Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_14.3272.284ON63263230470.0
Skud_14.3092.284ON63960421000.0
Smik_14.3112.284ON63759920080.0
YNL020C (ARK1)2.284ON63860320020.0
KAFR0H033302.284ON36931912821e-173
NCAS0G038102.284ON66143112801e-168
TDEL0G021502.284ON66130812791e-168
SAKL0E07722g2.284ON79130812881e-168
NDAI0G006402.284ON62130812641e-166
Suva_9.1042.284ON80530912721e-165
Smik_9.842.284ON80830912711e-165
YIL095W (PRK1)2.284ON81033212631e-164
Kwal_27.115422.284ON79130812571e-163
KNAG0H020202.284ON59234512331e-162
NCAS0B062602.284ON72330612441e-162
KAFR0J013702.284ON78034912461e-162
Skud_9.782.284ON80930912441e-161
Kpol_1003.352.284ON71330812131e-158
KLTH0G10318g2.284ON79030812141e-157
CAGL0G02607g2.284ON68830812051e-157
KLLA0E08405g2.284ON77730812031e-155
NDAI0B035602.284ON75634511941e-154
ZYRO0A01848g2.284ON70430811891e-154
TPHA0C033802.284ON69740211871e-154
CAGL0J03432g2.284ON62231011411e-148
Ecym_33232.284ON74830811471e-147
TBLA0B059302.284ON71730611371e-146
ADL217W2.284ON75030611251e-144
Kpol_1039.332.284ON70132911141e-143
TBLA0B069402.284ON144331011221e-137
KNAG0A054302.284ON78830910501e-132
TPHA0D015402.284ON7073139871e-124
KAFR0A010403.273ON9123217921e-93
NDAI0A057003.273ON11573577891e-91
Kpol_251.43.273ON8383127742e-91
SAKL0D03234g3.273ON8583057752e-91
CAGL0H10208g3.273ON10273187832e-91
KNAG0H012203.273ON9133247773e-91
KNAG0J008203.273ON10913247835e-91
NCAS0A105903.273ON10953187792e-90
TBLA0E025903.273ON10613167772e-90
Kpol_1052.223.273ON11013077722e-89
KLTH0C07260g3.273ON9013147614e-89
Suva_4.2973.273ON11073177618e-88
Kwal_27.109453.273ON9353147531e-87
ZYRO0E06864g3.273ON11153177592e-87
Ecym_26503.273ON8943067483e-87
KAFR0C004303.273ON9493217486e-87
CAGL0K11990g3.273ON9913217499e-87
TPHA0A040303.273ON10543357492e-86
TPHA0M011203.273ON7883847335e-86
KLLA0F18612g3.273ON8143077355e-86
Skud_2.1793.273ON10903177441e-85
Smik_2.1913.273ON11083207433e-85
TDEL0D035203.273ON10493147394e-85
AGR027C3.273ON9613137355e-85
YBR059C (AKL1)3.273ON11083177372e-84
TBLA0I019303.273ON13613147212e-81
SAKL0A03344g6.262ON3643542413e-21
KNAG0F002901.52ON11253052494e-21
Kwal_56.242746.262ON3463372342e-20
KAFR0A050906.31ON6682402403e-20
Kpol_1072.198.668ON8962972324e-19
Smik_1.793.177ON9742802324e-19
YAR019C (CDC15)3.177ON9742802324e-19
KLTH0H03080g6.262ON3463332236e-19
CAGL0K08514g2.479ON14892342316e-19
Skud_1.723.177ON9742882291e-18
SAKL0H06754g8.668ON8842072281e-18
NCAS0C041008.141ON9053652281e-18
Skud_4.7831.52ON11353212262e-18
TBLA0A071501.52ON13913302244e-18
TDEL0A067506.262ON3723032175e-18
KNAG0F001701.24ON5432772181e-17
Suva_16.706.262ON3643472131e-17
SAKL0C01716g1.52ON12153432191e-17
Ecym_73922.479ON14343822191e-17
Ecym_21536.262ON3633542122e-17
Suva_16.1608.668ON9182972182e-17
ZYRO0E07876g6.262ON3693362122e-17
KLLA0C01650g1.52ON11123342182e-17
TDEL0C067801.24ON4682842142e-17
YPL236C (ENV7)6.262ON3643312103e-17
TPHA0F024306.31ON7982762153e-17
KNAG0D048107.86ON14401772163e-17
Ecym_10581.52ON11643552164e-17
KAFR0C014403.92ON10952732154e-17
Suva_1.863.177ON9742882145e-17
ZYRO0D05500g7.86ON12621762146e-17
Kpol_2002.241.24ON4872752116e-17
AFR696C1.52ON11423542146e-17
NCAS0A002801.24ON5353302117e-17
NCAS0B086001.52ON11174142137e-17
NCAS0B044906.222ON3492072068e-17
Skud_16.426.262ON3643332078e-17
KAFR0D041001.52ON11173312139e-17
NCAS0C016708.668ON8962092129e-17
KLTH0F01672g1.52ON11643332111e-16
TPHA0G016308.668ON8712032111e-16
TDEL0A025502.479ON13692012111e-16
ABL034W2.479ON14253042111e-16
Kpol_1065.36.222ON3762902052e-16
YKL101W (HSL1)2.479ON15183182102e-16
KNAG0A065402.479ON14321992102e-16
TPHA0E036401.52ON11372302102e-16
YPL150W8.668ON9013022092e-16
Kwal_33.131121.24ON5052882072e-16
Kpol_431.92.479ON15522002102e-16
Smik_6.4416.262ON3643342032e-16
Suva_2.6871.52ON11283202092e-16
Suva_11.1232.479ON15262012083e-16
TPHA0H026307.86ON13671802083e-16
TDEL0H036407.86ON12371802074e-16
AFR724C1.24ON4403072034e-16
Skud_16.1328.668ON9243022064e-16
KLTH0F16676g5.406ON8782132065e-16
NDAI0A006601.52ON10223422065e-16
Smik_11.1392.479ON15342202075e-16
KAFR0G012001.24ON5072672036e-16
AFL101C6.222ON3672902006e-16
KLLA0E21693g5.406ON10162812056e-16
Skud_11.1262.479ON15181992066e-16
CAGL0F00913g7.86ON12061972057e-16
Smik_4.7891.52ON11363202058e-16
Ecym_26407.86ON13251812058e-16
CAGL0L11550g5.406ON10722062048e-16
ACR133C8.668ON8512042049e-16
Skud_3.391.52ON10172592049e-16
YDR507C (GIN4)1.52ON11423202049e-16
ZYRO0G03366g2.479ON16161922041e-15
Ecym_10301.24ON4403072001e-15
ZYRO0F18062g1.24ON4712882011e-15
Smik_6.3478.668ON9173012031e-15
KAFR0D049505.406ON10082132031e-15
NDAI0F045201.24ON4892932001e-15
TPHA0G032002.479ON15342472031e-15
TPHA0E038501.24ON4822772001e-15
ZYRO0B01166g2.496ON9632772022e-15
Suva_2.7031.24ON4852031992e-15
Kwal_55.215455.406ON8652132002e-15
TBLA0A047207.86ON12621782012e-15
KAFR0D032002.479ON14481972012e-15
NDAI0F016006.222ON4122081972e-15
TBLA0I011502.479ON17451982012e-15
CAGL0M02299g8.668ON8932082003e-15
ACR281C7.86ON12591812003e-15
Smik_4.8031.24ON4902031973e-15
KNAG0F029006.31ON6493081983e-15
ZYRO0F07194g8.668ON9382881994e-15
TBLA0B082503.92ON13471981994e-15
KLLA0F13552g2.479ON12672571994e-15
CAGL0H06259g7.86ON13361901994e-15
CAGL0K05709g1.52ON11032021994e-15
Kpol_2002.461.52ON11232741985e-15
NCAS0F015807.86ON13821851985e-15
Suva_15.2975.406ON10742271985e-15
KLTH0C09548g3.92ON9932301976e-15
Kwal_26.87518.668ON8482111976e-15
NDAI0H024707.86ON14111801986e-15
SAKL0E02860g2.479ON13772981986e-15
Kpol_1044.37.86ON9321761976e-15
YDR523C (SPS1)1.24ON4902031947e-15
KAFR0D033902.496ON7982301967e-15
NDAI0E023908.668ON8831971968e-15
KAFR0C009303.177ON9363471969e-15
Suva_15.653.92ON10803501969e-15
YOL100W (PKH2)3.92ON10812311969e-15
KAFR0D012207.86ON10552201951e-14
Kpol_1040.207.86ON12971761951e-14
TDEL0A061408.668ON8612871951e-14
KNAG0A030408.654ON6443481941e-14
YCL024W (KCC4)1.52ON10371981941e-14
AFR335C3.92ON10331971941e-14
ZYRO0E07018g6.222ON3672051892e-14
TBLA0A035705.406ON9752241942e-14
KLTH0H03982g6.222ON3982031902e-14
Skud_4.7971.24ON4852781912e-14
KLTH0D11044g8.668ON8492141932e-14
KLLA0B02332g6.222ON3612781872e-14
CAGL0I07513g3.92ON10762751922e-14
Kpol_1054.23.92ON10962531923e-14
KLTH0F00946g1.24ON5123561903e-14
Kpol_1012.68.654ON6283151913e-14
Kpol_1072.298.654ON8932991913e-14
TDEL0C064901.52ON11533061923e-14
KLLA0E03587g5.591ON6471981903e-14
Kwal_26.77882.479ON12673021923e-14
Kpol_1031.105.406ON11272131913e-14
TBLA0E022907.86ON13001821923e-14
KLLA0C12485g3.92ON9252251913e-14
CAGL0E05720g6.222ON3582901863e-14
NCAS0C049403.92ON11162181914e-14
SAKL0C00946g1.24ON5642821894e-14
Skud_8.1635.406ON10762061904e-14
KLTH0D05566g2.479ON11282961904e-14
NCAS0A057702.479ON14611971914e-14
TDEL0D053203.92ON10572311904e-14
NCAS0I004707.86ON10821911904e-14
Skud_15.543.92ON10822301904e-14
ZYRO0A06446g5.406ON9432441904e-14
Kwal_56.226933.92ON9842301905e-14
KLLA0C04191g3.177ON7972981886e-14
NDAI0C017005.406ON10202131886e-14
KAFR0K007007.86ON13811901897e-14
Smik_8.1805.406ON10732061887e-14
SAKL0G01848g5.406ON8852641887e-14
KLLA0F07623g7.86ON12291851888e-14
Suva_3.1901.52ON10242941888e-14
ACL104C5.406ON9472121888e-14
TPHA0G032902.496ON9732401879e-14
Kwal_26.78612.496ON9552761879e-14
Skud_4.977.335ON5232381851e-13
TDEL0C021107.335ON4952931851e-13
YCR073C (SSK22)6.341ON13312911871e-13
NDAI0D027502.479ON15151971861e-13
Ecym_35863.92ON10771961861e-13
YHR102W (KIC1)5.406ON10802061861e-13
YDR490C (PKH1)3.92ON7661981852e-13
Smik_15.573.92ON10812311852e-13
NDAI0G042903.92ON11132271852e-13
YPL209C (IPL1)6.222ON3672021812e-13
KNAG0B043205.406ON10272131852e-13
Smik_3.541.52ON10322001852e-13
SAKL0A04246g6.222ON4002151812e-13
Kpol_1023.266.31ON7392751842e-13
NCAS0A050502.496ON8932391842e-13
Ecym_21946.222ON3662921802e-13
Smik_4.7673.92ON7581981832e-13
KLLA0C00979g1.24ON4832981813e-13
Ecym_55055.406ON10032011833e-13
TDEL0A027202.496ON9152791823e-13
KLTH0D10714g8.654ON8723031823e-13
SAKL0B09856g7.86ON12741811834e-13
TPHA0H016305.406ON10362091824e-13
NDAI0E012908.654ON7292401824e-13
KNAG0J016708.668ON10092061824e-13
Smik_7.928.141ON8973501824e-13
KLLA0F14190g1.271ON13382241824e-13
NDAI0K021002.496ON9092291814e-13
Suva_7.828.141ON9003491814e-13
CAGL0J03872g8.654ON6612031805e-13
KLLA0F11319g8.668ON8431951815e-13
CAGL0K02673g2.496ON9152351815e-13
KAFR0H025108.668ON8793091815e-13
Skud_10.1191.271ON14812791825e-13
CAGL0J11638g6.31ON7463331815e-13
TPHA0D011408.654ON6223171805e-13
YOL045W (PSK2)7.86ON11011841815e-13
Skud_4.7643.92ON7562021805e-13
CAGL0G04609g3.92ON9652751806e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_14.327
         (632 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...  1178   0.0  
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   813   0.0  
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   778   0.0  
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   775   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   498   e-173
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   497   e-168
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   497   e-168
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   500   e-168
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    491   e-166
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   494   e-165
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   494   e-165
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   491   e-164
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   488   e-163
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   479   e-162
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   483   e-162
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   484   e-162
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   483   e-161
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   471   e-158
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   472   e-157
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   468   e-157
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   468   e-155
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   464   e-154
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   462   e-154
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   461   e-154
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   444   e-148
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   446   e-147
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   442   e-146
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   437   e-144
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   433   e-143
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   436   e-137
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   409   e-132
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   384   e-124
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   309   1e-93
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   308   1e-91
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   302   2e-91
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   303   2e-91
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   306   2e-91
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   303   3e-91
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   306   5e-91
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   304   2e-90
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   303   2e-90
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   301   2e-89
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   297   4e-89
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   297   8e-88
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   294   1e-87
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   296   2e-87
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   292   3e-87
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   292   6e-87
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   293   9e-87
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   293   2e-86
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   286   5e-86
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   287   5e-86
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   291   1e-85
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   290   3e-85
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   289   4e-85
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   287   5e-85
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   288   2e-84
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   282   2e-81
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    97   3e-21
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   100   4e-21
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    95   2e-20
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             97   3e-20
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    94   4e-19
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    94   4e-19
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    94   4e-19
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    91   6e-19
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    94   6e-19
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    93   1e-18
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    92   1e-18
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     92   1e-18
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    92   2e-18
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    91   4e-18
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    88   5e-18
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    89   1e-17
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    87   1e-17
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    89   1e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    89   1e-17
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    86   2e-17
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    89   2e-17
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    86   2e-17
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    89   2e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    87   2e-17
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    86   3e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    87   3e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    88   3e-17
