +R  WG+  S
Sbjct: 416 GFIVGGSPIRLSWGRPSS 433

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L     +  LR+ FK F   L      +++  + +  GFV F  + DA+ ++  +
Sbjct: 361 VFVGGLGPKTTEFQLRSLFKPFGPIL------NVRIPNGKNCGFVKFEKRIDAEASIQGL 414

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 415 QGFIVGGSPIRLSWG 429

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 346 YIGNIPHFATEADLIPLFQN-FGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEADL+ LFQ  F  +   +    P  G      F+++   ++    ++ +
Sbjct: 194 FVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERRRALIEM 253

Query: 399 ANFPFQGRNLRTGWGKERSNFM 420
           +   FQGR LR  +   R+N M
Sbjct: 254 SGKWFQGRALRVAYATPRNNMM 275

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 52/115 (45%), Gaps = 9/115 (7%)

Query: 37  AEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYF 96
           A QNV S   +E  +    +N+   +P+N  T   + ++  ++VG L    TE  L+  F
Sbjct: 324 ALQNVHSVHLNESSNSNMRQNE--SLPSN--TFNTDPTNTTVFVGGLGPKTTEFQLRSLF 379

Query: 97  QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWA 151
           +  GPI                 FV++ +  DA  ++Q L G  +  + ++++W 
Sbjct: 380 KPFGPILNVRIPNGKNC-----GFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           ++F LF+G LN  V  E L+  FKDFPS++S  V  DM+T  S GYG+++F++Q+D    
Sbjct: 92  NSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFSNQNDILRL 151

Query: 221 MDSMQGQDLNGRP 233
           ++    + L G P
Sbjct: 152 VEKYNYRSLFGCP 164

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 86/178 (48%), Gaps = 15/178 (8%)

Query: 77  VLYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  +I ++ LK  F  +GG I               Y +V++     A  A++ 
Sbjct: 158 TIFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKE 217

Query: 136 LNGKQIENNVVKINWAFXXXXXX--------------XDDTFNLFVGDLNVNVDDETLRN 181
           ++GK+I+   +  + +                      + +  LF+G+L+ N D +++  
Sbjct: 218 MHGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWE 277

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWA 239
            F  F   +S  +    +T   +G+G+V + + DDA+ A++++QG+ ++ RP+R++++
Sbjct: 278 MFSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYS 335

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (58%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+ ++DDE L+N F      +   VM +  T  SRGYG+V F+ +  A+ A+  M
Sbjct: 159 IFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKEM 218

Query: 225 QGQDLNGRPLRINWAAKR 242
            G++++GR +  + +  +
Sbjct: 219 HGKEIDGREINCDMSTSK 236

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (47%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXXXDDT 162
           Y FVE+    DA  AL +LN   + N                  ++NWA          +
Sbjct: 129 YCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASGATLQSSIPS 187

Query: 163 ---FNLFVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TGSSR +GFV F ++D+ +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G+   GR LR+ +A  R+
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPRN 272

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +    TE  L  LF+ FG IL+ +    K C F+K++    A   I  L 
Sbjct: 353 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 412

Query: 400 NFPFQGRNLRTGWGKERS 417
            F   G  +R  WG+  S
Sbjct: 413 GFIVGGSPIRLSWGRPSS 430

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L     +  LR+ FK F   L      +++  + +  GFV F  + DA+ ++  +
Sbjct: 358 VFVGGLVPKTTEFQLRSLFKPFGPIL------NVRIPNGKNCGFVKFEKRIDAEASIQGL 411

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 412 QGFIVGGSPIRLSWG 426

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 346 YIGNIPHFATEADLIPLFQN-FGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEADL+ LFQ  F  +   +    P  G      F+++   ++    ++ +
Sbjct: 194 FVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERRRALIEM 253

Query: 399 ANFPFQGRNLRTGWGKERSNFM 420
           +   FQGR LR  +   R+N M
Sbjct: 254 SGKWFQGRALRVAYATPRNNMM 275

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 68/145 (46%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXXXDDT 162
           Y FVE+    DA  AL +LN   + N                  ++NWA          +
Sbjct: 130 YCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPS 188

Query: 163 ---FNLFVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TGSSR +GFV F  +D+ +
Sbjct: 189 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERR 248

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G+   GR LR+ +A  R+
Sbjct: 249 RALIEMSGKWFQGRALRVAYATPRN 273

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +    TE  L  LF+ FG IL+ +    K C F+K++    A   I  L 
Sbjct: 357 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 400 NFPFQGRNLRTGWGKERS 417
            F   G  +R  WG+  S
Sbjct: 417 GFIVGGSPIRLSWGRPSS 434

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L     +  LR+ FK F   L      +++  + +  GFV F  + DA+ ++  +
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPIL------NVRIPNGKNCGFVKFEKRIDAEASIQGL 415

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 416 QGFIVGGSPIRLSWG 430

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 346 YIGNIPHFATEADLIPLFQN-FGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEADL+ LFQ  F  +   +    P  G      F+++   ++    ++ +
Sbjct: 195 FVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIEM 254

Query: 399 ANFPFQGRNLRTGWGKERSNFM 420
           +   FQGR LR  +   R+N M
Sbjct: 255 SGKWFQGRALRVAYATPRNNMM 276

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 146 VKINWAFXXX------XXXXDDTFNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDM 198
           +K+NWA               + F++FVGDL  NV +  L + F   +PS     V+ D+
Sbjct: 135 LKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQLFDLFISRYPSTEHAKVVIDL 194

Query: 199 QTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240
            TG S+GYGF+ F    D QTA+  MQG  LNGR L++  ++
Sbjct: 195 STGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGMSS 236

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 323 PPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCF 382
           P Q  P A++H      P  TT +IG +     E +L   FQ FG I+  K    KGC F
Sbjct: 278 PIQQQP-ALNHF---TDPNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGCGF 333

Query: 383 IKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 415
           ++Y     A   I  +  FP     +R  WG+ 
Sbjct: 334 VQYIDRISAETAISQMQGFPISNSRVRLSWGRS 366

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V +E LR  F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 296 VFIGGLSPLVKEEELRQYFQPF-----GEIVY-VKIPVGKGCGFVQYIDRISAETAISQM 349

Query: 225 QGQDLNGRPLRINWA 239
           QG  ++   +R++W 
Sbjct: 350 QGFPISNSRVRLSWG 364

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   + E+ L+QYFQ  G I                 FV+Y     A  A+ 
Sbjct: 293 NTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGC-----GFVQYIDRISAETAIS 347

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ V+++W 
Sbjct: 348 QMQGFPISNSRVRLSWG 364

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+ NV ++ L + F+ FPS +S  +  D +TG S GYG+++F S  DA+TA+++ 
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 225 QGQDLNGRPLRI 236
              +L GR +RI
Sbjct: 77  SYVNLFGREVRI 88

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 70/162 (43%), Gaps = 6/162 (3%)

Query: 73  TSDRV--LYVGNLDKAITEDILKQYFQVG-GPIAXXXXXXXXXXXXXXYAFVEYHQSHDA 129
           TS +V  L++G+LD  +TE +L   F+V    I+              Y ++ ++ S DA
Sbjct: 10  TSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDA 69

Query: 130 NIALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSY 189
             A++T +   +    V+I  +        +   N+F  +L +     T R  ++ F  Y
Sbjct: 70  ETAIETFSYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREY 129

Query: 190 LSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
             G V+   +    +  GFV F S   A+ A+ S   ++  G
Sbjct: 130 --GKVL-SCKLDRRKNIGFVYFESDAAARKAIASYNNKEYYG 168

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 49/126 (38%), Gaps = 15/126 (11%)

Query: 37  AEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYF 96
           A++N+ SE N E  + +Q   DP     N+I           +V NL   I  + L  YF
Sbjct: 200 AKENLLSENNVELENHDQNSKDPH---PNSI-----------HVKNLPFNICNEDLLNYF 245

Query: 97  QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFXXXX 156
              GP+               + FV Y +  D   AL +LNG    +  +++N A     
Sbjct: 246 SRIGPVK-SVFTSKLEAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALKNNG 304

Query: 157 XXXDDT 162
              D T
Sbjct: 305 DRRDGT 310

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 82/187 (43%), Gaps = 13/187 (6%)

Query: 69  GGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXYAFVEYHQSH 127
            G +  D  +YVGN+D +IT+++L + F    PIA               YAF++++   
Sbjct: 6   SGFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDFYTEE 65

Query: 128 DANIALQTLNGK-QIENNVVKINWAFXXXXXXXDDTFN----------LFVGDLNVNVDD 176
           DAN A+Q  N   Q+ N V+K+               +          +FV +L+ +VD 
Sbjct: 66  DANYAIQAFNNNVQLNNRVLKVRKTNNNISSKSSTNLSQATSVTPYAKIFVKNLDSSVDV 125

Query: 177 ETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 236
             L   FK F S      ++ +  G  R   +V F   + A  A+ S+ GQ +  + + I
Sbjct: 126 AYLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNKRINI 184

Query: 237 NWAAKRD 243
            +A K +
Sbjct: 185 EYAFKEN 191

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 67/132 (50%), Gaps = 15/132 (11%)

Query: 118 YAFVEYHQS-HDANIALQTLNGKQIEN---NVVKINWA--------FXXXXXXXDDTFNL 165
           Y FV++  S H AN  L+  NG  I N     +K+NWA                 +  ++
Sbjct: 108 YCFVDFPSSTHAANALLK--NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSI 165

Query: 166 FVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           FVGDL  NV +  L   F + + S     ++ D  TG S+GYGFV FT+ D+ Q A+  M
Sbjct: 166 FVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEM 225

Query: 225 QGQDLNGRPLRI 236
           QG  LNGR +++
Sbjct: 226 QGVFLNGRAIKV 237

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 34/76 (44%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L   FQ FG I+  K    K C F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQ 369

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 370 GFPIANSRVRLSWGRS 385

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           +  +++G L   +TED L+ YFQ  G I                 FV+Y     A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCC-----GFVQYVDRLSAEAAIA 366

Query: 135 TLNGKQIENNVVKINWA 151
            + G  I N+ V+++W 
Sbjct: 367 GMQGFPIANSRVRLSWG 383

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +  GFV +  +  A+ A+  M
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPF-----GTIVY-VKIPVGKCCGFVQYVDRLSAEAAIAGM 368

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 369 QGFPIANSRVRLSWG 383

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (47%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXXXDDT 162
           Y FVE+ +  DA  AL TLN   + N                  ++NWA          +
Sbjct: 114 YCFVEFQKLEDAQWAL-TLNSTPLPNILSNSTHSQTNPTLQRSFRLNWASGATLQSAIPS 172

Query: 163 ---FNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+ +  +  L + F K+F S  +  VM D  TG+SR +GFV F  + + +
Sbjct: 173 TPEFSLFVGDLSPSATEAHLLSLFQKNFKSVKTVRVMTDPITGASRCFGFVRFADEQERR 232

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G    GR LR+ +A  R+
Sbjct: 233 RALVEMNGVWCQGRCLRVAYATPRN 257

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P+ TT +IG +    +E  L  LF  FG I + +    KGC F+K+++   A   I  + 
Sbjct: 364 PKNTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQ 423

Query: 400 NFPFQGRNLRTGWGKERSNFMP 421
            F   G  +R  WG+      P
Sbjct: 424 GFIVGGNPIRLSWGRSSGEKTP 445

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L   + +  L + F  F S        +++    +G GFV F S+ DA+ A+  M
Sbjct: 369 VFIGGLASQISEPQLYSLFLPFGSIT------NVRIPQGKGCGFVKFESRIDAEAAIQGM 422

Query: 225 QGQDLNGRPLRINW 238
           QG  + G P+R++W
Sbjct: 423 QGFIVGGNPIRLSW 436

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 59  PSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXY 118
           P+ +P N+ T  + T+   +++G L   I+E  L   F   G I                
Sbjct: 353 PTSIPKNSYTNPKNTT---VFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKG-----C 404

Query: 119 AFVEYHQSHDANIALQTLNGKQIENNVVKINW 150
            FV++    DA  A+Q + G  +  N ++++W
Sbjct: 405 GFVKFESRIDAEAAIQGMQGFIVGGNPIRLSW 436

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 49/78 (62%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+ N+DD+ L+N F+      S  V+++  +  SRGYG+V FT +  A+ A+  M
Sbjct: 238 IFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKEM 297

Query: 225 QGQDLNGRPLRINWAAKR 242
            G++L+GRP+  + +  +
Sbjct: 298 HGKELDGRPINCDMSTSK 315

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 95/207 (45%), Gaps = 26/207 (12%)

Query: 49  QVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXX 107
           +VD+EQ E+         ++G   T    ++VG L   I +  LK  F+ +GG  +    
Sbjct: 217 EVDEEQEESSKKA----KLSGEPAT----IFVGRLSWNIDDQWLKNEFEHIGGVQSARVI 268

Query: 108 XXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWA---------------F 152
                     Y +V++     A  A++ ++GK+++   +  + +               F
Sbjct: 269 YERGSTRSRGYGYVDFTDKSYAEKAVKEMHGKELDGRPINCDMSTSKPTVNPREDRAKRF 328

Query: 153 XXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFT 212
                   DT  LF+G+L+ N D + +   F      +S  +    +T   +G+G+V + 
Sbjct: 329 GDMPSEPSDT--LFLGNLSFNADRDQIYELFSPHGEVISVRIPTHPETEQPKGFGYVQYA 386

Query: 213 SQDDAQTAMDSMQGQDLNGRPLRINWA 239
           S D AQ A++++QG+ ++ RP+R++++
Sbjct: 387 SVDSAQKALETLQGEYIDNRPVRLDFS 413

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 68/144 (47%), Gaps = 20/144 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQI------ENNV---------VKINWAFXXXXXXX--- 159
           Y FVE+    DA  AL +LN   I       NN+          ++NWA           
Sbjct: 166 YCFVEFQNQEDAQYAL-SLNSNPIPNILSDSNNLYTNPTGKRNFRLNWASGATLQSSIPV 224

Query: 160 DDTFNLFVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  + S  +  VM D  TG+SR +GF+ F  QD+ +
Sbjct: 225 TPEFSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQDERK 284

Query: 219 TAMDSMQGQDLNGRPLRINWAAKR 242
            A+  M G    GRPLR+ +A  R
Sbjct: 285 RALSEMNGVWCQGRPLRVAYATPR 308

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 6/97 (6%)

Query: 321 GLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGC 380
           G PPQ++     + +      V+T +IG +     E+ +  LF+ FG I++ K  P K C
Sbjct: 364 GQPPQLSKSNSQNEL------VSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNC 417

Query: 381 CFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERS 417
            F+K++    A   I  L  F   G  +R  WGK  S
Sbjct: 418 GFVKFENRIDAEAAIQGLQGFIVAGNPIRLSWGKASS 454

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 45/75 (60%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  +++  +R+ FK F     G+++ +++    +  GFV F ++ DA+ A+  +
Sbjct: 382 VFIGGLSPKINESQVRSLFKPF-----GNIV-NVKLPPGKNCGFVKFENRIDAEAAIQGL 435

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 436 QGFIVAGNPIRLSWG 450

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (63%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDLN +V  ETL + F  +PS++S  V +D QT  S G+G+++F  ++DA+ A+D  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 225 QGQDLNGRPLRI 236
               L  + +RI
Sbjct: 163 NCMKLGDKVIRI 174

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           +TF+LF+GDL+  V  E L N F  +PS+LS  V +D +T  S G+G+++F+S+ D++ A
Sbjct: 49  ETFSLFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQA 108

Query: 221 MDSMQGQDLNGRPLRI 236
           +D      L    +R+
Sbjct: 109 IDDFNCTRLFDSVIRL 124

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 86/179 (48%), Gaps = 18/179 (10%)

Query: 77  VLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
            ++VG L  ++ ++ LK  F+ +G  I               Y +V++     A  A++ 
Sbjct: 179 TIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKE 238

Query: 136 LNGKQIENNVVKINWA---------------FXXXXXXXDDTFNLFVGDLNVNVDDETLR 180
           ++GKQI+   +  + +               F        DT  LF+G+L+ N D + + 
Sbjct: 239 MHGKQIDGREINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDT--LFLGNLSFNADRDQIY 296

Query: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWA 239
             F      +S  +    +T   +G+G+V + + +DAQ+A+D++QG+ ++ RP+R++++
Sbjct: 297 ELFSKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFS 355

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (60%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           +T  +FVG L+ +VDDE L+N F+     +   V+++  T  SRGYG+V F+S+  A+ A
Sbjct: 176 ETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERA 235

Query: 221 MDSMQGQDLNGRPLRINWAAKR 242
           +  M G+ ++GR +  + +  +
Sbjct: 236 VKEMHGKQIDGREINCDMSTSK 257

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 68/136 (50%), Gaps = 19/136 (13%)

Query: 118 YAFVEYHQS-HDANIALQTLNGKQIE---NNVVKINWA------------FXXXXXXXDD 161
           Y FV++  S H AN  L+  NG  I    N  +K+NWA                     +
Sbjct: 111 YCFVDFPSSTHAANALLK--NGMIIPSFPNKKLKLNWATSSYSNGNNGGNNSISNSKSGN 168

Query: 162 TFNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
            +++FVGDL  NV +  L + F   + S     ++ D  TG S+GYGFV F++ D+ Q A
Sbjct: 169 NYSIFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKGYGFVKFSNADEQQLA 228

Query: 221 MDSMQGQDLNGRPLRI 236
           +  MQG  LNGR +++
Sbjct: 229 LSEMQGVFLNGRAIKV 244

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 320 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIAGMQ 379