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    88   4e-17
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    87   4e-17
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    87   5e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    87   6e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    86   6e-17
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    87   6e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        86   7e-17
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    87   7e-17
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     84   8e-17
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    84   8e-17
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    87   9e-17
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    86   9e-17
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    86   1e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    86   1e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    86   1e-16
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    86   1e-16
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    84   2e-16
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    86   2e-16
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    86   2e-16
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    86   2e-16
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    85   2e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    84   2e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    86   2e-16
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    83   2e-16
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    85   2e-16
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    85   3e-16
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    85   3e-16
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    84   4e-16
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    83   4e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    84   4e-16
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    84   5e-16
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     84   5e-16
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    84   5e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    83   6e-16
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    82   6e-16
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    84   6e-16
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    84   6e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    84   7e-16
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    84   8e-16
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    84   8e-16
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    83   8e-16
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    83   9e-16
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    83   9e-16
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    83   9e-16
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    83   1e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    82   1e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    82   1e-15
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    83   1e-15
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    83   1e-15
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    82   1e-15
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    83   1e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    82   1e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    82   2e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    81   2e-15
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    82   2e-15
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    82   2e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    82   2e-15
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    80   2e-15
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    82   2e-15
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    82   3e-15
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    82   3e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    80   3e-15
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               81   3e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    81   4e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    81   4e-15
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    81   4e-15
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    81   4e-15
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    81   4e-15
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    81   5e-15
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    81   5e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    81   5e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    80   6e-15
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    80   6e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    81   6e-15
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    81   6e-15
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    80   6e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    79   7e-15
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    80   7e-15
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    80   8e-15
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    80   9e-15
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    80   9e-15
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    80   9e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    80   1e-14
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    80   1e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    80   1e-14
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    79   1e-14
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    79   1e-14
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    79   1e-14
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    77   2e-14
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    79   2e-14
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    78   2e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    78   2e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    79   2e-14
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    77   2e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    79   2e-14
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    79   3e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    78   3e-14
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    78   3e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    78   3e-14
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    79   3e-14
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    78   3e-14
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    79   3e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    78   3e-14
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    79   3e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    78   3e-14
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    76   3e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    78   4e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    77   4e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    78   4e-14
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    78   4e-14
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    78   4e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    78   4e-14
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       78   4e-14
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    78   4e-14
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    78   4e-14
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    78   5e-14
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    77   6e-14
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    77   6e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    77   7e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    77   7e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    77   7e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    77   8e-14
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    77   8e-14
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    77   8e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    77   9e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    77   9e-14
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    76   1e-13
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    76   1e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    77   1e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    76   1e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    76   1e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    76   1e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    76   2e-13
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    76   2e-13
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    76   2e-13
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    74   2e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    76   2e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    76   2e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    74   2e-13
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    75   2e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    75   2e-13
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    74   2e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    75   2e-13
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    74   3e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    75   3e-13
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    75   3e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    75   3e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    75   4e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    75   4e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    75   4e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    75   4e-13
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    75   4e-13
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    75   4e-13
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    74   4e-13
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    74   4e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    74   5e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    74   5e-13
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    74   5e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    74   5e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    75   5e-13
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    74   5e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    74   5e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    74   5e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    74   5e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    74   6e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    74   6e-13
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    74   7e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    74   7e-13
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    74   7e-13
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     74   7e-13
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    74   8e-13
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    73   8e-13
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    74   8e-13
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    74   8e-13
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               73   8e-13
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    74   8e-13
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    74   9e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    74   9e-13
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    73   1e-12
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    73   1e-12
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    74   1e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    74   1e-12
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    73   1e-12
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    73   1e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    72   1e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    73   1e-12
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    73   1e-12
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    72   1e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    73   1e-12
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    73   1e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    73   1e-12
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    72   1e-12
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    73   2e-12
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    73   2e-12
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    72   2e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    71   2e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    72   2e-12
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    73   2e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    72   2e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    72   2e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    73   2e-12
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    72   2e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    72   2e-12
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    72   2e-12
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    72   2e-12
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    72   2e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    72   2e-12
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    72   2e-12
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    71   3e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    72   3e-12
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    72   3e-12
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    72   3e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    72   3e-12
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    72   3e-12
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    72   3e-12
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    72   3e-12
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    72   3e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    72   3e-12
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    70   4e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    72   4e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    72   4e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    72   4e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    70   4e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    71   4e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    71   5e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    70   5e-12
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    71   5e-12
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    71   5e-12
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    71   5e-12
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    71   5e-12
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    71   5e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    71   5e-12
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    70   6e-12
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    71   6e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    71   6e-12
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    71   6e-12
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    71   6e-12
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    71   6e-12
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               71   6e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     71   6e-12
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    70   6e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    71   7e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    71   7e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    71   7e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    70   7e-12
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    71   7e-12
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    70   7e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    70   8e-12
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    70   8e-12
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    70   8e-12
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    69   9e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     70   9e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    70   9e-12
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    70   9e-12
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      70   9e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    70   9e-12
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    70   1e-11
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    69   1e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    70   1e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    70   1e-11
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    70   1e-11
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    70   1e-11
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    69   1e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     69   1e-11
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    70   1e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    70   1e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     69   1e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    70   1e-11
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    70   1e-11
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    70   1e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    69   1e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    68   2e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    69   2e-11
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    70   2e-11
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    69   2e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    69   2e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    69   2e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    69   2e-11
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    69   2e-11
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    69   2e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    69   2e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    69   2e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    69   2e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    69   2e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    69   2e-11
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    69   2e-11
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    69   2e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    69   2e-11
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    69   2e-11
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    69   2e-11
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    69   2e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    69   2e-11
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    69   2e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    69   2e-11
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    69   3e-11
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    69   3e-11
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    69   3e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    69   3e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              69   3e-11
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    68   3e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    68   3e-11
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    68   3e-11
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    68   3e-11
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    69   4e-11
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    69   4e-11
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    69   4e-11
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              68   4e-11
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    68   4e-11
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    68   4e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    68   4e-11
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    68   5e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    68   5e-11
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    67   5e-11
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    68   5e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    68   5e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     68   5e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    68   5e-11
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               67   5e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    68   6e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    68   6e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    67   6e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    67   6e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    67   6e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    67   6e-11
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    67   7e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    67   7e-11
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    67   7e-11
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    67   7e-11
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    67   7e-11
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    67   8e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    67   8e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    67   8e-11
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    67   8e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    67   8e-11
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    67   8e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    67   9e-11
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    67   9e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    67   9e-11
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    67   9e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    66   9e-11
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    67   9e-11
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    67   9e-11
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    67   1e-10
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    67   1e-10
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    66   1e-10
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    67   1e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    67   1e-10
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    67   1e-10
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    67   1e-10
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    67   1e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    67   1e-10
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    66   1e-10
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    67   1e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    67   1e-10
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    66   1e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    66   1e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    66   1e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    67   1e-10
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    67   1e-10
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    66   1e-10
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    67   1e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    66   1e-10
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    65   1e-10
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    66   2e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    66   2e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    65   2e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    66   2e-10
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    66   2e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    66   2e-10
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    66   2e-10
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    66   2e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    66   2e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    66   2e-10
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    66   2e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    65   2e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    66   2e-10
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    66   2e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    65   2e-10
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    66   2e-10
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    65   2e-10
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    66   2e-10
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    66   2e-10
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    65   2e-10
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      66   2e-10
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    66   2e-10
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    66   2e-10
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    65   2e-10
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    65   2e-10
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    66   2e-10
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    65   2e-10
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    65   2e-10
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    65   2e-10
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    64   3e-10
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    65   3e-10
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    65   3e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    65   3e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    65   3e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    65   3e-10
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    65   3e-10
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    65   3e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    65   3e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    65   3e-10
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    65   3e-10
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    65   3e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     65   3e-10
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    65   3e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               65   3e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    65   3e-10
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    65   3e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    65   3e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    65   3e-10
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    65   4e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   4e-10
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    64   4e-10
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    65   4e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    65   4e-10
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    65   4e-10
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    64   4e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    64   4e-10
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    65   4e-10
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    64   4e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   5e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    64   5e-10
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    64   5e-10
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    64   5e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    65   5e-10
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    64   5e-10