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 380 GFPIANSRVRLSWGRS 395

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 325 VFIGGLSSLVTEDELRAYFQPF-----GTIVY-VKIPVGKGCGFVQYVDRLSAETAIAGM 378

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 379 QGFPIANSRVRLSWG 393

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 74  SDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIAL 133
           ++  +++G L   +TED L+ YFQ  G I                 FV+Y     A  A+
Sbjct: 321 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGC-----GFVQYVDRLSAETAI 375

Query: 134 QTLNGKQIENNVVKINWA 151
             + G  I N+ V+++W 
Sbjct: 376 AGMQGFPIANSRVRLSWG 393

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 66/145 (45%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXXXDDT 162
           Y F+E+    DA   L +LN K I N                  ++NWA          T
Sbjct: 119 YCFIEFDSLKDAQFGL-SLNSKPIPNFKSISTELETNPSGQRTFRLNWASGATLQSSIPT 177

Query: 163 ---FNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              ++LFVGDL+    +  L   F K F S  +  VM D  TG SR +GF+  + + + +
Sbjct: 178 TPEYSLFVGDLSPMTTEADLLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFERE 237

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+D M G  L+GR LR+  A  R+
Sbjct: 238 EALDKMNGTLLHGRQLRVALANPRN 262

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 61/124 (49%), Gaps = 12/124 (9%)

Query: 121 VEYHQSHDANIALQT----LNGKQIENNVVKINWAFXXXXXXXDDTFN--LFVGDLNVNV 174
           VE  + H+  + L+T     + + ++N+   +N          +D  N  +FVG+LN  +
Sbjct: 274 VEDKKKHNEPLLLETAKKLFSKELLKNSSSNVNDVKSNEDHSDNDPTNTTVFVGNLNCKI 333

Query: 175 DDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
            ++ L+  F+ F        +  ++    +  GFV F ++ DA+ +M  +QG  + G P+
Sbjct: 334 TEDELQKVFEPF------GAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQGYFVAGSPI 387

Query: 235 RINW 238
           RI+W
Sbjct: 388 RISW 391

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++GN+    TE +L  +F+ FG I   K  P K C F+K+     A   +  L 
Sbjct: 319 PTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQ 378

Query: 400 NFPFQGRNLRTGW 412
            +   G  +R  W
Sbjct: 379 GYFVAGSPIRISW 391

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 19/112 (16%)

Query: 39  QNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQV 98
           +N SS  N  + +++  +NDP+              +  ++VGNL+  ITED L++ F+ 
Sbjct: 299 KNSSSNVNDVKSNEDHSDNDPT--------------NTTVFVGNLNCKITEDELQKVFEP 344

Query: 99  GGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINW 150
            G I                 FV++    DA  ++  L G  +  + ++I+W
Sbjct: 345 FGAIEKVKIPPGKKC-----GFVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 48/72 (66%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+  V +ETL++ F  +PS++S  V  D  +  S G+G+++F  +++A  AM+ +
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 225 QGQDLNGRPLRI 236
              ++NG+ +RI
Sbjct: 153 NYTEVNGKEIRI 164

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/158 (18%), Positives = 65/158 (41%), Gaps = 4/158 (2%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++G+L + +TE+ LK  F +    ++              + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N  ++    ++I  +        +   N+F  +L +N    T R  +  F  Y  G ++ 
Sbjct: 153 NYTEVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPQLTTRAFYDTFSRY--GKIL- 209

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
             +  S +  GFV F  +  A+  +      +  G+ +
Sbjct: 210 SCKLDSRKDIGFVYFEDEKTARNVIKMYNNTNFFGKKI 247

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 91/194 (46%), Gaps = 22/194 (11%)

Query: 63  PANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXX----- 117
           P NA+ G R +    LY+G+LD +  E+ ++Q +   G                      
Sbjct: 36  PVNAV-GNRGSQ---LYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGP 91

Query: 118 -----YAFVEYHQS-HDANIALQTLNGKQIENNV---VKINWAFXXXXXXXD-DTFNLFV 167
                Y F+E+  + H +N  L+  NG QI N V   +K+NWA          + +++FV
Sbjct: 92  RNNLGYCFLEFPSTVHASNALLK--NGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFV 149

Query: 168 GDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQG 226
           GDL  NV +  L   F   F S     +++D  TG S+GY FV FT+    Q A+  MQG
Sbjct: 150 GDLAPNVTESQLFELFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQG 209

Query: 227 QDLNGRPLRINWAA 240
             L+GR +R++ A 
Sbjct: 210 IFLSGRAIRVSNAG 223

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +     E +L   FQ FG I+  K    KGC F++Y     A   I  + 
Sbjct: 280 PNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 339

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 340 GFPIGNSRVRLSWGRS 355

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+  V ++ LR  F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 285 VFVGGLSSLVAEDELRAYFQPF-----GTIVY-VKIPVGKGCGFVQYVDRISAETAIAKM 338

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 339 QGFPIGNSRVRLSWG 353

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 5/91 (5%)

Query: 61  VVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAF 120
           V P  A+    + ++  ++VG L   + ED L+ YFQ  G I                 F
Sbjct: 268 VQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGC-----GF 322

Query: 121 VEYHQSHDANIALQTLNGKQIENNVVKINWA 151
           V+Y     A  A+  + G  I N+ V+++W 
Sbjct: 323 VQYVDRISAETAIAKMQGFPIGNSRVRLSWG 353

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 69/145 (47%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNV---------------VKINWAFXXXXXXXDDT 162
           Y FVE+    DA  AL +LN   + N +                ++NWA          +
Sbjct: 141 YCFVEFESQQDAQFAL-SLNSGPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQSSIPS 199

Query: 163 ---FNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TG+SR +GFV F ++++ +
Sbjct: 200 RPEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEERR 259

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G    GR LR+ +A  R+
Sbjct: 260 RALVEMNGVWCQGRCLRVAYATPRN 284

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 36/78 (46%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIV 396
           + PP  TT +IG +     EA L  LF  FG IL  K    K C F+KY+    A   I 
Sbjct: 380 TTPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQ 439

Query: 397 ALANFPFQGRNLRTGWGK 414
            +  F   G  +R  WG+
Sbjct: 440 GMQGFIVGGNPVRLSWGR 457

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L   +++  L+  F  F + L+      ++    +  GFV + ++ DA+ A+  M
Sbjct: 388 VFIGGLTPKINEAQLQALFSPFGNILT------VKIPQGKNCGFVKYENRIDAEAAIQGM 441

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 442 QGFIVGGNPVRLSWG 456

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 344 TAYIGNIPHFATEADLIPLF-QNFGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIV 396
           + ++G++   ATEADL+ LF Q F  +   +    P  G      F+++   E+    +V
Sbjct: 204 SLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALV 263

Query: 397 ALANFPFQGRNLRTGWGKERSNF 419
            +     QGR LR  +   R+N 
Sbjct: 264 EMNGVWCQGRCLRVAYATPRNNM 286

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 68/145 (46%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNV---------------VKINWAFXXXXXXXDDT 162
           Y FVE+    DA   L +LN   + N +                ++NWA          +
Sbjct: 160 YCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQSSIPS 218

Query: 163 ---FNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TG+SR +GFV F ++++ +
Sbjct: 219 RPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERR 278

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G    GR LR+ +A  R+
Sbjct: 279 RALVEMNGVWCQGRCLRVAYATPRN 303

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 42/98 (42%), Gaps = 5/98 (5%)

Query: 322 LPPQVNPQAVDHIIRSAP-----PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYP 376
           LPP ++ Q +     SA      P  TT +IG +     E  L  LF  FG IL  K   
Sbjct: 395 LPPPISTQQLPDFSSSAQAYTTDPNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQ 454

Query: 377 EKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 414
            K C F+K++    A   I  +  F   G  +R  WG+
Sbjct: 455 GKNCGFVKFEKRIDAEAAIQGMQGFVVGGCPIRLSWGR 492

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L   +++  L+  F  F + L+      ++    +  GFV F  + DA+ A+  M
Sbjct: 423 VFIGGLTPKINENQLQTLFSPFGNILT------VKIPQGKNCGFVKFEKRIDAEAAIQGM 476

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 477 QGFVVGGCPIRLSWG 491

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 346 YIGNIPHFATEADLIPLF-QNFGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEADL+ LF Q F  +   +    P  G      F+++   E+    +V +
Sbjct: 225 FVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALVEM 284

Query: 399 ANFPFQGRNLRTGWGKERSNFM 420
                QGR LR  +   R+N M
Sbjct: 285 NGVWCQGRCLRVAYATPRNNMM 306

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 75/175 (42%), Gaps = 16/175 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGP--IAXXXXXXXXXXXXXXYAFVEY-HQSHDANIALQ 134
           +Y+G LD   TE  +K  ++  G   I               Y F+E+  + H +N  L+
Sbjct: 72  IYMGELDPTWTEATIKSIWKSLGEELINVKLIWNKNLGLNQGYCFIEFPSEQHASNALLK 131

Query: 135 T-LNGKQIENNVVKINWAFXXXXX-----------XXDDTFNLFVGDLNVNVDDETLRNA 182
             +N  +     VK+NW                       +++FVGDL  NV +  L + 
Sbjct: 132 NGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVTEGQLFDL 191

Query: 183 F-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 236
           F   F S     ++ D  T +S+ YGFV F    D Q A+  MQG  LNGR ++I
Sbjct: 192 FISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAIKI 246

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +    TE  L   FQ FG I+  K    KGC F++Y     A   I+ + 
Sbjct: 323 PNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYFDRISAETAILRMQ 382

Query: 400 NFPFQGRNLRTGWGKE 415
            FP     +R  WG+ 
Sbjct: 383 GFPIGNSRIRLSWGRS 398

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+  V +E LR+ F+ F     G +++ ++    +G GFV +  +  A+TA+  M
Sbjct: 328 VFVGGLSSMVTEEQLRHCFQPF-----GTIIY-VKIPIGKGCGFVQYFDRISAETAILRM 381

Query: 225 QGQDLNGRPLRINWA 239
           QG  +    +R++W 
Sbjct: 382 QGFPIGNSRIRLSWG 396

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 74  SDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIAL 133
           ++  ++VG L   +TE+ L+  FQ  G I                 FV+Y     A  A+
Sbjct: 324 NNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGC-----GFVQYFDRISAETAI 378

Query: 134 QTLNGKQIENNVVKINWA 151
             + G  I N+ ++++W 
Sbjct: 379 LRMQGFPIGNSRIRLSWG 396

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 65/145 (44%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNV---------------VKINWAFXXXXXX---X 159
           Y FV++    +A   LQ LN   + N V                ++NWA           
Sbjct: 100 YCFVQFANLQEAQAGLQ-LNATPLPNVVSPTTRNPTNPTGKRNFRLNWASGATLQSDIPA 158

Query: 160 DDTFNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TG+SR +GFV F  + + +
Sbjct: 159 TPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERR 218

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G    GR LR+ +A  R+
Sbjct: 219 RALAEMNGVWCQGRQLRVAYATPRN 243

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%)

Query: 343 TTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 402
           TT +IG + +  +E  L  LF  FG IL  K  P +GC F++++    A   I  +  F 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFI 385

Query: 403 FQGRNLRTGWGK 414
             G  +R  WG+
Sbjct: 386 VGGNAIRLSWGR 397

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 8/81 (9%)

Query: 161 DTFN--LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
           DT N  +F+G L+  + +  L   F  F + LS      ++    RG GFV F ++ DA+
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILS------VKVPPGRGCGFVRFENRMDAE 375

Query: 219 TAMDSMQGQDLNGRPLRINWA 239
            A+  MQG  + G  +R++W 
Sbjct: 376 AAIQGMQGFIVGGNAIRLSWG 396

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 33/80 (41%), Gaps = 5/80 (6%)

Query: 72  ETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANI 131
           +T++  +++G L   I+E  L   F   G I                 FV +    DA  
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNI-----LSVKVPPGRGCGFVRFENRMDAEA 376

Query: 132 ALQTLNGKQIENNVVKINWA 151
           A+Q + G  +  N ++++W 
Sbjct: 377 AIQGMQGFIVGGNAIRLSWG 396

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNV---------------VKINWAFXXXXXXXDDT 162
           Y FV++    +A   LQ LN   + N +                ++NWA          T
Sbjct: 101 YCFVQFPSLQEAQAGLQ-LNSTPLPNLISSTTHNPTNPTAKRNFRLNWASGATLQSDIPT 159

Query: 163 ---FNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F+  F S  +  VM D  TG+SR +GFV F  + + +
Sbjct: 160 TPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEQERR 219

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G    GR LR+ +A  R+
Sbjct: 220 RALVEMNGIWCQGRQLRVAYATPRN 244

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG + +  TE+ L  LF  FG IL  K  P KGC F+K++    A   I  + 
Sbjct: 395 PSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQ 454

Query: 400 NFPFQGRNLRTGWGK 414
            F      +R  WG+
Sbjct: 455 GFIVGNSAIRLSWGR 469

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
            +F+G LN  + +  L++ F  F + LS  V         +G GFV F  + DA+ A+  
Sbjct: 399 TVFIGGLNNQITESQLQSLFMPFGNILSVKV------PPGKGCGFVKFEHRLDAEAAIQG 452

Query: 224 MQGQDLNGRPLRINW 238
           MQG  +    +R++W
Sbjct: 453 MQGFIVGNSAIRLSW 467

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (42%), Gaps = 22/131 (16%)

Query: 37  AEQNVSSEGNSEQVDDE--QGENDPSVV--PANAITGGR-------------ETSDRVLY 79
           A Q +SS   S+Q+     Q  N  S++   AN+ITG               + S+  ++
Sbjct: 342 ATQTISSLQQSQQLPTTLAQTSNQQSLLMSTANSITGTNTLPMVTRPVPGYTDPSNTTVF 401

Query: 80  VGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGK 139
           +G L+  ITE  L+  F   G I                 FV++    DA  A+Q + G 
Sbjct: 402 IGGLNNQITESQLQSLFMPFGNI-----LSVKVPPGKGCGFVKFEHRLDAEAAIQGMQGF 456

Query: 140 QIENNVVKINW 150
            + N+ ++++W
Sbjct: 457 IVGNSAIRLSW 467

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 66/146 (45%), Gaps = 21/146 (14%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN----------------NVVKINWA---FXXXXXX 158
           Y FVE+    DA  AL TLN   I N                   ++NWA          
Sbjct: 96  YCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRKFRLNWANGATLHSTIL 154

Query: 159 XDDTFNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDA 217
               F+LFVGDL+    +  L + F+  + S  +  VM D  TG+SR +GFV F ++ + 
Sbjct: 155 PTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETER 214

Query: 218 QTAMDSMQGQDLNGRPLRINWAAKRD 243
           + A+  M G    GR LR+ +A  R+
Sbjct: 215 RNALIEMNGVQFQGRQLRVAYATPRN 240

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (48%)

Query: 343 TTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 402
           TT ++G +     E  L  LF+ FG I D K  P K C F+KY+   +A   I  L  F 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFI 504

Query: 403 FQGRNLRTGWGK 414
             G  +R  WG+
Sbjct: 505 IMGSPIRLSWGR 516

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG LN N+++  L   FK F +      + D++    +  GFV +  + +A+ A++ +
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGT------ITDVKIPPGKQCGFVKYNERLEAEAAINGL 500

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 501 QGFIIMGSPIRLSWG 515

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 344 TAYIGNIPHFATEADLIPLFQ---NFGFILDFKHYPEKGCC----FIKYDTHEQAAVCIV 396
           + ++G++  FATEADL+ LFQ   N    +     P  G      F+++    +    ++
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 397 ALANFPFQGRNLRTGWGKERSN 418
            +    FQGR LR  +   R+N
Sbjct: 220 EMNGVQFQGRQLRVAYATPRNN 241

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 65/143 (45%), Gaps = 18/143 (12%)

Query: 118 YAFVEYHQSHDANIAL-----------QTLNGKQIE---NNVVKINWAFXXXXXXXDDT- 162
           Y FVE+    DA   L            T  G+ I        ++NWA          T 
Sbjct: 172 YCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIPTT 231

Query: 163 --FNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQT 219
             ++LFVGDL+    +  L + F+  F S  +  VM D  TG+SR +GFV F ++++ + 
Sbjct: 232 PEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRR 291

Query: 220 AMDSMQGQDLNGRPLRINWAAKR 242
           A+  M G    GR LR+ +A  R
Sbjct: 292 ALIEMNGVHFQGRTLRVAYATPR 314

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT ++G +     E  L  +FQ FG IL  K  P K C F+K++    A   I  L 
Sbjct: 464 PTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 400 NFPFQGRNLRTGWGK 414
            F      +R  WG+
Sbjct: 524 GFVLVENPIRLSWGR 538

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L   V ++ LR  F+ F + LS      ++    +  GFV F  + DA+ A+  +
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILS------IKIPPGKNCGFVKFEHKIDAEAAIQGL 522

Query: 225 QGQDLNGRPLRINWA 239
           QG  L   P+R++W 
Sbjct: 523 QGFVLVENPIRLSWG 537

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 346 YIGNIPHFATEADLIPLFQ-NFGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEADL+ LFQ  F  +   +    P  G      F+++   E+    ++ +
Sbjct: 237 FVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIEM 296

Query: 399 ANFPFQGRNLRTGWGKERS 417
               FQGR LR  +   RS
Sbjct: 297 NGVHFQGRTLRVAYATPRS 315

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 14/50 (28%)

Query: 205 GYGFVSFTSQDDAQTAM-----------DSMQGQDLN---GRPLRINWAA 240
           GY FV F SQ DAQ  +            +  GQD+N    R  R+NWA+
Sbjct: 171 GYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWAS 220