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    64   5e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    65   6e-10
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              64   6e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    64   6e-10
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    64   6e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    64   6e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    64   6e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    63   6e-10
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    64   7e-10
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    64   7e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    64   7e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    64   7e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   7e-10
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    64   7e-10
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    64   7e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    64   7e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    64   7e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    64   8e-10
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    64   8e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    64   8e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    64   8e-10
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    64   8e-10
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    64   8e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    63   9e-10
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    64   9e-10
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    64   9e-10
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    64   9e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    64   9e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    63   9e-10
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    64   1e-09
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    62   1e-09
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    63   1e-09
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    64   1e-09
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    63   1e-09
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    64   1e-09
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    64   1e-09
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    64   1e-09
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    64   1e-09
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    63   1e-09
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    64   1e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    63   1e-09
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    64   1e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    64   1e-09
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    64   1e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   1e-09
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    63   1e-09
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    63   1e-09
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    63   1e-09
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    62   1e-09
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    63   1e-09
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    63   1e-09
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    62   1e-09
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    63   1e-09
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    64   1e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    63   1e-09
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    62   1e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       62   1e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    61   2e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    63   2e-09
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    63   2e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    63   2e-09
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    63   2e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    63   2e-09
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    63   2e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    63   2e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    62   2e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   2e-09
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    63   2e-09
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    62   2e-09
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    62   2e-09
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    62   2e-09
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    62   2e-09
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    63   2e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    63   2e-09
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    62   2e-09
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    62   2e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    62   2e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    62   2e-09
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    62   2e-09
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    62   3e-09
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    62   3e-09
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    62   3e-09
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    62   3e-09
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    62   3e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    61   3e-09
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    62   3e-09
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    62   3e-09
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    62   3e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    62   3e-09
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               62   3e-09
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    62   3e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    62   3e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    62   3e-09
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    61   3e-09
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    61   3e-09
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    62   3e-09
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    62   3e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    62   3e-09
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    60   3e-09
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    62   3e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    62   3e-09
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    61   4e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    61   4e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    62   4e-09
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    62   4e-09
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    62   4e-09
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    62   4e-09
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    61   4e-09
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    62   4e-09
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    61   4e-09
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    62   4e-09
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    62   4e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    62   4e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    62   4e-09
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    62   4e-09
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    62   4e-09
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    60   4e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    60   4e-09
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    61   4e-09
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              62   4e-09
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              60   4e-09
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    62   4e-09
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    60   4e-09
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    61   5e-09
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    61   5e-09
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    61   5e-09
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    61   5e-09
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    61   5e-09
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    61   5e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    61   5e-09
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    61   5e-09
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    61   6e-09
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    60   6e-09
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    60   6e-09
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    60   6e-09
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    60   6e-09
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    60   6e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     60   6e-09
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    61   6e-09
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    61   7e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    61   7e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    60   7e-09
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    61   7e-09
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    59   8e-09
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    59   8e-09
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    60   8e-09
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    60   8e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    61   8e-09
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    60   8e-09
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    60   8e-09
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    60   8e-09
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    60   8e-09
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    60   8e-09
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    60   9e-09
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    61   9e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    60   9e-09
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    60   9e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    60   9e-09
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    60   9e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    60   1e-08
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     60   1e-08
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              60   1e-08
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    60   1e-08
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    60   1e-08
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    60   1e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    60   1e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    60   1e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    60   1e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    60   1e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    60   1e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    60   1e-08
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    60   1e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    60   1e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    60   1e-08
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    60   1e-08
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    60   1e-08
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    60   1e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    60   1e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    59   1e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    59   1e-08
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    60   2e-08
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    59   2e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    59   2e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    60   2e-08
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    59   2e-08
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    59   2e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    59   2e-08
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    59   2e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    60   2e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    59   2e-08
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    60   2e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    59   2e-08
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    59   2e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    60   2e-08
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    59   2e-08
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    60   2e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    59   2e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    59   2e-08
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    60   2e-08
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    59   2e-08
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    59   2e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    59   2e-08
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     59   2e-08
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    59   2e-08
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    58   2e-08
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    60   2e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    60   2e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    59   2e-08
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    59   2e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    58   2e-08
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    58   2e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    59   2e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    59   2e-08
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    58   2e-08
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    59   2e-08
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    59   2e-08
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    59   3e-08
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    59   3e-08
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    56   3e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    59   3e-08
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    57   3e-08
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    59   3e-08
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    59   3e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    59   3e-08
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    59   3e-08
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    58   3e-08
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    59   3e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               59   3e-08
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    59   3e-08
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    59   3e-08
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    59   3e-08
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    58   3e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    58   3e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    59   3e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     59   3e-08
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    57   3e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    59   3e-08
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    59   3e-08
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    58   3e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    59   3e-08
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             59   3e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    59   3e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    58   3e-08
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    59   4e-08
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    59   4e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    58   4e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    59   4e-08
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    58   4e-08
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    58   4e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    59   4e-08
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    58   4e-08
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    58   4e-08
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    58   4e-08
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    58   4e-08
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    58   4e-08
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    58   4e-08
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    58   4e-08
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    58   4e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    58   4e-08
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    58   4e-08
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    58   4e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    58   5e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    58   5e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    59   5e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    58   5e-08
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     58   5e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    58   5e-08
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    58   5e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    58   5e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    59   5e-08
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    57   5e-08
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    58   5e-08
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    57   5e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    57   5e-08
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    58   5e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    57   5e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    58   5e-08
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    58   5e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    58   5e-08
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    58   5e-08
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    58   6e-08
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    57   6e-08
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    57   6e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    57   6e-08
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    57   6e-08
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    57   6e-08
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    57   6e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    58   6e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    57   6e-08
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    58   6e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    57   7e-08
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    58   7e-08
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    58   7e-08
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    57   7e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    57   7e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    58   7e-08
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    57   7e-08
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    57   7e-08
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    57   7e-08
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    57   8e-08
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    58   8e-08
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    57   8e-08
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    57   8e-08
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    57   8e-08
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    57   8e-08
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    57   8e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    57   8e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    57   8e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     57   8e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    57   8e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    57   8e-08
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    57   8e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    57   8e-08
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    57   8e-08
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    57   9e-08
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    57   9e-08
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    57   9e-08
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    57   9e-08
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    57   9e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    57   9e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    57   9e-08
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    57   9e-08
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    57   9e-08
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    57   1e-07
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    57   1e-07
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    57   1e-07
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    57   1e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    57   1e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    56   1e-07
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    57   1e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    57   1e-07
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    56   1e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    57   1e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               57   1e-07
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    56   1e-07
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    56   1e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    57   1e-07
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    57   1e-07
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    57   1e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    57   1e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    56   1e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    57   1e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    57   1e-07
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    56   1e-07
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    57   1e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    57   1e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    57   1e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    57   1e-07
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    55   1e-07
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    56   1e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    57   1e-07
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              57   1e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    57   1e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    57   1e-07
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              57   2e-07
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    55   2e-07
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    57   2e-07
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    56   2e-07
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    57   2e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     56   2e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    56   2e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    55   2e-07
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    56   2e-07
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    57   2e-07
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    56   2e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    56   2e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    56   2e-07
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    56   2e-07
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    56   2e-07
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    57   2e-07
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    56   2e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    56   2e-07
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    56   2e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    55   2e-07
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    56   2e-07
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    55   2e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    55   2e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    55   2e-07
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    55   2e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    56   2e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    55   2e-07
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    56   2e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    56   2e-07
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    56   2e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    56   2e-07
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    56   2e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    56   2e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    56   2e-07
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    56   2e-07
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    56   2e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    56   2e-07
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    56   2e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    56   2e-07
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    55   2e-07
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    55   2e-07
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    56   2e-07
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    55   2e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    56   2e-07
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    55   2e-07
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    55   3e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    56   3e-07
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    56   3e-07
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    56   3e-07
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    56   3e-07
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    55   3e-07
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    55   3e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    55   3e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    55   3e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    56   3e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    55   3e-07
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    55   3e-07
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    56   3e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    55   3e-07
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    55   3e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    55   3e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    55   3e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    56   3e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    55   3e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    55   3e-07
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    55   3e-07
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    55   3e-07
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    55   3e-07
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    55   3e-07
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              55   3e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    55   3e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    55   3e-07