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 72/137 (52%), Gaps = 17/137 (12%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNVVKINWA---------------FXXXXXXXDDT 162
           Y +V++     A  A++ ++GK+I+   + ++ +               +        DT
Sbjct: 11  YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPSQPSDT 70

Query: 163 FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMD 222
             LF+G+L+ N + + +   F ++   +S  +    +T   +G+G+V ++S ++AQ A+D
Sbjct: 71  --LFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALD 128

Query: 223 SMQGQDLNGRPLRINWA 239
           ++QG  ++ RP+R++++
Sbjct: 129 ALQGHYIDNRPVRLDFS 145

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 28/43 (65%)

Query: 200 TGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           T  SRGYG+V F  +  A+ A+  M G++++GRP+ ++ +  +
Sbjct: 5   TDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSK 47

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 66/145 (45%), Gaps = 20/145 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIENNVV---------------KINWAFXXXXXXXDDT 162
           Y FVE+    DA  AL TLN   + +                  ++NWA          +
Sbjct: 112 YCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIPS 170

Query: 163 ---FNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              F+LFVGDL+    +  L + F K F S  +  VM D  TG+SR +GFV F  + + +
Sbjct: 171 TPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERR 230

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  M G    GR LR+ +A  R+
Sbjct: 231 RALVEMNGVWCQGRNLRVAYATPRN 255

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 36/75 (48%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    +E  L  LF  FG I++ K  P KGC F+KY     A   I  + 
Sbjct: 393 PNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 400 NFPFQGRNLRTGWGK 414
            F   G  +R  WG+
Sbjct: 453 GFIVGGNPIRLSWGR 467

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L   + +  L + F  F + +      +++    +G GFV +  + DA+ A+  M
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAII------NVKIPPGKGCGFVKYAYRIDAEAAIQGM 451

Query: 225 QGQDLNGRPLRINWA 239
           QG  + G P+R++W 
Sbjct: 452 QGFIVGGNPIRLSWG 466

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 346 YIGNIPHFATEADLIPLFQN-FGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEA L+ LFQ  F  +   +    P  G      F+++   ++    +V +
Sbjct: 177 FVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVEM 236

Query: 399 ANFPFQGRNLRTGWGKERSNFM 420
                QGRNLR  +   R+N M
Sbjct: 237 NGVWCQGRNLRVAYATPRNNVM 258

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 45/72 (62%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+  V ++ LR+ F  F S++S  +  D  T  S GYG+++F++++DA+  ++  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 225 QGQDLNGRPLRI 236
               + GR +RI
Sbjct: 178 NYIPIFGREVRI 189

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 61/158 (38%), Gaps = 10/158 (6%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++G+LD+ +TE  L+  F +    ++              Y ++ +    DA   ++  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDL---NVNVDDETLRNAFKDFPSYLSGH 193
           N   I    V+I  +        +   N+F  +L   N+ +      +AFK F   LS  
Sbjct: 178 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILSCK 237

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
           +         +  GFV F     A+ A+    G++  G
Sbjct: 238 L------DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFG 269

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+ +L +N D + L + F       S  +     +  S  + F++F    DAQ A+D++
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKS--IFTSNVSKLSSAWAFITFQKGSDAQDAIDNL 384

Query: 225 QGQDLNGRPLRINWAAK 241
               L GRP+ ++ A K
Sbjct: 385 NHSQLLGRPIELSRAQK 401

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%)

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           T  LF+GDL+  +D+E L   FK F S  S  V  D +TG S GYG+++F+ + D   A 
Sbjct: 102 TIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAAT 161

Query: 222 DSMQGQDLNGRPLRI 236
           +    + + G+ +RI
Sbjct: 162 EEFNYRPIFGKEVRI 176

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 63/158 (39%), Gaps = 4/158 (2%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXX-XXXXYAFVEYHQSHDANIALQTL 136
           L++G+LD+ I E+IL Q F+    +                Y ++ + +  D   A +  
Sbjct: 105 LFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAATEEF 164

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N + I    V+I  +        +   N+F  +L +   + T R  +  F  Y  G+++ 
Sbjct: 165 NYRPIFGKEVRIMPSLRNTFYRKNIGTNIFFSNLPLENSNLTTRVFYDTFKVY--GNIL- 221

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
             +    +  GF+ F +   A+  +    G +  G  +
Sbjct: 222 SCKLDKRKNIGFIYFDNDHAARVVIKEFNGSEFFGNKI 259

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 45/72 (62%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+  V ++ LR+ F  F S++S  +  D  T  S GYG+++F++++DA+  ++  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 225 QGQDLNGRPLRI 236
               + GR +RI
Sbjct: 182 NYIPIFGREVRI 193

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 32/158 (20%), Positives = 60/158 (37%), Gaps = 10/158 (6%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++G+LD+ +TE  L+  F +    ++              Y ++ +    DA   ++  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDL---NVNVDDETLRNAFKDFPSYLSGH 193
           N   I    V+I  +        +   N+F  +L   N+ +      +AFK +   LS  
Sbjct: 182 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKYGKILSCK 241

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
           +         +  GFV F     A+ A+    G+   G
Sbjct: 242 L------DRRKNIGFVYFEKDSSAKQAIAEYNGKQFYG 273

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+ +L +N D + L + F       S  +     +  +  + F++F    DAQ A+DS+
Sbjct: 331 VFIKNLPLNSDSDLLLDYFSQIGPVKS--IFTSNVSKLNSAWAFITFKKGSDAQDAIDSL 388

Query: 225 QGQDLNGRPLRINWAAK 241
               L GR + ++ A K
Sbjct: 389 NHSQLLGRTIELSRAQK 405

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 46/72 (63%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+G+L+++V++E L+  FK FPS +S  +  +  T  S GYG+++F  ++DA+ A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 225 QGQDLNGRPLRI 236
              +L G  ++I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 62/158 (39%), Gaps = 4/158 (2%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++GNL   + E+ LKQ F +    ++              Y ++ +    DA  A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N   +  N VKI  +        +   NLF  +L ++  + T R  +  F  Y  G ++ 
Sbjct: 140 NYINLFGNEVKIMPSLRNSFYRKNIGTNLFFCNLPLDNKELTTRRFYDTFKKY--GKIL- 196

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
             +    +  GFV F +   A+  +     ++  G  +
Sbjct: 197 SCKLDKRKNIGFVYFDNDKSAKEVIKDFNNKEFFGTKI 234

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 61  VVPANAIT--GGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXY 118
           V+ +N+I     ++T    ++V NL    T++ +  YF V GPI               +
Sbjct: 315 VIDSNSIIDETNKKTYPNSVFVKNLPINTTDEEILDYFSVAGPIK-SVFSSKVPKFNSLW 373

Query: 119 AFVEYHQSHDANIALQTLNGKQIENNVVKINWA 151
           + + Y +S D+  A+QT + K  +  V+ +  A
Sbjct: 374 SIITYKKSSDSIKAIQTYDNKTFKEKVISVTKA 406

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           NLFV +L+ +VDDE L+  F  F + +S  VM   + G S+ +GFV F++ ++A  A+  
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMR-TEDGKSKNFGFVCFSTPEEATRAITE 80

Query: 224 MQGQDLNGRPLRINWAAKRD 243
              Q + G+PL +  A +++
Sbjct: 81  KNQQIVAGKPLYVAIAQRKE 100

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 61/120 (50%), Gaps = 7/120 (5%)

Query: 128 DANIALQTLNGKQIENNVVKINWAFXXXXXXXDDT---FNLFVGDLNVNVDDETLRNAF- 183
           DA+  L+T N   + N   ++NWA          +   F+LFVGDL+    +  L + F 
Sbjct: 140 DASSPLRT-NPTGLRN--FRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQ 196

Query: 184 KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
           K F S  +  VM D  TG+SR +GFV F  + + + A+  M G    GR LR+ +A  R+
Sbjct: 197 KKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPRN 256

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    +E  L  LF  FG I++ K  P KGC F+KY     A   I  + 
Sbjct: 403 PNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 462

Query: 400 NFPFQGRNLRTGWGKERSN 418
            F   G  +R  WG+  ++
Sbjct: 463 GFIVGGNPIRLSWGRTSTD 481

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L  +  +  L + F  F + +      +++    +G GFV +  + DA+ A+  M
Sbjct: 408 VFIGGLTSHTSERQLHSLFAPFGTII------NVKIPPGKGCGFVKYAYRIDAEAAIQGM 461

Query: 225 QGQDLNGRPLRINW 238
           QG  + G P+R++W
Sbjct: 462 QGFIVGGNPIRLSW 475

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 346 YIGNIPHFATEADLIPLFQN-FGFILDFKHY--PEKGCC----FIKYDTHEQAAVCIVAL 398
           ++G++   ATEA L+ LFQ  F  +   +    P  G      F+++   ++    +V +
Sbjct: 178 FVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVEM 237

Query: 399 ANFPFQGRNLRTGWGKERSNFM 420
                QGRNLR  +   R+N M
Sbjct: 238 NGVWCQGRNLRVAYATPRNNVM 259

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 48/72 (66%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+  V +ETL+  FK +PS++S  V  D  T  S G+G+++F  +++A+ AM+ +
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 225 QGQDLNGRPLRI 236
               +NG+ +RI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/158 (18%), Positives = 68/158 (43%), Gaps = 4/158 (2%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++G+LD+ +TE+ LK+ F +    ++              + ++ +    +A  A++ L
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N  ++    ++I  +        +   N+F  +L +N    T R  +  F  Y  G ++ 
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRY--GKIL- 209

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
             +  S +  GFV F  +  A++ +      +  G+ +
Sbjct: 210 SCKLDSRKDIGFVYFEDEKTARSVIKMYNNTNFFGKKI 247

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+  V ++ LR+ F  +PS +S  +  D  +  S GYG+++F++ +DA+ A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 225 QGQDLNGRPLRI 236
               L G+ +RI
Sbjct: 164 NYVPLFGKEVRI 175

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 64/158 (40%), Gaps = 10/158 (6%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++G+LD+ +TE +L+  F +    ++              Y ++ +    DA  A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDL---NVNVDDETLRNAFKDFPSYLSGH 193
           N   +    V+I  +        +   N+F  +L   N+++      + FK +   LS  
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILSCK 223

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
           +         +  GF+ F     A++A+D   G++  G
Sbjct: 224 L------DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYG 255

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 48/72 (66%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL+  V +ETL+  FK +PS++S  V  D  T  S G+G+++F  +++A+ AM+ +
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 225 QGQDLNGRPLRI 236
               +NG+ +RI
Sbjct: 153 NYTKVNGKEIRI 164

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +  DE L N F +        ++ D Q  +SRG+GFVSF  +DD + A
Sbjct: 19  DMKTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQK-NSRGFGFVSFAVEDDTKDA 77

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +D  +     GR LR++ A +RD
Sbjct: 78  LDKARKTKFKGRLLRVDIAKRRD 100

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 85/189 (44%), Gaps = 19/189 (10%)

Query: 60  SVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXY 118
           S VPAN +           YVGN+D  +++++L + F   GP+A               +
Sbjct: 5   STVPANTV-----------YVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGF 53

Query: 119 AFVEYHQSHDANIALQTLNGK-QIENNVVKINWAFXXXXX-----XXDDTFNLFVGDLNV 172
           AFVE++   DA  A + LN   ++ +  +K+  A             D    LF+ +++ 
Sbjct: 54  AFVEFNSPQDAEYASKCLNNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKNIDE 113

Query: 173 NVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGR 232
            VD E L   F  F S +    ++ ++ G  R   ++ +++ + +  A++ +  Q +  +
Sbjct: 114 LVDSEMLTKIFGKFGSLVRPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMVMNK 172

Query: 233 PLRINWAAK 241
            + I++A K
Sbjct: 173 CISIDYAYK 181

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 93/215 (43%), Gaps = 16/215 (7%)

Query: 36  SAEQNVSSEGNSEQVDDE--QGENDPSVVPAN--AITGGRETSDRVLYVGNLDKAITEDI 91
           S+EQN S+  +  QV ++    E   S+  AN   +       +  +++G L+   TED 
Sbjct: 86  SSEQNGSNVSSEPQVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDG 145

Query: 92  LKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT---LNGKQIENNVVK 147
           L++YF + G  +               + F+ +      +  ++T   L+GK     V+ 
Sbjct: 146 LREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQHILDGK-----VID 200

Query: 148 INWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYG 207
              A        D T  +FVG L  +V  +     F  + + +   +M D  TG SRG+G
Sbjct: 201 PKRAIPREEQ--DKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFG 258

Query: 208 FVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           FV++ S D A+   +S   ++  G+ + I  A  R
Sbjct: 259 FVTYDSPDAAEKVCESRY-REFKGKQIEIKRAEPR 292

>ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR429C (TIF35)
          Length = 269

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
           DD   L +  LN N D+ T++      FP+     V+ + +TG SRG  +V+F S+ DA+
Sbjct: 185 DDAMTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAE 244

Query: 219 TAMDSMQGQDLNGRPLRINWA 239
           TA+  + G+      L+++W+
Sbjct: 245 TALRLLHGRGFMNLILQVDWS 265

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL  +V +  LR+ F  F S  S  +  D  +G S GYG+++F + +DA+ A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 225 QGQDLNGRPLRI 236
             + + G+ +RI
Sbjct: 159 NYRPIEGQEVRI 170

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/155 (20%), Positives = 64/155 (41%), Gaps = 4/155 (2%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++G+L+ ++TE++L+  F +     +              Y ++ +  S DA  A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N + IE   V+I  +        +   N+F  +L +     T R  +  F  Y  G ++ 
Sbjct: 159 NYRPIEGQEVRIMPSLRNSFYRKNVGTNVFFSNLPLEDSRLTTRVFYDTFKKY--GKIL- 215

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
             +    +  GF+ F +   A+  +    G++  G
Sbjct: 216 SCKLDKRKDIGFIYFNNDQSARKVIKDYNGKEFFG 250

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 44/72 (61%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+G+L+ +V ++ L   F  +PS++S  V ++  T  S G+G+++F S++DA+ A + M
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 225 QGQDLNGRPLRI 236
               +    +RI
Sbjct: 151 NYSKVLNNEIRI 162

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 60/155 (38%), Gaps = 4/155 (2%)

Query: 78  LYVGNLDKAITEDILKQYFQVG-GPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L++GNLDK +TE  L+  F V    I+              + ++ +    DA  A + +
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N  ++ NN ++I  +            N++  +L    +  T R  +  F  Y  G ++ 
Sbjct: 151 NYSKVLNNEIRIMPSMRDPDYRKKVGTNVYFRNLPTENNMLTTRYFYDSFRKY--GKIL- 207

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
             +   S+  GF+ F  +  A   +         G
Sbjct: 208 SCKIERSKKIGFIYFACEVTANEVIKKFNNSSFLG 242

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  + ++V DE L + F +F       V+ D+    SRG+GFVSF  +DD + A
Sbjct: 24  DMKTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAVEDDTKEA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +   L G  LR++ A +RD
Sbjct: 83  LKQARKAKLKGHLLRVDIAKRRD 105

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  + ++V DE L + F +F       V+ D+    SRG+GFVSF  +DD + A
Sbjct: 24  DMKTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAVEDDTKEA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +   L G  LR++ A +RD
Sbjct: 83  LKKARQTKLKGHLLRVDIAKRRD 105

>TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.382
           YHR086W
          Length = 362

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%)

Query: 340 PRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           P  TT +IG +    TE +L  LFQ FG I+  K    KGC F++Y+T + A + I  + 
Sbjct: 252 PTNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGCGFVQYETRKAAELAIHKMK 311

Query: 400 NFPFQGRNLRTGWGK 414
               +   +R  WGK
Sbjct: 312 GVSIKNSKIRLSWGK 326

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+  V +  LR+ F+ F     G +++ ++    +G GFV + ++  A+ A+  M
Sbjct: 257 VFIGGLSSLVTENELRSLFQPF-----GEIVY-VKIPFGKGCGFVQYETRKAAELAIHKM 310

Query: 225 QGQDLNGRPLRINW--AAK 241
           +G  +    +R++W  AAK
Sbjct: 311 KGVSIKNSKIRLSWGKAAK 329

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 74  SDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIAL 133
           ++  +++G L   +TE+ L+  FQ  G I                 FV+Y     A +A+
Sbjct: 253 TNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGC-----GFVQYETRKAAELAI 307

Query: 134 QTLNGKQIENNVVKINWA 151
             + G  I+N+ ++++W 
Sbjct: 308 HKMKGVSIKNSKIRLSWG 325

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +V DE L + F +F       V+ D+    SRG+GFVSF  +DD + A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNK-RSRGFGFVSFAVEDDTKEA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +    NG  LR++ A +RD
Sbjct: 83  LAKARKTKFNGHSLRVDVAKRRD 105

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 59/114 (51%), Gaps = 5/114 (4%)

Query: 132 ALQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLS 191
           A+Q +N  ++ + ++  N ++        D   +F+G LNV + +  +   F  +   + 
Sbjct: 6   AIQRINDTELSSGILSPNLSWHNEYK---DRAYIFIGGLNVELTEADILTIFSQYGIPVD 62

Query: 192 GHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN--WAAKRD 243
             ++ D +TG S+G+G++ +  Q  A  A+D++ G  + GR ++++  W   RD
Sbjct: 63  VFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHAWYTPRD 116

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 72  ETSDRV-LYVGNLDKAITE-DILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDA 129
           E  DR  +++G L+  +TE DIL  + Q G P+               + +++Y     A
Sbjct: 29  EYKDRAYIFIGGLNVELTEADILTIFSQYGIPVDVFLVRDRETGDSKGFGYLKYEDQRSA 88

Query: 130 NIALQTLNGKQIENNVVKINWAF 152
            +A+  LNG +I   ++K++ A+
Sbjct: 89  VLAIDNLNGSKIAGRIIKVDHAW 111

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 162 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           T +LF+G+L   V +E LR  FK + S+ S  V  D  T  S GYG+++F  ++DA++A 
Sbjct: 110 TNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESAR 169

Query: 222 DSMQGQDLNGRPLRI 236
                    G+ ++I
Sbjct: 170 KEFNYTVFFGQEVKI 184

>KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {ON}
           Anc_1.357 YHR015W
          Length = 590

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           L++G L  +++ +TL   FKDF S  S  V +D  TG S GYG+++FTSQ +    +D  
Sbjct: 88  LYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQKELDKFVDKY 147

Query: 225 QGQDLNGRPLRI 236
             + + G  +++
Sbjct: 148 NYKRMLGGEIKL 159

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 43/73 (58%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           +LF+GDL+  V ++ L +AF  F +  S  +  D +T  S GYG+++FTS  +A  A++ 
Sbjct: 95  SLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEK 154

Query: 224 MQGQDLNGRPLRI 236
                L G+ +RI
Sbjct: 155 FSYVKLFGKEVRI 167

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 86/216 (39%), Gaps = 12/216 (5%)

Query: 26  VTEVPTSADPSAEQNVSSEG--NSEQVDDEQGENDPSVV----PANAITGGRETSDRVLY 79
            T   T+ +P     +S+E     E      G  D ++V      + +T G   S   L+
Sbjct: 40  TTARSTNEEPRNRTELSTENFLQPEISSYRSGSADSAIVVKQGAKDHLTAGPSISS--LF 97

Query: 80  VGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQTLNG 138
           +G+LDK +TE +L   F     +A               Y ++ +  + +A+ A++  + 
Sbjct: 98  IGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKFSY 157

Query: 139 KQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDM 198
            ++    V+I  +        +   N+F  +L +     T R  ++ F  Y  G V+   
Sbjct: 158 VKLFGKEVRIMPSMRNSYFRKNIGTNVFFTNLPLENPALTTRVFYESFRKY--GRVL-SC 214

Query: 199 QTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPL 234
           +    +  GFV F S   A+ A+D    ++  G  +
Sbjct: 215 KLDRRKNIGFVYFESDISAKKAIDDFNSREYFGNKI 250

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 78/172 (45%), Gaps = 18/172 (10%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED+L+QYF + G  I               + F+ +  S   +  ++T 
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK     V+    A        D T  +FVG +  +V  +     F  + S +   
Sbjct: 212 HILDGK-----VIDPKRAIPREEQ--DKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQ 264

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM-QGQ--DLNGRPLRINWAAKR 242
           +M D  TG SRG+GFV++ S D    A+D + Q +  +  G+ + I  A +R
Sbjct: 265 LMLDKDTGRSRGFGFVTYDSPD----AVDKVCQNKFIEFKGKTIEIKRAEQR 312

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 40/72 (55%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+GDL  NV ++ L N F  F S+ S  +  D  T  S GYG+++F    DA+ A+D  
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 225 QGQDLNGRPLRI 236
               + GR +R+
Sbjct: 200 NYMPIFGREIRM 211

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 70/183 (38%), Gaps = 26/183 (14%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           ++V NL    + D L  +F   GP+               +AF+ Y +  D   A++ LN
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSVYTSDVSKFDSS-WAFITYKRIQDTKTAIEKLN 446

Query: 138 GKQIENNVVKINWA---------FXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPS 188
           G +     +++            F       +    +F+ +L+V  ++E        F +
Sbjct: 447 GCKYMKRTIEVKKTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNEE--------FLN 498

Query: 189 YLSGHVMWDMQTGSSRGY--------GFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240
           +L G      +    R Y        G+V   S++DAQ   + M+ + L    ++ +W  
Sbjct: 499 FLCGQERIKTERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASWQQ 558

Query: 241 KRD 243
            +D
Sbjct: 559 PKD 561

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +V DE L   F +F       V+ D+    SRG+GFVSF +++D + A
Sbjct: 20  DMKTLFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNK-KSRGFGFVSFATEEDTKDA 78

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +   LNG  LR++ A +RD
Sbjct: 79  LGKARRSKLNGNVLRVDIAKRRD 101

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 65/144 (45%), Gaps = 20/144 (13%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXX---X 159
           Y FVE+    D  IA  +LN   I N                  ++NWA           
Sbjct: 121 YCFVEFESQQDV-IAALSLNKAVIPNIFSESINLYTNPNGRRTFRLNWASGATLQSLIPA 179

Query: 160 DDTFNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
              ++LF+GDL+    +  + + F K + S  +  VM D   GSSRG+GF+ F+ +D+ +
Sbjct: 180 TPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSDEDERK 239

Query: 219 TAMDSMQGQDLNGRPLRINWAAKR 242
            A+++M G   + R  R+  A  R
Sbjct: 240 DALENMNGVMCHSRYFRLALATPR 263

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 325 QVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIK 384
           Q + Q +DH+  +     TT +IG +     E +L  LF+ FG IL  K    K C F+K
Sbjct: 326 QQSAQNIDHV--NLDNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVK 383

Query: 385 YDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN 418
           +    +A   I  +  F   G  +R  WGK  +N
Sbjct: 384 FKRKIEANAAIKGMQGFIINGNPIRLSWGKSNNN 417

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +F+G L+ + ++  L+  F+ F + LS      ++    +  GFV F  + +A  A+  M
Sbjct: 344 VFIGGLSTSTNEYELQVLFEPFGNILS------VKIPIGKNCGFVKFKRKIEANAAIKGM 397

Query: 225 QGQDLNGRPLRINWAAKRD 243
           QG  +NG P+R++W    +
Sbjct: 398 QGFIINGNPIRLSWGKSNN 416

>Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 76/182 (41%), Gaps = 13/182 (7%)

Query: 74  SDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXYAFVEYHQSHDANIA 132
           S   +YVGN+D  IT++ L + F    PI                YAF+E+H   DA   
Sbjct: 7   SGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQYV 66

Query: 133 LQTLNG-----------KQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
           +Q +N            +Q+ N+V   N +             LFV +L  +VD E L  
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGAANASSNNSKGISLPIAKLFVKNLADSVDIEQLEK 126

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F   ++   ++ + TG  +   +V F   + A  A+ S+  Q +    + +++A K
Sbjct: 127 IFNKFGKTVNKPEIFHLSTGKLKC-AYVYFEDFEKADMAIKSLNNQLVANNRITVDYAFK 185

Query: 242 RD 243
            +
Sbjct: 186 EN 187

>Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043W
           (REAL)
          Length = 690

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +V DE L + F +F       V+ D     SRG+GFVSF  +DD + A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFAVEDDTKEA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +    NG  LR++ A +RD
Sbjct: 83  LAKARKTKFNGHTLRVDVAKRRD 105

>TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.491
           YPL043W
          Length = 692

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +V DE +   F +F       ++ D Q   SRG+GFVSF  +DD   A
Sbjct: 24  DMKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQK-KSRGFGFVSFAVEDDTLAA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +   L  R LRI+ A +RD
Sbjct: 83  LKEARKTKLKDRLLRIDIAKRRD 105

>KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs),
          Length = 685

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +     DE   N F  F       ++ D + G+SRG+GFVSF  +DD +TA
Sbjct: 13  DLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGE-GASRGFGFVSFAVEDDTKTA 71

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           ++  +     GR LRI+ A +R+
Sbjct: 72  LNQARKTKFMGRLLRIDIAKRRE 94

>Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W
           (REAL)
          Length = 652

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+G L   V +E LR  FK + S+ S  +  D  T  S GYG+++F ++ DA+ A    
Sbjct: 113 LFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGNKKDAEAAKKEF 172

Query: 225 QGQDLNGRPLRI 236
             +   G+ ++I
Sbjct: 173 NYRIFFGQEVKI 184

>Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043W
           (REAL)
          Length = 680

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +V DE L + F +F       V+ D     SRG+GFVSF  +DD + A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFAVEDDTKEA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +    NG  LR++ A +RD
Sbjct: 83  LIKARKTKFNGHTLRVDVAKRRD 105

>CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q04067 Saccharomyces
           cerevisiae YDR429c TIF35
          Length = 274

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
           DD+  L +  LN N D+ TLRN     F       V+ + +TG SRG  FV+F ++D A+
Sbjct: 186 DDSCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAE 245

Query: 219 TAMDSMQGQDLNGRPLRINWA 239
            A+  + G+      LR++W+
Sbjct: 246 KALHFLDGRGFMNLILRVDWS 266

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 18/172 (10%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           L++G L+   TED LK YF + G  +               + F+ +  S   +  ++T 
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 255 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 307

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM-QGQ--DLNGRPLRINWAAKR 242
           +M D  TG SRG+GF+++    D+  A+D + Q +  D  G+ + I  AA R
Sbjct: 308 LMLDKDTGRSRGFGFITY----DSSEAVDRVCQNKYIDFKGKQIEIKRAAPR 355

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 8/171 (4%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           LY+GN+D  +T+D+L + F    PI+               YAF+E+    DA+  ++ +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 137 NGK-QIENNVVKI-----NWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL 190
           N   Q+ N  +K+     N A        +    LFV +L+  VD   L   F  F  + 
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFGPFS 131

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
               ++ ++    +   ++ +T+ DD+  A+  +  Q +  R + +++A K
Sbjct: 132 KQPEIFHVKQADYKC-AYIYYTTFDDSDQALAKLNNQIVFNRSISVDYAFK 181

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +V DE L + F +F       V+ D     SRG+GFVSF  +DD + A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFAVEDDTKEA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +    NG  LR++ A +RD
Sbjct: 83  LAKARKTKFNGHILRVDIAKRRD 105

>KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.491
           YPL043W
          Length = 682

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +   V DE L   F +F       V+ D+    SRG+GFVSF S++D + A
Sbjct: 15  DLQTLFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNK-KSRGFGFVSFASEEDTKEA 73

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   + + LNG+ LR++ A +R+
Sbjct: 74  LLKARKEKLNGQLLRVDIAKRRE 96

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV ++  +  D  L + F  F       ++ D   GSSRG+GFVSF  + D Q A
Sbjct: 14  DLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKD-NAGSSRGFGFVSFAVESDTQAA 72

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +D  +     GR LR++ A +R+
Sbjct: 73  LDKGRKTQFKGRLLRVDVAKRRE 95

>CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa]
           {ON} similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043w nucleolar protein
          Length = 682

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  +V DE L + F +F       V+ D+    SRG+GFVSF  +DD + A
Sbjct: 20  DMKTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNK-KSRGFGFVSFAVEDDTKIA 78

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +   L+G  L+++ A +RD
Sbjct: 79  LKEARKTKLDGAQLKVDIARRRD 101

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 45/72 (62%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           L++GDL  +V +  L + F  + S++S  +  D +TG S GYG+++ +++++A + ++  
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 225 QGQDLNGRPLRI 236
              ++ GR +RI
Sbjct: 214 NYTNIFGREVRI 225

>Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 13/182 (7%)

Query: 74  SDRVLYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIA 132
           SD  +YVGN+D  IT+D L + F Q+   +               YAF+E++   DA   
Sbjct: 7   SDSTVYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKEDAEYV 66

Query: 133 LQTLNG-----------KQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRN 181
           +Q +N            +Q+ N+V   N +             LFV +L  ++D + L  
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGTANLSSNNSKDIALPIAKLFVKNLADSIDIDQLAK 126

Query: 182 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
            F  F   +S   ++ +  G  +    V F   + A  A+ S+  Q +    + I++A K
Sbjct: 127 IFGKFGKTISKPEIFHLSNGKLKC-ACVYFEDFEKADLAIKSLNNQLVANSRITIDYAFK 185

Query: 242 RD 243
            +
Sbjct: 186 EN 187

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           NL++  +  ++  + L+  F  F   LS  ++ D+ TG S GYGF+SF    +A   ++ 
Sbjct: 230 NLYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINK 289

Query: 224 MQGQDLNGRPLRINWAAKR 242
           + G  +NG  L IN+  +R
Sbjct: 290 LNGTAMNGSTLFINYHVER 308

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 6/77 (7%)

Query: 346 YIGNIPHFATEADLIPLFQNFGFILDFKHYPE------KGCCFIKYDTHEQAAVCIVALA 399
           YI  IP   T  DL P+F  FG +L  K   +       G  FI +    +A+ CI  L 
Sbjct: 232 YIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINKLN 291

Query: 400 NFPFQGRNLRTGWGKER 416
                G  L   +  ER
Sbjct: 292 GTAMNGSTLFINYHVER 308

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDL 229
           +GH+  ++  G+S+GYGFV F +  DA  A+ S  G  L
Sbjct: 868 AGHL--ELPIGASKGYGFVYFKNPLDASKAVMSTDGIKL 904

>KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {ON}
           Anc_5.536 YDR429C
          Length = 274

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  LN N D+ TLR      F   P  +   V+ + +TG SRG  FV+F+S++
Sbjct: 190 DDMCTLKIMQLNENADENTLREELLFPFAPIPKAV---VVRNRETGRSRGLAFVTFSSEE 246

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
            A+ A+  + G+      LR+ W+
Sbjct: 247 MAEKALHFLDGRGFMNLILRVEWS 270

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +     DE L N F +        ++ D +  +SRG+GFVSF  +DD + A
Sbjct: 19  DMKTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEK-NSRGFGFVSFAVEDDTKDA 77

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           ++  +     GR LR++ A +R+
Sbjct: 78  LEKARKTKFKGRLLRVDIAKRRE 100

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED LK YF + G  +               + F+ +      +  ++T 
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +   + F  + + +   
Sbjct: 258 HILDGKVID-------PKRSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQ 310

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 311 LMLDKDTGRSRGFGFVTYDSGD 332

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    ++ L+N F  + + +   +M D  TG SRG+GF++F
Sbjct: 194 DNCKMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTF 244

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 18/172 (10%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L+ YF + G  I               + F+ +  S   +  ++T 
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 221 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQ 273

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM-QGQ--DLNGRPLRINWAAKR 242
           +M D  TG SRG+GFV++ S D    A+D + Q +  D  G+ + I  A  R
Sbjct: 274 LMLDKDTGRSRGFGFVTYDSPD----AVDRVCQNKFIDFKGKKIEIKRAEPR 321

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 8/71 (11%)

Query: 143 NNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGS 202
           NN VK + +         D   +F+G LN    ++TLR+ F  +   +   +M D  TG 
Sbjct: 147 NNAVKADLSR--------DICKMFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGR 198

Query: 203 SRGYGFVSFTS 213
           SRG+GF++F S
Sbjct: 199 SRGFGFLTFDS 209

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           L++GDL   V ++ L+N F  + S LS  +  D  +G S GYG+++ T++++A   M+  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 225 QGQDLNGRPLRI 236
               + G+ +RI
Sbjct: 161 NYTPIFGKVVRI 172

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 69/153 (45%), Gaps = 4/153 (2%)

Query: 78  LYVGNLDKAITEDILKQYFQV-GGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           LY+G+L+K +TED+LK +F +    ++              Y ++      +A+  ++  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N   I   VV+I  +        +   N+F  DL ++    T R+ +  F +Y  G+++ 
Sbjct: 161 NYTPIFGKVVRIMPSLRNSQTRKNMGTNVFFSDLPLSEKSITTRDFYNFFKAY--GNIL- 217

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDL 229
             +  +S+  GF+ F ++  A+  +      +L
Sbjct: 218 SCKLNTSKNIGFIFFENESSAKEVISKFNANEL 250

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 79/176 (44%), Gaps = 13/176 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           +YVGN+D  +T++ L + F    PIA               +AFVE++   D    +Q L
Sbjct: 12  VYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFYTPEDCQYVVQLL 71

Query: 137 NGK-QIENNVVKINWAFXXXXXXXDDTFN--------LFVGDLNVNVDDETLRNAFKDFP 187
           N   Q+ +  +K+  A         DT +        +FV +L+ ++D+  L   F  F 
Sbjct: 72  NNTVQLYDRFLKVRKA--NVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFG 129

Query: 188 SYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD 243
               G  ++ +  G  R   ++ F + D +  A+ ++ GQ +  + + +++A K +
Sbjct: 130 PLAKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFKEN 184

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 6/99 (6%)

Query: 60  SVVPANAITGGRETSDRVL------YVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXX 113
            V  AN  + G +T D  +      +V NLD +I E  L + F   GP+A          
Sbjct: 83  KVRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSD 142

Query: 114 XXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAF 152
                A++ +     +++AL TLNG+ + N  V +++AF
Sbjct: 143 GQLRCAYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAF 181

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L+ YF + G  +               + F+ +  +   +  ++T 
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK     V+    A        D T  +FVG +  +V  +     F  + + +   
Sbjct: 226 HILDGK-----VIDPKRAIPREEQ--DKTGKIFVGGIGADVRPKEFEEFFAQYGTIIDAQ 278

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 279 LMLDKDTGRSRGFGFVTYDSPD 300

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D+  +F+G LN    ++TLR+ F  + S +   +M D  TG SRG+GF++F
Sbjct: 162 DSCKMFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTF 212

>KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.357
           YHR015W
          Length = 365

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 45/77 (58%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQT 219
           D   +LF+G+L+ NV +E LR  F  +P ++S  + ++  T  S G+G+++F+++ DA  
Sbjct: 89  DSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDAIR 148

Query: 220 AMDSMQGQDLNGRPLRI 236
           A   +   ++    +R+
Sbjct: 149 ATKDLNYCNILSSEIRL 165

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 87/201 (43%), Gaps = 11/201 (5%)