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    55   4e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    55   4e-07
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    55   4e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    55   4e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    55   4e-07
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    55   4e-07
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    54   4e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    55   4e-07
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    55   4e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    55   4e-07
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    55   4e-07
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    55   4e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    55   4e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    55   4e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    55   4e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    55   4e-07
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    55   4e-07
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    55   4e-07
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    55   4e-07
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    55   4e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    55   5e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    55   5e-07
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    55   5e-07
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    55   5e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    55   5e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    55   5e-07
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    55   5e-07
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    55   5e-07
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    54   5e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    54   5e-07
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    55   5e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    54   5e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    54   5e-07
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    54   5e-07
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    54   6e-07
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    55   6e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    55   6e-07
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    54   6e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    55   6e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    55   6e-07
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    54   6e-07
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    54   6e-07
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    54   6e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              54   6e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    54   6e-07
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    54   7e-07
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    54   7e-07
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    54   7e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    54   7e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    54   7e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    54   7e-07
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    54   7e-07
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    54   7e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    54   7e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    54   7e-07
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    54   7e-07
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    54   7e-07
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    54   7e-07
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    55   8e-07
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    54   8e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    54   8e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    54   8e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    53   8e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    54   8e-07
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    54   8e-07
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    54   9e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    54   9e-07
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    54   9e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    54   9e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    54   9e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    54   9e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    54   9e-07
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    54   9e-07
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    54   1e-06
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    53   1e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    54   1e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    54   1e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    54   1e-06
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    54   1e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    54   1e-06
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    54   1e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    54   1e-06
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    54   1e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    54   1e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    53   1e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       54   1e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    54   1e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    54   1e-06
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    54   1e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    54   1e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    53   1e-06
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    53   1e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    54   1e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    53   1e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    54   1e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    54   1e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    53   1e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    53   1e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   1e-06
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    53   1e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    54   1e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    53   1e-06
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    53   1e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    53   1e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    53   1e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    53   1e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    54   1e-06
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    54   1e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    53   1e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    54   1e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    54   1e-06
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    53   1e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    53   1e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    53   1e-06
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    53   1e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    53   1e-06
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    53   1e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    53   1e-06
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    54   1e-06
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    54   1e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    53   1e-06
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    53   2e-06
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     53   2e-06
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    53   2e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    50   2e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    53   2e-06
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    53   2e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    53   2e-06
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    53   2e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    53   2e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    54   2e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    53   2e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    53   2e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    53   2e-06
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    53   2e-06
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    53   2e-06
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    53   2e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    53   2e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    53   2e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    53   2e-06
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    53   2e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    53   2e-06
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    53   2e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     53   2e-06
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    53   2e-06
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    53   2e-06
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    52   2e-06
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    53   2e-06
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    52   2e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    53   2e-06
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    53   2e-06
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    53   2e-06
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    52   2e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    53   2e-06
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    52   2e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    53   2e-06
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    52   2e-06
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    53   2e-06
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    53   2e-06
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    52   2e-06
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    52   2e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    52   2e-06
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    52   2e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    53   2e-06
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    52   2e-06
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    53   2e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    52   2e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    53   2e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     52   2e-06
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    53   2e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    53   2e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    53   2e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    52   2e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    53   2e-06
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    52   2e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    52   2e-06
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    53   3e-06
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    52   3e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    52   3e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    52   3e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    52   3e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    52   3e-06
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    53   3e-06
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    52   3e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    52   3e-06
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    52   3e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    52   3e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              52   3e-06
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    52   3e-06
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    52   3e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    52   3e-06
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    52   3e-06
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    52   3e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   3e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    52   3e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               52   3e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   3e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    52   3e-06
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    52   3e-06
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    52   3e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    52   3e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    52   4e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    52   4e-06
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    52   4e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    52   4e-06
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    52   4e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    52   4e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    52   4e-06
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    51   4e-06
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    52   4e-06
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    52   4e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    52   4e-06
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    51   4e-06
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    52   4e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     52   4e-06
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    51   4e-06