Query: 38  EQNVSSEGNSEQVDDEQGE-NDPSVVPANAITGGRETSDRV--LYVGNLDKAITEDILKQ 94
           E++VS EG+    D    E N P V  A      +  SD +  L++GNL K +TE++L+ 
Sbjct: 55  EEDVSDEGSELSSDYGSVEINGPGVTMAT----NKLASDSMESLFIGNLHKNVTEELLRG 110

Query: 95  YFQVG-GPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFX 153
            F V  G I+              + ++ +    DA  A + LN   I ++ +++  +  
Sbjct: 111 VFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDAIRATKDLNYCNILSSEIRLMPSMR 170

Query: 154 XXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTS 213
                     N+F+ +L +++   T R  +  F  +  G V+   +    +G GF+ F S
Sbjct: 171 NAAYRKQIGTNVFMSNLPLDIPFLTTRFFYVYFSGF--GEVL-SCKLVEEKGIGFIYFES 227

Query: 214 QDDAQTAMDSMQGQDLNGRPL 234
              A   ++   G  L G+ +
Sbjct: 228 NTVANYVVNLFNGSLLYGKQV 248

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 74/172 (43%), Gaps = 18/172 (10%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L+ YF + G  I               + F+ + +    +  ++T 
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 219 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQ 271

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM-QGQ--DLNGRPLRINWAAKR 242
           +M D  TG SRG+GFV++ S D    A+D + Q +  D  G+ + I  A  R
Sbjct: 272 LMLDKDTGRSRGFGFVTYDSPD----AVDRVCQNKFIDFKGKKIEIKRAEPR 319

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    ++TLR+ F  +   +   +M D  TG SRG+GF++F
Sbjct: 155 DICKMFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTF 205

>TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON}
           Anc_5.536 YDR429C
          Length = 278

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  LN N D+ TLR      F   P  +   V+ + +TG SRG  FV+F S++
Sbjct: 189 DDMATLKITQLNENADENTLREELLFPFAPIPKVV---VVRNRETGRSRGLSFVTFASEE 245

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
            A+ A+  + G+      LR+ W+
Sbjct: 246 IAEQALHFLDGRGFMNLILRVEWS 269

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 73/172 (42%), Gaps = 18/172 (10%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L+ YF + G  I               + F+ +      +  ++T 
Sbjct: 199 MFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQ 258

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D    +FVG +  +V  +     F  F + +   
Sbjct: 259 HILDGKVID-------PKRSIPKEEQDKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDAQ 311

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM-QGQ--DLNGRPLRINWAAKR 242
           +M D  TG SRG+GF+++ S D    A+D + Q +  D  G+ + +  A +R
Sbjct: 312 LMLDKDTGRSRGFGFITYDSAD----AVDKVCQNKYIDFKGKQIEVKRAQQR 359

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D+  +F+G LN    ++ LRN F  + + +   +M D  TG SRG+GF++F
Sbjct: 195 DSCKMFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTF 245

>TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON}
           Anc_5.536 YDR429C
          Length = 293

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNAF-KDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
           ++TF + +  LN +  +E +R+     + +     V+ + +TG SRG+ F++FT +  A+
Sbjct: 209 EETFIIKISQLNTHATEEMIRDELLYAYDNIQRVAVIRNRETGKSRGFAFITFTDEKSAE 268

Query: 219 TAMDSMQGQDLNGRPLRINWAAKRD 243
            A+  + G+      LR+ W+  RD
Sbjct: 269 DALYGLDGKGFMNLILRVEWSVPRD 293

>Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015W
           (REAL)
          Length = 662

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+G L   V +E L+  FK + S+ S  V  D  T  S GYG+++F S+ DA  A    
Sbjct: 118 LFIGKLKPTVTEEMLKQTFKKYQSFESAKVCRDFLTKKSLGYGYLNFKSEGDADAAKKDF 177

Query: 225 QGQDLNGRPLRI 236
                 G+ ++I
Sbjct: 178 NYTLFFGQEVKI 189

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 18/172 (10%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L++YF + G  I               + F+ + +    +  ++T 
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 219 HILDGKVID-------PKRSIPREEQDKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDAQ 271

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM-QGQ--DLNGRPLRINWAAKR 242
           +M D  TG SRG+GFV++    D+  A+D + Q +  D  G+ + I  A  R
Sbjct: 272 LMLDKDTGRSRGFGFVTY----DSPEAVDRVCQNKYIDFKGKQIEIKRAEPR 319

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    ++ LR  F  +   +   +M D  +G SRG+GF++F
Sbjct: 155 DNCKMFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTF 205

>Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON}
           (221318..222142) [825 nt, 275 aa]
          Length = 274

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  LN N D+ TLR      F + P  +   V+ + +TG SRG  FV+F+S++
Sbjct: 188 DDMATLKITQLNENADETTLREELLFPFGNIPRVV---VVRNRETGRSRGLAFVTFSSEE 244

Query: 216 DAQTAMDSMQGQDLNGRPLRINWAAKRD 243
            A+ A   + G+      L+++W+  ++
Sbjct: 245 VAEKARRLLNGRGFMNLILQVDWSKPKE 272

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE LR  F+     +   +     +G  +G+ FV F +++ A  A+   
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 285 SCRKIAGRPLRMEFGEDR 302

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++L+++FQ  G I                +AFV++     A  AL+
Sbjct: 223 RILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALK 282

Query: 135 TLNGKQIENNVVKINWA 151
             + ++I    +++ + 
Sbjct: 283 DKSCRKIAGRPLRMEFG 299

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 63/142 (44%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXX-XXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L++YF   G +                + F+ +  +   +  ++T 
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK     V+    A        D T  +FVG +  +V  +     F ++ S +   
Sbjct: 233 HILDGK-----VIDPKRAIPREEQ--DKTGKIFVGGIGPDVRPKEFEEFFSEWGSIIDAQ 285

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GF+++ S D
Sbjct: 286 LMLDKDTGRSRGFGFITYDSPD 307

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    ++ LR  F  + +     +M D  TG SRG+GF+SF
Sbjct: 169 DINKMFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSF 219

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV ++     D  L + F  F       ++ D   G+SRG+GFVSF   +D QTA
Sbjct: 14  DQKTLFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGD-GNSRGFGFVSFAVDEDTQTA 72

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           ++  +     GR LR++ A +R+
Sbjct: 73  LNEGRKMKFQGRLLRVDIAKRRE 95

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 31/78 (39%), Gaps = 5/78 (6%)

Query: 344 TAYIGNIPHFATEADLIPLFQNF-----GFILDFKHYPEKGCCFIKYDTHEQAAVCIVAL 398
           T ++ NIP  AT+A+L   F  F       I+       +G  F+ +   E     +   
Sbjct: 17  TLFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGDGNSRGFGFVSFAVDEDTQTALNEG 76

Query: 399 ANFPFQGRNLRTGWGKER 416
               FQGR LR    K R
Sbjct: 77  RKMKFQGRLLRVDIAKRR 94

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE LR+ F+     +         TG  +G+ F+ F +++ A  A+   
Sbjct: 224 LFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALKDK 283

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRP+R+ +   R
Sbjct: 284 SCRKIAGRPIRMEYGEDR 301

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 6/97 (6%)

Query: 328 PQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFK--HYPEKGCC---- 381
           P   D +  S  P     ++GN+ +  T+  L   FQ+ G I+  +   + + G C    
Sbjct: 207 PNRDDLVSMSKNPPSRILFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFS 266

Query: 382 FIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN 418
           FI + T E A   +   +     GR +R  +G++RS 
Sbjct: 267 FIDFLTEESATKALKDKSCRKIAGRPIRMEYGEDRSK 303

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++L+ +FQ  G I                ++F+++     A  AL+
Sbjct: 222 RILFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALK 281

Query: 135 TLNGKQIENNVVKINW 150
             + ++I    +++ +
Sbjct: 282 DKSCRKIAGRPIRMEY 297

>Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa]
           {ON} YOR319W (HSH49) - homolog of mammalian splicing
           factor/U2 snRNP protein [contig 20] FULL
          Length = 209

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 76/174 (43%), Gaps = 8/174 (4%)

Query: 75  DRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXYAFVEYHQSHDANIAL 133
           D  +YVGN+D  +T +IL + F    P+A               +AFVE++ + D   A 
Sbjct: 9   DNTVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 134 QTLNGK-QIENNVVKINWA-----FXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFP 187
           + LN   ++ +  +K+  A             D    LFV +++  VD   L   F  F 
Sbjct: 69  KCLNNSLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRIFSKFG 128

Query: 188 SYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
                  ++ ++ G  +   +VS+T+ + +  A+  +  Q +  + + +++A K
Sbjct: 129 PLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCISLDYALK 181

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 18/172 (10%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXX-XXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L+ YF   G +                + F+ +  +   +  ++T 
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 184 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 236

Query: 194 VMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM-QGQ--DLNGRPLRINWAAKR 242
           +M D  TG SRG+GF+++ + D    A+D + Q +  D  GR + I  AA R
Sbjct: 237 LMLDKDTGRSRGFGFITYDTPD----AVDKVCQNKFIDFKGRKIEIKRAAPR 284

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTS 213
           D+  +F+G LN    ++ LR+ F  +       +M D  TG SRG+GF++F S
Sbjct: 120 DSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFES 172

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE LR  F+     +   +     +G  +G+ FV F +++ A  A+   
Sbjct: 235 LFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALSDK 294

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 295 SCRKIAGRPLRMEFGEDR 312

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++L+++FQ  G I                +AFV++     A  AL 
Sbjct: 233 RILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALS 292

Query: 135 TLNGKQIENNVVKINW 150
             + ++I    +++ +
Sbjct: 293 DKSCRKIAGRPLRMEF 308

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  D+ LR  F+     +   +     TG  +G+ FV F +++ A  A+   
Sbjct: 224 LFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDK 283

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 284 SCRKIAGRPLRMEFGEDR 301

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+D+L+++FQ  G  I               +AFV++     A  AL 
Sbjct: 222 RILFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALT 281

Query: 135 TLNGKQI 141
             + ++I
Sbjct: 282 DKSCRKI 288

>TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {ON}
           Anc_7.159 YIR005W
          Length = 140

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 78  LYVGNLDKAITE-DILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           +++GNL+K +TE DIL  + Q G PI               +A+++Y  S    +A+  L
Sbjct: 36  IFIGNLNKNLTEGDILTVFSQFGNPIDLKLIRNKQTNHSMGFAYLKYEDSRSCILAIDNL 95

Query: 137 NGKQIENNVVKIN 149
           NG ++  N +KI+
Sbjct: 96  NGSKVAGNTLKID 108

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 133 LQTLNGKQIENNVVKI--NWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL 190
           +Q LN  +++NN++ I  +W +        D   +F+G+LN N+ +  +   F  F + +
Sbjct: 7   IQQLNDTELQNNILSIEKSWHYNYI-----DYGYIFIGNLNKNLTEGDILTVFSQFGNPI 61

Query: 191 SGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
              ++ + QT  S G+ ++ +        A+D++ G  + G  L+I+
Sbjct: 62  DLKLIRNKQTNHSMGFAYLKYEDSRSCILAIDNLNGSKVAGNTLKID 108

 Score = 32.3 bits (72), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 346 YIGNIPHFATEADLIPLFQNFGFILDFKHYPEK------GCCFIKYDTHEQAAVCIVALA 399
           +IGN+    TE D++ +F  FG  +D K    K      G  ++KY   E +  CI+A+ 
Sbjct: 37  FIGNLNKNLTEGDILTVFSQFGNPIDLKLIRNKQTNHSMGFAYLKY---EDSRSCILAID 93

Query: 400 NF 401
           N 
Sbjct: 94  NL 95

>KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {ON}
           weakly similar to uniprot|Q00916 Saccharomyces
           cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog,
          Length = 301

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 4/71 (5%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG L+  VD+  L+ +F  +    S  ++ D Q G SRGYGFV FTS +D++     +
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGFVQFTSYEDSKQCFREL 175

Query: 225 ---QGQDLNGR 232
              +G ++ GR
Sbjct: 176 GVRKGIEIMGR 186

>ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR005W (IST3)
          Length = 173

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 56/108 (51%), Gaps = 7/108 (6%)

Query: 132 ALQTLNGKQIENNVV--KINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSY 189
           ++Q L+  ++E+ ++  + +W +       D  +  F G LNV + +  +   F  F   
Sbjct: 6   SIQKLSETELEHGILSEEASWHYQYK----DQAYIHFSG-LNVELTEGDILTVFSQFGVP 60

Query: 190 LSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
               ++ D +TG SRG+GF+ +  Q     A+D++ G +L GR L+++
Sbjct: 61  TDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKVD 108

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 63/142 (44%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L+ YF + G  +               + F+ + +S   +  ++T 
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVDEVVKTQ 231

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK     V+    A        D T  +F+G +  +V  +     F  + + +   
Sbjct: 232 HILDGK-----VIDPKRAIPREEQ--DKTGKIFIGGIGADVRPKEFEEFFAKYGNIIDAQ 284

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 285 LMLDKDTGRSRGFGFVTYDSPD 306

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D+  +F+G LN    ++ LR+ F  + + +   +M D  TG SRG+GF++F
Sbjct: 168 DSCKMFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTF 218

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TE+ L+ YF + G  +               + F+ +  +   +  ++T 
Sbjct: 158 MFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVDEVVKTQ 217

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +   + F  + + +   
Sbjct: 218 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGADVRPKEFEDFFAQYGTIIDAQ 270

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 271 LMLDKDTGRSRGFGFVTYDSPD 292

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D+  +F+G LN    +ETLR+ F  +   +   +M D  TG SRG+GF++F
Sbjct: 154 DSCKMFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTF 204

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L   +  E L   FK + S++S  V  +     S G+G+++F +++DA+ A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 225 QGQDLNGRPLRI 236
               + G+ +RI
Sbjct: 126 NYNKIMGKEIRI 137

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 64/155 (41%), Gaps = 4/155 (2%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGP-IAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           L+VGNL + IT + L + F+V    I+              + ++ +    DA  A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N  +I    ++I  +        +   N+F  +L +  +  T R  +  F  Y  G+V+ 
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKY--GNVL- 182

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNG 231
            ++  SS+  GFV F     A+  +     ++  G
Sbjct: 183 SVKLDSSKNIGFVYFEDDTIARDVIKEFNNKEFLG 217

>Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W
           (REAL)
          Length = 670

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+G+L   V +E LR  F+ + S+ S  +  D  T  S GYG+++F ++++ + A    
Sbjct: 123 LFIGNLKPTVTEEMLRKIFRKYQSFESAKICRDFLTKKSLGYGYLNFKNKNETEAARKEF 182

Query: 225 QGQDLNGRPLRI 236
                 G+ ++I
Sbjct: 183 NYTVFFGQEVKI 194

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 333 HIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAA 392
           HI  SAP +  T Y+GNIP   T  +L+   ++ G + + K  PEK C F+ +   E AA
Sbjct: 155 HIFTSAPRK--TVYLGNIPPSLTVRELLDHVRS-GVVEEVKILPEKTCAFLTF-VDESAA 210

Query: 393 VCI---VALANFPFQGRNLRTGWGK 414
           +       L      GR+++ GWGK
Sbjct: 211 LLFHSDAILKRLHIDGRDIKIGWGK 235

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 12/103 (11%)

Query: 328 PQAVDHIIRSAPPRVTTAYIGNIPHFA---------TEADLIPLFQNFGFILDFKHYPEK 378
           P A+   + +   R    YIGNI  +          T   L  +FQ +G +      PEK
Sbjct: 481 PNAIALAVSNGASR--NVYIGNIDFYEDSKRQEPIFTADYLRKIFQEYGEVEQLNFLPEK 538

Query: 379 GCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421
            C F+ Y     A   I  + + P   +NL+  +GK+R   +P
Sbjct: 539 NCAFVNYTNISNAISAIDKIKSNPL-FKNLKINFGKDRCGTIP 580

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE LR  F+     +   +     +G  +G+ FV F +++ A  A+   
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 300 TCRKIAGRPLRMEFGEDR 317

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++L+++FQ  G  I               +AFV++     A  AL+
Sbjct: 238 RILFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALK 297

Query: 135 TLNGKQI 141
               ++I
Sbjct: 298 DKTCRKI 304

>ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {ON}
           similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043W NOP4 Nucleolar protein essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis contains four RNA recognition motifs
           (RRMs)
          Length = 714

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  N  DE L   F +F       ++ D +   SRG+GFVSF  +DD   A
Sbjct: 25  DMKTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKD-KNQKSRGFGFVSFAVEDDTMEA 83

Query: 221 MDSMQGQDLNGRPLRINWAAKR 242
           +   +   LNG  +R++ A +R
Sbjct: 84  LKQARRTKLNGHQVRVDLAKRR 105

>TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.491
           YPL043W
          Length = 697

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  + +   D+   + F +F       ++ D     SRG+GFVSF S++D+Q A
Sbjct: 20  DLKTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDTNK-KSRGFGFVSFASEEDSQEA 78

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +   +    LR+++A +RD
Sbjct: 79  LTKARTSKIQNHLLRVDFAKRRD 101

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXX-XXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED LK YF   G +                + F+ + ++   +  ++T 
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 271 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 323

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GF+++ + D
Sbjct: 324 LMLDKDTGRSRGFGFITYDTPD 345

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    ++ L++ F  +       +M D  TG SRG+GF++F
Sbjct: 207 DICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTF 257

>NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa]
           {ON} Anc_1.357 YFR023W
          Length = 611

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           L++G L+ +V +ETL  AF+D+ +  S  +  D  T  S GYG+++F++  +A   +D  
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 225 QGQDLNGRPLRI 236
              +L G  ++I
Sbjct: 163 NYTNLFGNEIKI 174