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    52   4e-06
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    52   4e-06
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    52   4e-06
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    52   4e-06
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    52   4e-06
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    51   4e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    52   4e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    52   4e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    52   4e-06
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               51   4e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    52   4e-06
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    52   5e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    52   5e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    52   5e-06
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    52   5e-06
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    51   5e-06
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    52   5e-06
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    52   5e-06
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    51   5e-06
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    52   5e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    52   5e-06
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    52   5e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    52   5e-06
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    52   5e-06
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    51   6e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    51   6e-06
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    51   6e-06
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    52   6e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    51   6e-06
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    51   6e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    52   6e-06
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    51   6e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    51   6e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    50   6e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    51   6e-06
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    50   6e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    51   6e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    51   7e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    51   7e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    51   7e-06
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    51   7e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    51   7e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    51   7e-06
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    51   7e-06
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    51   7e-06
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    51   7e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    50   7e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    51   7e-06
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    51   7e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    51   8e-06
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    51   8e-06
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    50   8e-06
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    50   8e-06
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    50   8e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    51   8e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    51   8e-06
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    50   8e-06
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    51   8e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    51   8e-06
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    51   8e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    50   8e-06
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    51   8e-06
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    51   8e-06
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    50   9e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    50   9e-06
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    51   9e-06
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    51   9e-06
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               50   9e-06
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    51   9e-06
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    50   9e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     51   9e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    50   9e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    50   9e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    50   9e-06
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               51   9e-06
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    51   9e-06
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    50   9e-06
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    50   9e-06
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    50   9e-06
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    50   1e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    50   1e-05
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    50   1e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    50   1e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    50   1e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    50   1e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    51   1e-05
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    50   1e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    51   1e-05
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    51   1e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   1e-05
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    50   1e-05
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    50   1e-05
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    50   1e-05
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    50   1e-05
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    50   1e-05
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    50   1e-05
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    50   1e-05
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       50   1e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    50   1e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    50   1e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    50   1e-05
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    50   1e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    49   1e-05
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    50   1e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    50   1e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    50   1e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    50   1e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    50   1e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    50   1e-05
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    50   1e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    49   1e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    50   1e-05
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    50   1e-05
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    50   2e-05
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    50   2e-05
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    50   2e-05
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    50   2e-05
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    50   2e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    50   2e-05
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    49   2e-05
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    49   2e-05
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    49   2e-05
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               49   2e-05
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     50   2e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    49   2e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    50   2e-05
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    50   2e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    50   2e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    50   2e-05
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    50   2e-05
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    50   2e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    50   2e-05
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    49   2e-05
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    49   2e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    49   2e-05
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    50   2e-05
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    49   2e-05
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    49   2e-05
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    50   2e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    49   2e-05
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    49   2e-05
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    49   2e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    49   2e-05
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    49   2e-05
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    49   2e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    49   2e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    49   2e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    49   2e-05
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    49   2e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    49   2e-05
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    49   3e-05
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    49   3e-05
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    49   3e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    49   3e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    49   3e-05
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    49   3e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    49   3e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    49   3e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    49   3e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    49   3e-05
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    48   3e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    49   3e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    49   3e-05
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    49   3e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    49   3e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    48   3e-05
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    49   3e-05
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    49   3e-05
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    49   3e-05
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    49   3e-05
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    49   3e-05
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    49   3e-05
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    49   3e-05
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    49   3e-05
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    48   3e-05
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    49   4e-05
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    49   4e-05
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    49   4e-05
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     48   4e-05
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    49   4e-05
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    48   4e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    49   4e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    49   4e-05
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    49   4e-05
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    48   4e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    49   4e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    49   4e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    49   4e-05
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    49   4e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   4e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    49   4e-05
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    49   5e-05
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    49   5e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    48   5e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    48   5e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    49   5e-05
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    48   5e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    49   5e-05
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    48   5e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      49   5e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    48   5e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    48   5e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    48   5e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    48   5e-05
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    49   5e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    48   5e-05
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    48   5e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    48   5e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    49   5e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    48   5e-05
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    48   5e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               48   5e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    48   6e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    48   6e-05