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 57/145 (39%), Gaps = 4/145 (2%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXX-YAFVEYHQSHDANIALQTL 136
           LY+G L K +TE+ L + F+    +A               Y ++ +  S +A   +   
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 196
           N   +  N +KI  +        +   N+F  +L +     T R  +  F  Y  G ++ 
Sbjct: 163 NYTNLFGNEIKIMPSMRNTLYRKNIGTNVFFSNLPLENKQLTTRKFYDTFKKY--GEIL- 219

Query: 197 DMQTGSSRGYGFVSFTSQDDAQTAM 221
             +  S +  GFV F +   A  A+
Sbjct: 220 SCKLDSRKNIGFVYFENDKAALQAI 244

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAV--C 394
           SAP R  T Y+GNIP   T  +L+   ++ G + D K  PEK C FI +     A +   
Sbjct: 165 SAPSR--TVYLGNIPTTLTVKELLDHVRS-GVVEDVKILPEKMCAFISFVDDSSALLFHS 221

Query: 395 IVALANFPFQGRNLRTGWGK 414
              L     +GR+++ GWGK
Sbjct: 222 DAILKRLNIEGRDIKIGWGK 241

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 345 AYIGNI---------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
            YIGNI             TE +L  LFQ +G +      P K CCFI Y     A   I
Sbjct: 502 VYIGNIDFEEDSKRNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAI 561

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P+  ++L+  +GK+R   +P
Sbjct: 562 DKIKSNPY-FKDLKINFGKDRCGNIP 586

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXX-XXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L+ YF   G +                + F+ + +S   +  ++T 
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 244 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQYGTIIDAQ 296

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GF+++ + D
Sbjct: 297 LMLDKDTGRSRGFGFITYDTPD 318

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    ++ LR+ F  + +     +M D  TG SRG+GF++F
Sbjct: 180 DMCKMFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTF 230

>Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON}
           similar to Ashbya gossypii ABL059W
          Length = 204

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 78/174 (44%), Gaps = 17/174 (9%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQTL 136
           +YVGNLD  +T++ L + F   GP+                +AFVE++ + D   A+++L
Sbjct: 9   IYVGNLDGQVTKEHLYELFVQMGPVYRIRYRKDKITQEYQGFAFVEFYTNSDCEFAIKSL 68

Query: 137 NGKQIENNVVKINWAFXXXXXXXDDTF---------NLFVGDLNVNVDDETLRNAFKDFP 187
                 NN V +           ++T           LFV +L+ +VD + L+  F  F 
Sbjct: 69  ------NNSVSLFGKILKVRRTLENTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFG 122

Query: 188 SYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
             +    ++ ++ G+ +   ++ +++   +  A+  +  Q L  R + I++A K
Sbjct: 123 PLVKQPEIFTLKNGTLKC-AYIYYSTFKHSDEALQKLNKQILANRVISIDYAFK 175

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 40/88 (45%)

Query: 65  NAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYH 124
           N   GG   S   L+V NLD ++    L++ F   GP+                A++ Y 
Sbjct: 87  NTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQPEIFTLKNGTLKCAYIYYS 146

Query: 125 QSHDANIALQTLNGKQIENNVVKINWAF 152
               ++ ALQ LN + + N V+ I++AF
Sbjct: 147 TFKHSDEALQKLNKQILANRVISIDYAF 174

>ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa]
           {ON} similar to uniprot|Q04067 YDR429C Saccharomyces
           cerevisiae TIF35 Subunit of the core complex of
           translation initiation factor 3(eIF3)
          Length = 273

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  LN+N D+ TLR      F   P  +   V+ + +TG SRG  FV+F S++
Sbjct: 187 DDMSTLKITQLNLNADENTLREELLFPFAPIPKVV---VVRNRETGRSRGLSFVTFASEE 243

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
            A+ A+  + G+      L + W+
Sbjct: 244 IAEQALHFLNGRGFMNLILHVEWS 267

>Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON}
           similar to Ashbya gossypii ADR189W
          Length = 270

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  LN N D+ T++      F+  P      V+ + +TG SRG  +V+F+S+ 
Sbjct: 186 DDAMTLKITQLNENADEMTIKQKLLTPFQTIPRVA---VVRNKETGRSRGIAYVTFSSEH 242

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
           +A+TA+  + G+      L   W+
Sbjct: 243 EAETALRLLDGRGFMNLILHAEWS 266

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 59/142 (41%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXX-XXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TE+ L+ YF   G +                + F+ +      +  ++T 
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 156 HILDGKVIDPKR-------SIPREEQDKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDAQ 208

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 209 LMLDKDTGRSRGFGFVTYDSPD 230

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    +ETLR+ F  +       +M D  TG SRG+GF++F
Sbjct: 92  DNCKMFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTF 142

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 76/196 (38%), Gaps = 34/196 (17%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXX----YAFVEYHQSHDANIAL 133
           L++G +DKAIT   L   F V GPI                   Y FV Y     A   +
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAANCI 229

Query: 134 QTLNGKQIENNVVKIN------------WAFXXXXXXXDDTFNLFVGDL-NVNVDDE--- 177
             LNGK+I ++ + IN            W          +   +F+G+L  V V+ E   
Sbjct: 230 NDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPIT 289

Query: 178 ----------TLRNAFKDFPSYLSGHVMWDMQTGSS---RGYGFVSFTSQDDAQTAMDSM 224
                      L+  F +F   LS +   D     S   +GYGFV   + ++A   ++S 
Sbjct: 290 CGMILETIKDRLKEQFANF-EILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSF 348

Query: 225 QGQDLNGRPLRINWAA 240
            G + +G  L +N A 
Sbjct: 349 NGYEFHGSKLIVNRAV 364

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXX-XXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED LK YF   G +                + F+ + ++   +  ++T 
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 270 HILDGKVIDPKRA-------IPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 322

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GF+++ + D
Sbjct: 323 LMLDKDTGRSRGFGFITYDTPD 344

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    ++ L++ F  +       +M D  TG SRG+GF++F
Sbjct: 206 DICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTF 256

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFV  LN   + + L   F  F   +S  ++ D  TG S GYGF+ F S+   + A  +M
Sbjct: 244 LFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNM 303

Query: 225 QGQDLNGRPLRINWA 239
           +G  ++ + + ++++
Sbjct: 304 EGVIIDDKKIHVDFS 318

>Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON}
           (14539..16821) [2283 nt, 761 aa]
          Length = 760

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%)

Query: 149 NWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGF 208
           NW+            NL++  +  ++  + L   F  F   +S  ++ D  TG S GYGF
Sbjct: 128 NWSVSINEHALTHPGNLYIKGIPKDLSIDDLVPVFSTFGDIISMKIIQDSITGISLGYGF 187

Query: 209 VSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           +S+     + + M  + GQ +NG  L IN+  +R
Sbjct: 188 LSYRLGSQSSSCMSKLNGQIMNGSTLFINYHVER 221

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 6/77 (7%)

Query: 346 YIGNIPHFATEADLIPLFQNFGFILDFKHYPEK------GCCFIKYDTHEQAAVCIVALA 399
           YI  IP   +  DL+P+F  FG I+  K   +       G  F+ Y    Q++ C+  L 
Sbjct: 145 YIKGIPKDLSIDDLVPVFSTFGDIISMKIIQDSITGISLGYGFLSYRLGSQSSSCMSKLN 204

Query: 400 NFPFQGRNLRTGWGKER 416
                G  L   +  ER
Sbjct: 205 GQIMNGSTLFINYHVER 221

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 17/96 (17%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW----------------DMQTGSSRGYG 207
           N+++  +  +  DE L   +K +   +S  V+                 D   G+S+GYG
Sbjct: 526 NIYIKHIPFSWKDEDLYEYYKKYGEVISAKVITVGGSKNKDSKSELKGSDAPVGTSKGYG 585

Query: 208 FVSFTSQDDAQTAMDSMQGQDLNG-RPLRINWAAKR 242
           FV F +  DA  A+     + L+    L +++A KR
Sbjct: 586 FVYFKNPIDASRAILETDRRKLDKDHTLHVSFAQKR 621

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 11/87 (12%)

Query: 345 AYIGNI----------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVC 394
            Y+GNI          P   TE  L  +FQ +G +      PEK CCFI +     A + 
Sbjct: 621 VYLGNIDFENDIKLHNPPIFTELSLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILA 680

Query: 395 IVALANFPFQGRNLRTGWGKERSNFMP 421
           I  + N P   ++L+  +GK+R   +P
Sbjct: 681 IEKIKNNP-DFKDLKINFGKDRCGNIP 706

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 344 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI---VALAN 400
           T Y+GNIP   +  DL+   ++ G + + K  P+K C FI +   E +A+       L  
Sbjct: 269 TVYLGNIPSDLSVKDLLDHVRS-GVVENIKILPDKMCAFISF-VDESSALLFHSDAILKR 326

Query: 401 FPFQGRNLRTGWGK 414
               GR+++ GWGK
Sbjct: 327 LNIGGRDIKIGWGK 340

>KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C
          Length = 874

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%)

Query: 150 WAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFV 209
           W+        +   NL+V  +  N+  E L   F  F   L   ++ D  T  S G+GFV
Sbjct: 178 WSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFV 237

Query: 210 SFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           S+     A   +  + G  +NG PL +N+  +R
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPLFVNYHVER 270

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 38/96 (39%), Gaps = 14/96 (14%)

Query: 327 NPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFG------FILDFKHYPEKGC 380
           NP A++H            Y+  IP   T+ DL+P+F  FG       ILD       G 
Sbjct: 183 NPHALNH--------PGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGF 234

Query: 381 CFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 416
            F+ Y    QA+ CI  L      G  L   +  ER
Sbjct: 235 GFVSYALGSQASNCIKELNGNLMNGSPLFVNYHVER 270

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 16/95 (16%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW---------------DMQTGSSRGYGF 208
           NL+V  L ++  DE L   F+ F   +S  ++                D   G S+GYGF
Sbjct: 731 NLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYGF 790

Query: 209 VSFTSQDDAQTAMDSMQGQDLNG-RPLRINWAAKR 242
           V F +  DA  AM    G  LN    L +++A +R
Sbjct: 791 VCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRR 825

>Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {ON}
           YDR429C (REAL)
          Length = 274

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  +N N D+ +LR      F   P      V+ + +TG SRG  FV+F+S++
Sbjct: 188 DDMCTLKIMQVNENADENSLREELLFPFAPIPRV---SVVRNKETGKSRGLAFVTFSSEE 244

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
            A+ A+  + G+      LR+ W+
Sbjct: 245 VAEQALRFLDGRGYMNLILRVEWS 268

>Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {ON}
           YDR429C (REAL)
          Length = 274

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  +N N D+ +LR      F   P      V+ + +TG SRG  FV+F+S++
Sbjct: 188 DDMCTLKIMQVNENADENSLREELLFPFAPIPRV---SVVRNKETGKSRGLAFVTFSSEE 244

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
            A+ A+  + G+      LR+ W+
Sbjct: 245 VAEQALRFLDGRGYMNLILRVEWS 268

>YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON}
           TIF35eIF3g subunit of the core complex of translation
           initiation factor 3 (eIF3), which is essential for
           translation; stimulates resumption of ribosomal scanning
           during translation reinitiation
          Length = 274

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  +N N D+ +LR      F   P      V+ + +TG SRG  FV+F+S++
Sbjct: 188 DDMCTLKIMQVNENADENSLREELLFPFAPIPRV---SVVRNKETGKSRGLAFVTFSSEE 244

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
            A+ A+  + G+      LR+ W+
Sbjct: 245 VAEQALRFLDGRGYMNLILRVEWS 268

>KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.536
           YDR429C
          Length = 279

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
           DD+  L +  LN N D+ TLR      F       V+ + +TG SRG  FV+F+S+  A+
Sbjct: 191 DDSCTLKILQLNENADENTLREELLFPFAPIQRVVVVRNRETGRSRGLAFVTFSSEQLAE 250

Query: 219 TAMDSMQGQDLNGRPLRINWA 239
            A+  + G+      L++ W+
Sbjct: 251 KALQFLDGRGFMNLILKVEWS 271

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 323 PPQVNPQAVDHI-IRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           P  VN QA + +   SAP R  T Y+GN+P   T  +L+   ++ G + D K  PEK C 
Sbjct: 166 PLSVNSQANNSLNFTSAPTR--TVYLGNVPPHLTVKELLDHVRS-GVVEDVKIIPEKMCA 222

Query: 382 FIKYDTHEQAAVCI---VALANFPFQGRNLRTGWGK 414
           FI +   E AA+       L       R+++ GWGK
Sbjct: 223 FISF-VDESAALLFHSDAILKRLNIGDRDIKIGWGK 257

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 345 AYIGNI---------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
            Y+GNI             TE +L  +FQ +G +      PEK CCFI Y     A + +
Sbjct: 508 VYVGNIDFASDSLNDERIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILAL 567

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P+  ++L+  +GK+R   +P
Sbjct: 568 DKIKSNPY-FKDLKINFGKDRCGNVP 592

>KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2.80
           YNL175C
          Length = 381

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE L+  F+     +   +     +G  +G+ FV F S++ A  A+   
Sbjct: 225 LFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALKDK 284

Query: 225 QGQDLNGRPLRINWAAKR 242
             + +  RP+R+ +   R
Sbjct: 285 TCRRIASRPIRMEYGEDR 302

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++LK++FQ  G  I               +AFV++     A  AL+
Sbjct: 223 RILFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALK 282

Query: 135 TLNGKQIENNVVKINWA 151
               ++I +  +++ + 
Sbjct: 283 DKTCRRIASRPIRMEYG 299

>Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to
           Ashbya gossypii AFR649W
          Length = 324

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+  LN     E +   F+ F   LS  ++ D +TG+S GYGF+ F +++  + A   M
Sbjct: 243 LFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKEACEQAYSKM 302

Query: 225 QGQDLNGRPLRINWA 239
               ++ R + ++++
Sbjct: 303 DNTLIDDRRIHVDFS 317

>KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326
           bp, 441 aa] {ON} Anc_1.408 YNL004W intron location
           uncertain
          Length = 441

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D F +FV +L  +V+ + L++ FK   + L   V  D   G SRG+G V F++Q+D + A
Sbjct: 240 DGFEIFVANLPFSVNWQALKDMFKPCGNVLRADVELD-HVGRSRGFGTVLFSNQEDMRRA 298

Query: 221 MDSMQGQDLNGRPLRI 236
           +D   G ++ GR L +
Sbjct: 299 IDDYNGYEIEGRRLDV 314

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFIL------DFKHYPEKGCCFIKYDTHEQ 390
           S   R    Y  N+P     +DL  LF+  G ++      D  + P  G   I+Y+  E 
Sbjct: 357 SGDERNNFIYCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQP-TGVAVIEYENIED 415

Query: 391 AAVCIVALANFPFQGRNLRTGWGKE 415
           A VCI  L N+ + G +L   + K+
Sbjct: 416 ADVCIERLNNYNYGGCDLVISYAKK 440

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 2/70 (2%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG+L  +   + LR+ F      +   ++     G  RG G V FT+ DD   A+   
Sbjct: 121 IFVGNLTYDCTPDDLRDFFSQIGEVVRADII--TSRGHHRGMGTVEFTNNDDVTEAIRQY 178

Query: 225 QGQDLNGRPL 234
            G D   R +
Sbjct: 179 DGSDFMERQI 188

>KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 835

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           NL+V  +  ++  + L   F  F   LS  ++ D  TG S GYGF+S+     A   +  
Sbjct: 250 NLYVRGIPKDLTIDDLVPVFAKFGPVLSMKIICDSNTGDSLGYGFLSYPLGSQASRCIKE 309

Query: 224 MQGQDLNGRPLRINWAAKR 242
           + G  +NG PL IN+  +R
Sbjct: 310 LNGNLMNGSPLFINYHVER 328

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 6/77 (7%)

Query: 346 YIGNIPHFATEADLIPLFQNFGFILDFKHYPEK------GCCFIKYDTHEQAAVCIVALA 399
           Y+  IP   T  DL+P+F  FG +L  K   +       G  F+ Y    QA+ CI  L 
Sbjct: 252 YVRGIPKDLTIDDLVPVFAKFGPVLSMKIICDSNTGDSLGYGFLSYPLGSQASRCIKELN 311

Query: 400 NFPFQGRNLRTGWGKER 416
                G  L   +  ER
Sbjct: 312 GNLMNGSPLFINYHVER 328

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 77/174 (44%), Gaps = 5/174 (2%)

Query: 72  ETSDRVLYVGNLDKAITEDILKQYFQVGGPIAXXXX-XXXXXXXXXXYAFVEYHQSHDAN 130
           + ++  +YVGNLD  +++++L + F    P++               +AFVE     D +
Sbjct: 3   QNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 131 IALQTLNGK-QIENNVVKINWAFXXXXXXXD--DTFNLFVGDLNVNVDDETLRNAFKDFP 187
            A+++LN    +   V+K+                  LFV +L+  +D   L+  F  F 
Sbjct: 63  FAIKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFG 122

Query: 188 SYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAK 241
                  ++ ++ G+ R   +V FT+   +  A++ +  Q +  + + I++A K
Sbjct: 123 PLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

>Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +V D+ LR  F+     +   +     +G  +G+ F+ F +++ +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 301 SCRKIAGRPLRMEYGEDR 318

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL   +T+D+L+++FQ  G I                +AF+++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 135 TLNGKQIENNVVKINW 150
             + ++I    +++ +
Sbjct: 299 DKSCRKIAGRPLRMEY 314

>NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167
          Length = 226

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           ++V  L     ++ L   F  F +     +  + +TG+SR YGF+ FTS+DDA+ A D+M
Sbjct: 99  IYVSRLPHGFHEKELSKYFSQFGNLKEVRLARNKKTGNSRHYGFIEFTSKDDAKVAEDTM 158

Query: 225 QGQDLNGRPLRI 236
               L G  L++
Sbjct: 159 NNYLLMGHLLQV 170

>Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W
           (REAL)
          Length = 536

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXX-XXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L++YF   G +                + F+ + +    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 221 HILDGKVIDPKRA-------IPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 273

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 274 LMLDKDTGQSRGFGFVTYDSAD 295

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           ++  +F+G LN +  ++ LR  F  + +     +M D  TG SRG+GF+SF
Sbjct: 157 ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF 207

>SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {ON}
           similar to uniprot|P40567 Saccharomyces cerevisiae
           YIR009W MSL1 U2B component of U2 snRNP involved in
           splicing binds the U2 snRNA stem-loop IV in vitro does
           not contain the conserved C-terminal RNA binding domain
           found in other family members
          Length = 110

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 165 LFVGDLNVNVDDETLR-NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           L+V +LN  +   TLR N +  F +Y  G V+    T   RG  FV   + ++A  AM S
Sbjct: 30  LYVNNLNDQIRPNTLRENLYLLFSTY--GEVIQVSMTSKERGQAFVLLRTMNEANLAMIS 87

Query: 224 MQGQDLNGRPLRINWA 239
           +Q +   G+PLRI ++
Sbjct: 88  LQDEPFFGKPLRIRFS 103

>Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {ON}
           YNL175C (REAL)
          Length = 400

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +V D+ LR  F+     +   +     +G  +G+ F+ F +++ +  A+   
Sbjct: 238 LFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 297

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 298 SCRKIAGRPLRMEYGEDR 315

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL   +T+D+L+++FQ  G  +               +AF+++     +  AL+
Sbjct: 236 RILFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 295

Query: 135 TLNGKQIENNVVKINWA 151
             + ++I    +++ + 
Sbjct: 296 DKSCRKIAGRPLRMEYG 312

>AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR250C
          Length = 834

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 4/107 (3%)

Query: 140 QIENNVVKIN----WAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVM 195
           QI+ N+ K +    W+            NL++  +  ++  + L   F  F + LS  ++
Sbjct: 190 QIKENLEKSDHVEAWSISQNPHALTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKII 249

Query: 196 WDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
            D  T  S GYGF+S+     A   +  + G  +NG PL IN+  +R
Sbjct: 250 IDGNTRESLGYGFISYPLGSQAARCIKELNGNLMNGSPLFINYHVER 296

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 31/77 (40%), Gaps = 6/77 (7%)

Query: 346 YIGNIPHFATEADLIPLFQNFGFILDFK------HYPEKGCCFIKYDTHEQAAVCIVALA 399
           YI  IP   +  DLIP+F  FG +L  K           G  FI Y    QAA CI  L 
Sbjct: 220 YIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKELN 279

Query: 400 NFPFQGRNLRTGWGKER 416
                G  L   +  ER
Sbjct: 280 GNLMNGSPLFINYHVER 296

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 15/73 (20%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHV---------------MWDMQTGSSRGYGF 208
           NL+V  + ++  DE L + +  +   +S  +               + D+  G+SRGYGF
Sbjct: 600 NLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYGF 659

Query: 209 VSFTSQDDAQTAM 221
           V F +  DA  AM
Sbjct: 660 VCFKNPLDASRAM 672

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 163 FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMD 222
           + +F+ +L  +V+ + L++ FK+    L   V  D + G SRGYG V + ++++ Q A++
Sbjct: 261 YEVFIANLPYSVNWQALKDMFKECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIE 319

Query: 223 SMQGQDLNGRPLRIN 237
              G +L GR L ++
Sbjct: 320 RYNGYELEGRVLDVH 334

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 343 TTAYIGNIPHFATEADLIPLFQNFGFI----LDFKHYPE-KGCCFIKYDTHEQAAVCIVA 397
           +T ++ N+P    ++DL  LF+  G +    L F +  +  G   ++YD    A VCI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 398 LANFPFQGRNLRTGW 412
           L ++ + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           ++FVG+L  +   E L+  F      +   ++     G  RG G V FT+ DD   A+  
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADII--TSRGHHRGMGTVEFTNADDVDEAIRR 220

Query: 224 MQGQDLNGRPL 234
             G  L  R +
Sbjct: 221 FDGSTLLDREI 231

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 345 AYIGNIPHFA---------TEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
            Y+GNI + +         TE  L  +FQ +G +      PEK CCFI Y     A + +
Sbjct: 526 VYVGNIDYVSDSVRDERIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILAL 585

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P+  ++L+  +GK+R   +P
Sbjct: 586 DKIKSNPY-FKDLKINFGKDRCGNVP 610

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 323 PPQVNPQAVDHI-IRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           P  VN QA + +   SA  R  T Y+GN+P   +  +L+   ++ G + D K  PEK C 
Sbjct: 184 PLSVNAQANNPLNFTSAQSR--TVYLGNVPPNLSVKELLDHVRS-GVVEDVKIIPEKMCA 240

Query: 382 FIKYDTHEQAAVCI---VALANFPFQGRNLRTGWGK 414
           FI +   E AA+       L       R+++ GWGK
Sbjct: 241 FISF-VDESAALLFHSDAILKRLNIGDRDIKIGWGK 275

>Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {ON}
           YDR429C (REAL)
          Length = 274

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNA----FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           DD   L +  +N N D+ +LR      F   P      V+ + +TG SRG  FV+F+S++
Sbjct: 188 DDMCTLKIMQVNENADENSLREEILFPFAPIPRV---SVVRNKETGKSRGLAFVTFSSEE 244

Query: 216 DAQTAMDSMQGQDLNGRPLRINWA 239
            A+ A+  + G+      LR+ W+
Sbjct: 245 VAEQALRFLDGRGYMNLILRVEWS 268

>YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit of
           cleavage factor I, a five-subunit complex required for
           the cleavage and polyadenylation of pre-mRNA 3' ends;
           RRM-containing heteronuclear RNA binding protein and
           hnRNPA/B family member that binds to poly (A) signal
           sequences
          Length = 534

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXX-XXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L++YF   G +                + F+ + +    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 221 HILDGKVIDPKRA-------IPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 273

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 274 LMLDKDTGQSRGFGFVTYDSAD 295

>Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W
           (REAL)
          Length = 539

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXX-XXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L++YF   G +                + F+ + +    +  ++T 
Sbjct: 164 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 223

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 224 HILDGKVIDPKRA-------IPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 276

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 277 LMLDKDTGQSRGFGFVTYDSAD 298

>SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs)
          Length = 697

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D   LFV  +  + +DE   + F  F       ++ D +   SRG+GFVSF  +DD + A
Sbjct: 24  DMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEK-QSRGFGFVSFAVEDDTKEA 82

Query: 221 MDSMQGQDLNGRPLRINWAAKRD 243
           +   +      R LRI+ A +R+
Sbjct: 83  LAQARKAKFKNRLLRIDIAKRRE 105

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 31/55 (56%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 215
           ++F++FV ++  +   E+L + F  F        + D +TG ++G  FV+F +++
Sbjct: 296 ESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTEE 350

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXX-XXXXXXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TE+ L+ YF   G +A               + F+ +  +   +  ++T 
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK     V+    A        D T  +FVG +  +V  +     F  + S +   
Sbjct: 248 HILDGK-----VIDPKRAIPREEQ--DKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQ 300

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GF+++ + D
Sbjct: 301 LMLDKDTGRSRGFGFITYDTPD 322

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           D   +F+G LN    +E LR+ F  + +     +M D  TG SRG+GF++F
Sbjct: 184 DINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTF 234

>Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W
           (REAL)
          Length = 551

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXX-XXXXXXXYAFVEYHQSHDANIALQT- 135
           +++G L+   TED L++YF   G +                + F+ + +    +  ++T 
Sbjct: 163 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 222

Query: 136 --LNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGH 193
             L+GK I+                 D T  +FVG +  +V  +     F  + + +   
Sbjct: 223 HILDGKVIDPKRA-------IPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 275

Query: 194 VMWDMQTGSSRGYGFVSFTSQD 215
           +M D  TG SRG+GFV++ S D
Sbjct: 276 LMLDKDTGQSRGFGFVTYDSAD 297

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211
           ++  +F+G LN +  ++ LR  F  + +     +M D  TG SRG+GF+SF
Sbjct: 159 ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF 209

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +FVG L+ +V ++ L   F+ F     G +M D++    +  GFV+F  + DA+ A+  +
Sbjct: 310 IFVGGLSTDVSEQELNELFRPF-----GEIM-DVKIPLGKKCGFVTFKRRIDAKAAIKGL 363

Query: 225 QGQDLNGRPLRINWA 239
            G  + G P+R++W 
Sbjct: 364 HGFLVRGCPIRLSWG 378

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%)

Query: 343 TTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 402
           +T ++G +    +E +L  LF+ FG I+D K    K C F+ +     A   I  L  F 
Sbjct: 308 STIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIKGLHGFL 367

Query: 403 FQGRNLRTGWGKERSN 418
            +G  +R  WGK  +N
Sbjct: 368 VRGCPIRLSWGKTFNN 383

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 61/142 (42%), Gaps = 17/142 (11%)

Query: 118 YAFVEYHQSHDANIALQTLNGKQIEN---------------NVVKINWAFXXXXXXXDDT 162
           Y  VE+    +A  AL TLNG  + N               +V ++NWA           
Sbjct: 101 YCLVEFESQQEAAEAL-TLNGLPLPNFFSRSRNSVINASQLSVFRLNWAVWPTVNGLSPE 159

Query: 163 FNLFVGDLNVNVDDETLRNAFKD-FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAM 221
           + LFVG+L+    +  L   F+  + S  +  +M +   G S  +GF+ F + ++ + A 
Sbjct: 160 YPLFVGNLSSITREADLLLLFRSRYKSVKTVRMMTEPIPGKSDSFGFICFANCEERRLAA 219

Query: 222 DSMQGQDLNGRPLRINWAAKRD 243
           + M G     + +++  A  RD
Sbjct: 220 EEMNGICFQDKYIKVAIANPRD 241

>YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON}
           NOP13Nucleolar protein found in preribosomal complexes;
           contains an RNA recognition motif (RRM)
          Length = 403

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +V D+ LR  F+     +   +     +G  +G+ F+ F +++ +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 301 SCRKIAGRPLRMEYGEDR 318

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL   +T+D+L+++FQ  G I                +AF+++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 135 TLNGKQIENNVVKINWA 151
             + ++I    +++ + 
Sbjct: 299 DKSCRKIAGRPLRMEYG 315

>KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {ON}
           Anc_1.357 YHR015W
          Length = 642

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+G L  +V +  L+  F  F S  S  + +D +T  S GYG+++F+  D+    ++  
Sbjct: 97  LFIGGLGPHVTESMLKELFNKFSSLYSVKICYDSETKKSLGYGYLNFSGSDEIDRVIEEF 156

Query: 225 QGQDLNGRPLRI 236
              ++ G  ++I
Sbjct: 157 NYTEVFGSEIKI 168

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 78  LYVGNLDKAITEDILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTLN 137
           ++V NL    TED +  +F V GP+               +AF+ Y +  D   A++ L+
Sbjct: 307 VFVKNLPIDTTEDEILDFFSVVGPVKSVFTSKVLKFKSE-WAFITYKKGSDTERAIEELD 365

Query: 138 GKQIENNVVKINWA 151
           GK+ ++  + +  A
Sbjct: 366 GKKYKDRKISVTKA 379

>Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {ON}
           YNL175C (NOP13) - nucleolar protein [contig 103] FULL
          Length = 393

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE L+  F+     +   +     TG  +G+ FV F  ++    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 297 TCRKIAGRPLRMEFGEDR 314

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++LK++FQ  G I                +AFV++        AL+
Sbjct: 235 RILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALK 294

Query: 135 TLNGKQIENNVVKINWA 151
               ++I    +++ + 
Sbjct: 295 DKTCRKIAGRPLRMEFG 311

>KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some
           similarities with uniprot|P40561 Saccharomyces
           cerevisiae YIR001C SGN1 Cytoplasmic RNA-binding protein
           contains an RNA recognition motif (RRM) may have a role
           in mRNA translation as suggested by genetic interactions
           with genes encoding proteins involved in translational
           initiation
          Length = 345

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 161 DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTA 220
           D+ ++FVG++      ETL   FKD    +   ++++  TG+ +GY ++ F S D    A
Sbjct: 101 DSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIPKA 160

Query: 221 MDSMQGQDLNGRPLRINWAAKR 242
           ++ ++  +L+G    IN A KR
Sbjct: 161 LE-LKDSELHGE--TINVAKKR 179

>KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE L+  F+     +   +     TG  +G+ FV F +++    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALKDK 296

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 297 TCRRIAGRPLRMEFGEDR 314

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++LK++FQ  G I                +AFV++        AL+
Sbjct: 235 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALK 294

Query: 135 TLNGKQIENNVVKINW 150
               ++I    +++ +
Sbjct: 295 DKTCRRIAGRPLRMEF 310

>Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +V D+ LR  F+     +   +     +G  +G+ F+ F +++ +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 301 GCRKIAGRPLRMEYGEDR 318

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQ-VGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL   +T+D+L+++FQ  G  I               +AF+++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 135 TLNGKQIENNVVKINWA 151
               ++I    +++ + 
Sbjct: 299 DKGCRKIAGRPLRMEYG 315

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 345 AYIGNIPHFA---------TEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
            Y+GNI             TE++L  +FQ +G +      PEK CCFI Y     A + +
Sbjct: 524 VYVGNIDFVGDSLRDERVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILAL 583

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P+  ++L+  +GK+R   +P
Sbjct: 584 DKIKSNPY-FKDLKINFGKDRCGNVP 608

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 323 PPQVNPQAVDHI-IRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCC 381
           P  VN QA + +   SAP R  T Y+GN+P   +  +L+   ++ G + D K  PEK C 
Sbjct: 182 PLPVNAQANNPLNFTSAPSR--TVYLGNVPPNLSVKELLDHVRS-GVVEDVKIIPEKMCA 238

Query: 382 FIKYDTHEQAAVCI---VALANFPFQGRNLRTGWGK 414
           F+ +   E AA+       L       R+++ GWGK
Sbjct: 239 FVSF-IDESAALLFHSDAILKRLNIGDRDIKIGWGK 273

>ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LF+  LN     + +   F+ F +  S  ++ D  TG S GYGF+ FT +   + A   M
Sbjct: 244 LFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKSCEQAYKKM 303

Query: 225 QGQDLNGRPLRINWA 239
           +G  ++ R + ++++
Sbjct: 304 EGVIIDDRRIHVDFS 318

>NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON}
           Anc_5.536 YDR429C
          Length = 270

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 160 DDTFNLFVGDLNVNVDDETLRNAFK-DFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 218
           DD   L +  LN N D+  LR      F       V+ + +TG S+G  FV+F+S+  A+
Sbjct: 184 DDLCTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAE 243

Query: 219 TAMDSMQGQDLNGRPLRINWA 239
            A+  + G+      LR+ W+
Sbjct: 244 KALHFLDGRGFMNLILRVEWS 264

>NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {ON}
           Anc_2.80
          Length = 404

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE L+  F+     +   +     +G  +G+ F+ F S++ A  A+   
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 225 QGQDLNGRPLRINWAAKR 242
             + +  RP+R+ +   R
Sbjct: 300 TCRKIAARPIRMEYGEDR 317

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++LK++FQ  G I                +AF+++     A  AL+
Sbjct: 238 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALK 297

Query: 135 TLNGKQIENNVVKINWA 151
               ++I    +++ + 
Sbjct: 298 DKTCRKIAARPIRMEYG 314

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 7/81 (8%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI- 395
           SAP R  T Y+GNIP F     L+   ++ G I + K  P++ C FI +   E +A+   
Sbjct: 157 SAPSR--TVYLGNIPPFLPAKQLLDHVRS-GVIEELKILPDRMCAFISF-VDESSALLFH 212

Query: 396 --VALANFPFQGRNLRTGWGK 414
               L     +GR+++ GWGK
Sbjct: 213 SDAILKRLNIEGRDIKVGWGK 233

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 10/85 (11%)

Query: 346 YIGNIPHFA---------TEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIV 396
           Y+GNI   A         TE +L   FQ FG +       EK CCFI +     A + I 
Sbjct: 495 YVGNIDFNAIDETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAID 554

Query: 397 ALANFPFQGRNLRTGWGKERSNFMP 421
            +   P+  +NL+  +GK+R   +P
Sbjct: 555 KIKCNPY-FKNLKVNFGKDRCGNVP 578

>KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFV  LN     + L   F  F       ++ D +TGSS GYGF+ FT ++  + A   M
Sbjct: 249 LFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKESCEMAYSKM 308

Query: 225 QGQDLNGRPLRINWA 239
            G  ++ R + +++ 
Sbjct: 309 DGVLIDDRRIHVDFC 323

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 7/81 (8%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI- 395
           SAP R  T Y+GN+P + T  +L+   ++ G + D K  PEK C FI +   E +A+   
Sbjct: 152 SAPSR--TVYLGNVPPYITTRELLDHVRS-GVVEDVKILPEKMCAFISF-VDENSALLFH 207

Query: 396 --VALANFPFQGRNLRTGWGK 414
               L       R+++ GWGK
Sbjct: 208 SDAILKRLNIDDRDIKIGWGK 228

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 12/86 (13%)

Query: 346 YIGNI----------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
           Y+GNI          P F TE  L  +FQ FG +       E+ CCFI +     A + I
Sbjct: 489 YLGNIDFEDDRKLEQPIF-TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAI 547

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P   ++L+  +GK+R   +P
Sbjct: 548 DKIKSIP-TFKDLKINFGKDRCGNVP 572

>ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL175C
           (NOP13)
          Length = 375

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           LFVG+L+ +  DE L+  F+     +   +     +G  +G+ FV F  +  A  A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 225 QGQDLNGRPLRINWAAKR 242
             + + GRPLR+ +   R
Sbjct: 278 SCRAIAGRPLRMEYGEDR 295

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 76  RVLYVGNLDKAITEDILKQYFQVGGPIAXXXXXX-XXXXXXXXYAFVEYHQSHDANIALQ 134
           R+L+VGNL    T+++LK++FQ  G I                +AFV++     A  AL 
Sbjct: 216 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALT 275

Query: 135 TLNGKQIENNVVKINW 150
             + + I    +++ +
Sbjct: 276 DRSCRAIAGRPLRMEY 291

>Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354)
           [417 nt, 139 aa]
          Length = 138

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 55/108 (50%), Gaps = 7/108 (6%)

Query: 132 ALQTLNGKQIENNVVK--INWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSY 189
           A+Q +N  ++EN V+   ++W          D   +++G LN ++ +  +   F  F   
Sbjct: 6   AIQKINENELENGVLSPSLSW-----HDTYKDQAYIYIGRLNKDLTEGDILTVFSQFGVP 60

Query: 190 LSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
           +   ++ + +TGSSRG+ ++ +  Q     A+D++ G ++ G  + ++
Sbjct: 61  VDIKLVRENETGSSRGFAYLKYEDQRSTILAVDNLNGAEIAGNAIVVD 108

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 12/86 (13%)

Query: 346 YIGNI----------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
           Y+GNI          P F TE+ L  +FQ +G +    + PE+ CCF+ Y     A + I
Sbjct: 545 YVGNINFDEDSKREDPIF-TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAI 603

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             +   P   ++L+  +GK+R   +P
Sbjct: 604 DKIKGHPV-FKDLKINFGKDRCGNVP 628

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 344 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI---VALAN 400
           T Y+GN P   T  +L+   ++ G + D +  P+K C F+ +   E AA+       L  
Sbjct: 211 TVYLGNTPITLTVKELLDHVRS-GVVEDVRILPDKMCAFVSF-VDESAALLFHSDAILKR 268

Query: 401 FPFQGRNLRTGWGK 414
               GR+++ GWGK
Sbjct: 269 LHIDGRDIKIGWGK 282

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 3/74 (4%)

Query: 344 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAA--VCIVALANF 401
           T Y+GN+P      ++  + +  G + + K   ++  CF+ +     AA    + +L   
Sbjct: 452 TVYLGNLPKDVKVEEICNVVRG-GLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLHGI 510

Query: 402 PFQGRNLRTGWGKE 415
             Q R  R GWGK 
Sbjct: 511 TIQKRRCRVGWGKH 524

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%)

Query: 355 TEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 414
           TE  L    Q FG I   K   EKG  F+ + +   A   +  LAN     RN +  +GK
Sbjct: 329 TEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANINPYYRNKKIFYGK 388

Query: 415 ERSNFM 420
           +R  F+
Sbjct: 389 DRCAFI 394

>Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON}
           (34514..35347) [834 nt, 278 aa]
          Length = 277

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 8/80 (10%)

Query: 339 PPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHY------PEKGCCFIKYDTHEQAA 392
           P RV   Y+G+IP+  TE  L+ L +N G +++ K          KG  F++Y   E +A
Sbjct: 12  PSRV--VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSA 69

Query: 393 VCIVALANFPFQGRNLRTGW 412
             +  L  +P   R L+ G+
Sbjct: 70  SAVRNLNGYPIGSRFLKCGY 89

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 44/79 (55%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           +++G +  +  +E L +  ++    ++  +M+D QTG S+GY FV +   + + +A+ ++
Sbjct: 16  VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSASAVRNL 75

Query: 225 QGQDLNGRPLRINWAAKRD 243
            G  +  R L+  +++  D
Sbjct: 76  NGYPIGSRFLKCGYSSNSD 94

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 10/86 (11%)

Query: 345 AYIGNIPHFA---------TEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
            Y+GNI   +         TE++L  +FQ +G +      PEK CCF+ Y     A + +
Sbjct: 537 VYVGNIDFVSDSLRDERIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILAL 596

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P+  ++L+  +GK+R   +P
Sbjct: 597 DKIKSNPY-FKDLKINFGKDRCGNVP 621

>CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar to
           uniprot|Q99181 Saccharomyces cerevisiae YOR319w
           essential yeast splicing factor
          Length = 211

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 74/181 (40%), Gaps = 18/181 (9%)

Query: 78  LYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           +YVGN+D  +T+++L + F QVG                  +AF+E+  + DA+  L  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 137 NGK-QIENNVVKINWAFXXXXXXXDD-------------TFNLFVGDLNVNVDDETLRNA 182
           N   ++   V+KI  +        DD                +FV D+   V+   L   
Sbjct: 68  NNNVKLYQKVLKIRRS--NQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 183 FKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAAKR 242
           F  F        ++ +  G  R   F+ F   D+A  A+ ++ GQ +  +   + +A K 
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAFKE 184

Query: 243 D 243
           +
Sbjct: 185 N 185

>TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {ON}
           Anc_2.167 YNL110C
          Length = 215

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           ++V  L     +  L   F  F   +   +  + ++G+SR YGFV F +++DA+ A ++M
Sbjct: 88  IYVSRLPQGFHERELNKYFSQFGDLIESRLARNKKSGNSRHYGFVEFVNKEDAKIAQETM 147

Query: 225 QGQDLNGRPLRINWAAK 241
               L G  L++   AK
Sbjct: 148 NNYLLMGHLLQVRLLAK 164

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 1/62 (1%)

Query: 77  VLYVGNLDKAITEDILKQYF-QVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQT 135
           ++YV  L +   E  L +YF Q G  I               Y FVE+    DA IA +T
Sbjct: 87  IIYVSRLPQGFHERELNKYFSQFGDLIESRLARNKKSGNSRHYGFVEFVNKEDAKIAQET 146

Query: 136 LN 137
           +N
Sbjct: 147 MN 148

>KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.167
           YNL110C
          Length = 220

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 160 DDTFN--LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDA 217
           DD ++  ++V  L     ++ L   F  F       +  + ++G+SR YGFV F +++DA
Sbjct: 86  DDEYSSIIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYGFVEFANKEDA 145

Query: 218 QTAMDSMQGQDLNGRPLRINWAAK 241
           + A ++M    L G  LR+    K
Sbjct: 146 KVAQETMDNYLLMGHLLRVRLMGK 169

>KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} similar
           to uniprot|P40565 YIR005W Saccharomyces cerevisiae IST3
           Component of the U2 snRNP required for the first
           catalytic step of splicing and for spliceosomal assembly
          Length = 134

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 57/108 (52%), Gaps = 7/108 (6%)

Query: 132 ALQTLNGKQIENNVV--KINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSY 189
           ++Q L+ +++EN V+  K +W          D   +++G LN  + +  +   F  +   
Sbjct: 6   SIQNLSLRELENGVLSPKASW-----HHEYRDQAYVYIGGLNKELTEGDVLTVFSQYGVP 60

Query: 190 LSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
           +  +++ D +TG S+G+ ++ F  Q  +  A+D++ G  + GR ++++
Sbjct: 61  VDINLVRDRETGESKGFCYLKFEDQRSSILAVDNLNGAVVAGRAIKVD 108

 Score = 33.9 bits (76), Expect = 0.30,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 78  LYVGNLDKAITE-DILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           +Y+G L+K +TE D+L  + Q G P+               + ++++     + +A+  L
Sbjct: 36  VYIGGLNKELTEGDVLTVFSQYGVPVDINLVRDRETGESKGFCYLKFEDQRSSILAVDNL 95

Query: 137 NGKQIENNVVKIN 149
           NG  +    +K++
Sbjct: 96  NGAVVAGRAIKVD 108

 Score = 29.6 bits (65), Expect = 8.8,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 346 YIGNIPHFATEADLIPLFQNFG------FILDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399
           YIG +    TE D++ +F  +G       + D +    KG C++K++    + + +  L 
Sbjct: 37  YIGGLNKELTEGDVLTVFSQYGVPVDINLVRDRETGESKGFCYLKFEDQRSSILAVDNLN 96

Query: 400 NFPFQGRNLR 409
                GR ++
Sbjct: 97  GAVVAGRAIK 106

>Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF}
           YCL011C (GBP2) - Protein with RNA recognition motifs
           [contig 83] PARTIAL
          Length = 216

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 163 FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMD 222
           + +F+ +L  +   ++L++ FK   +     V  D + G S+G+G V F + D+A+TA+D
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLD-RNGRSKGFGTVIFETIDEARTALD 118

Query: 223 SMQGQDLNGRPLRIN 237
             Q  DL GR L + 
Sbjct: 119 KFQHFDLEGRILELK 133

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI- 395
           +AP R  T Y+GNIP   T +DL+   ++ G I + K  PEK C FI +   E +++   
Sbjct: 164 TAPSR--TVYLGNIPPTLTASDLLDHVRS-GVIEEVKILPEKMCAFISF-LDENSSLLFH 219

Query: 396 --VALANFPFQGRNLRTGWGK 414
               L      G++++ GWGK
Sbjct: 220 SDAILKRLNIDGKDIKIGWGK 240

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 10/81 (12%)

Query: 345 AYIGNI---------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
            YIGNI           + T+++L  +F  +G +        K CCF+ Y     A   I
Sbjct: 508 VYIGNIDFTADGTKRERYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAI 567

Query: 396 VALANFPFQGRNLRTGWGKER 416
             + N P   +NL+  +GK+R
Sbjct: 568 DKIKNNP-TFKNLKINFGKDR 587

>Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {ON}
           ANNOTATED BY YGOB - YCL011C (GBP2) - Protein with RNA
           recognition motifs [contig 83] PARTIAL
          Length = 226

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 163 FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMD 222
           + +F+ +L  +   ++L++ FK   +     V  D + G S+G+G V F + D+A+TA+D
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLD-RNGRSKGFGTVIFETIDEARTALD 118

Query: 223 SMQGQDLNGRPLRIN 237
             Q  DL GR L + 
Sbjct: 119 KFQHFDLEGRILELK 133

>Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W
           (REAL)
          Length = 149

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 55/105 (52%), Gaps = 3/105 (2%)

Query: 133 LQTLNGKQIENNVVKINWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSG 192
           +Q +N +++++ ++  + ++        D   +++G+LN  + +  +   F ++   +  
Sbjct: 4   IQEINDRELQSGILSPHLSWHSEYR---DNAYVYIGNLNKELTEGDILTVFSEYGVPVDV 60

Query: 193 HVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
            +  D  TG S+G+ ++ +  Q     A+D++ G  + GRPL+I+
Sbjct: 61  ILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGVKVGGRPLKID 105

 Score = 38.9 bits (89), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 78  LYVGNLDKAITE-DILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           +Y+GNL+K +TE DIL  + + G P+               +A+++Y       +A+  L
Sbjct: 33  VYIGNLNKELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 137 NGKQIENNVVKINWAF 152
           NG ++    +KI+  F
Sbjct: 93  NGVKVGGRPLKIDHTF 108

>NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7.159
          Length = 171

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 78  LYVGNLDKAITE-DILKQYFQVGGPIAXXXXXXXXXXXXXXYAFVEYHQSHDANIALQTL 136
           +Y+G LDK +TE DI+  + Q G P+               +AF++Y       +A+  L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 137 NGKQIENNVVKINWAF 152
           NG ++ +N ++++  F
Sbjct: 96  NGVKVGSNTIQVDHTF 111

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/108 (16%), Positives = 54/108 (50%), Gaps = 7/108 (6%)

Query: 132 ALQTLNGKQIENNVVKI--NWAFXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSY 189
           ++Q +N +++++ ++    +W +        D   +++G L+  + +  + + F  +   
Sbjct: 6   SIQQINERELQSGILTTEQSWHYQYK-----DQAYIYIGGLDKELTEGDIISVFSQYGVP 60

Query: 190 LSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRIN 237
           +   ++ D QTG S+G+ F+ +  Q     A+D++ G  +    ++++
Sbjct: 61  VDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLNGVKVGSNTIQVD 108

>Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061C
           (SNP1) - U1snRNP 70K protein homolog [contig 11] FULL
          Length = 278

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 15/127 (11%)

Query: 123 YHQSHDANIALQTL-------NGKQIENNVVKINWAF-----XXXXXXXDDTFNLFVGDL 170
           YHQ        Q L       N +QIE + +K   +             D    +FVG L
Sbjct: 49  YHQEFPTGSCNQHLEAYDKADNARQIEADALKEKLSHWHPNEDANIVGSDPYRTVFVGRL 108

Query: 171 NVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM---QGQ 227
              V +  L+  F  F       V+ D  +  SRGYGF+ F  +  A+TA   +   +G 
Sbjct: 109 PYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACREIGVHRGV 168

Query: 228 DLNGRPL 234
           ++ GRP+
Sbjct: 169 EIGGRPV 175

>Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {ON}
           YPL178W (CBC2) - Small subunit of the nuclear cap
           binding complex [contig 31] FULL
          Length = 201

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 327 NPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFI------LDFKHYPEKGC 380
           NP  ++ + RS   R  T Y+GN+  + +E  +  LF   G I      LD   +   G 
Sbjct: 32  NPDGLEDLRRSM--RSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGF 89

Query: 381 CFIKYDTHEQAAVCIVALANFPFQGRNL 408
           CF+ Y+T E+A   +  L++     RN+
Sbjct: 90  CFVIYNTPEEALNAVKYLSDTKLDDRNI 117

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 7/81 (8%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI- 395
           SAP R  T Y+GNIP   T  +L+   ++ G + D K  PEK C FI +   E +A+   
Sbjct: 210 SAPSR--TVYLGNIPSNLTVKELLDHVRS-GVVEDVKIIPEKLCAFISF-VDESSALLFH 265

Query: 396 --VALANFPFQGRNLRTGWGK 414
               L      G++++ GWGK
Sbjct: 266 SDAILKRLNIGGKDIKIGWGK 286

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 345 AYIGNI---------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
            YIGNI         P   TE  L  LF+ +G +      PEK CCFI +     A + +
Sbjct: 541 VYIGNINFEKDAMRDPRIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILAL 600

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P    +L+  +GK+R   +P
Sbjct: 601 DKIKSNP-HFEDLKINFGKDRCGNVP 625

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%)

Query: 355 TEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 414
           TEA L    ++FG I   K  PEKG  F+ + +   A  C+  L +      N +  +GK
Sbjct: 326 TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMNPYYENKKIAYGK 385

Query: 415 ERSNFM 420
           +R  F+
Sbjct: 386 DRCAFI 391

>Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C
           (REAL)
          Length = 782

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDS 223
           N+FVG +  ++    L   F  + + LS  +++D   G   GYGF+S+     A   +  
Sbjct: 195 NIFVGGIAKSLSIGELSFLFSKYGTILSMKLIYDRTKGEPNGYGFISYPLGSQASLCIKE 254

Query: 224 MQGQDLNGRPLRINWAAKR 242
           + G+ +NG  L IN+  +R
Sbjct: 255 LNGRVVNGSTLFINYHVER 273

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 20/99 (20%)

Query: 164 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVM-------------------WDMQTGSSR 204
           NL+V  + ++  DE L + +K F   +S  V+                    D+  GSSR
Sbjct: 542 NLYVKHIPLSWTDEDLYDFYKTFGEIISVKVITVGGSKNKYRQQSNDSSSDSDLPVGSSR 601

Query: 205 GYGFVSFTSQDDAQTAMDSMQGQDLNGRP-LRINWAAKR 242
           GYGFVSF S  DA  A+ +  G  ++    L +++A KR
Sbjct: 602 GYGFVSFESPLDAAKAILNTDGYQVSKEQVLSVSFAQKR 640

>CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} similar
           to uniprot|P53927 Saccharomyces cerevisiae YNL110c
          Length = 255

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%)

Query: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224
           ++VG L     +  L   F  F       +  + +TG+SR YGFV F + DD++ A D+M
Sbjct: 127 IYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTM 186

Query: 225 QGQDLNGRPLRINWAAK 241
               L G  L++    K
Sbjct: 187 NNYLLMGHLLQVRLLPK 203

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 7/81 (8%)

Query: 337 SAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI- 395
           +AP R  T Y+GNIP   T  +L+   ++ G I D K  PEK C FI +   E +A+   
Sbjct: 218 TAPSR--TVYLGNIPSDLTVKELLDHVRS-GVIEDVKIIPEKLCAFISF-LDENSALLFH 273

Query: 396 --VALANFPFQGRNLRTGWGK 414
               L      G++++ GWGK
Sbjct: 274 SDAILKRLNINGKDIKIGWGK 294

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 12/86 (13%)

Query: 346 YIGNI----------PHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCI 395
           YIGNI          P F TE  L  +F  +G +      PEK CCFI +     A + +
Sbjct: 593 YIGNIDFATDKKRDNPIF-TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILAL 651

Query: 396 VALANFPFQGRNLRTGWGKERSNFMP 421
             + + P   ++L+  +GK+R   +P
Sbjct: 652 DKIKSNPV-FKDLKINFGKDRCGNIP 676

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,790,443
Number of extensions: 1393682
Number of successful extensions: 7559
Number of sequences better than 10.0: 571
Number of HSP's gapped: 7178
Number of HSP's successfully gapped: 1077
Length of query: 457
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 344
Effective length of database: 40,524,141
Effective search space: 13940304504
Effective search space used: 13940304504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)