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    48   6e-05
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    48   6e-05
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    48   6e-05
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    48   6e-05
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               48   6e-05
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    48   6e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    48   6e-05
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    48   6e-05
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    48   6e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    48   6e-05
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    48   6e-05
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    48   7e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    48   7e-05
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    48   7e-05
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    48   7e-05
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    48   7e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    48   7e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    47   7e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   7e-05
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    48   7e-05
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    48   7e-05
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    48   8e-05
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               48   8e-05
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    48   8e-05
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    47   8e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    48   8e-05
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    48   8e-05
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    48   8e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    48   8e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    48   8e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    47   8e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    48   8e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    47   8e-05
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    48   9e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    47   9e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    47   9e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    47   9e-05
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    47   1e-04
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    47   1e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    47   1e-04
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    47   1e-04
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    47   1e-04
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     47   1e-04
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    47   1e-04
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    47   1e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    47   1e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    47   1e-04
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    47   1e-04
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    47   1e-04
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    47   1e-04
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    47   1e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    46   1e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    47   1e-04
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    47   1e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    47   1e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    47   1e-04
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    47   1e-04
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    47   1e-04
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    47   1e-04
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    46   1e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    47   1e-04
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    47   1e-04
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    47   1e-04
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    46   1e-04
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    47   1e-04
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    46   1e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    46   1e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    47   1e-04
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    47   1e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    47   1e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    47   1e-04
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    46   2e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    46   2e-04
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    47   2e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    47   2e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    46   2e-04
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    47   2e-04
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    47   2e-04
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    46   2e-04
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    47   2e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   2e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    47   2e-04
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    47   2e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    46   2e-04
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    46   2e-04
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    47   2e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    46   2e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    46   2e-04
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    47   2e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    47   2e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    46   2e-04
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    46   2e-04
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    46   2e-04
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    47   2e-04
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    46   2e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    46   2e-04
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    46   2e-04
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    47   2e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    45   2e-04
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    46   2e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    46   2e-04
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    46   2e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    46   2e-04
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    46   2e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    46   2e-04
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    46   2e-04
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    46   2e-04
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    47   2e-04
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    45   2e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    46   2e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    46   2e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    45   2e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    46   2e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    46   2e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    46   2e-04
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    46   2e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    45   2e-04
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    45   2e-04
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    46   2e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    45   2e-04
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    46   2e-04
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    46   3e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      46   3e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    46   3e-04
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    46   3e-04
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    45   3e-04
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    46   3e-04
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    46   3e-04
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    45   3e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    46   3e-04
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    45   3e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   3e-04
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    45   3e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    45   3e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    46   3e-04
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    46   3e-04
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    45   3e-04
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    45   3e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    46   3e-04
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    46   3e-04
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    46   3e-04
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    45   4e-04
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    45   4e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    45   4e-04
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    45   4e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    45   4e-04
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    45   4e-04
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    45   4e-04
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    45   4e-04
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    45   4e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    45   4e-04
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    45   4e-04
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    45   4e-04
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    45   4e-04
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    45   4e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    45   5e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    45   5e-04
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    45   5e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    45   5e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    45   5e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    45   5e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    45   5e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    45   5e-04
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    45   5e-04
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    45   5e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    45   5e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    45   5e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    45   5e-04
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    45   6e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    45   6e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    44   6e-04
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    45   6e-04
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    45   6e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    44   6e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    44   6e-04
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    45   7e-04
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    45   7e-04
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    44   7e-04
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    45   7e-04
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    44   7e-04
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    45   7e-04
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    45   7e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    45   7e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    44   7e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    44   7e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    44   7e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    44   7e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    44   7e-04
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    44   8e-04
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    44   8e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    44   8e-04
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    44   8e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    44   8e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    44   8e-04
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    44   8e-04
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    44   8e-04
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    44   8e-04
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    44   8e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    44   9e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    44   9e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    44   9e-04
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    44   9e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    44   9e-04
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    44   9e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    44   9e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    44   9e-04
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    44   9e-04
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    44   0.001
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    44   0.001
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    44   0.001
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    44   0.001
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    44   0.001
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    44   0.001
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    44   0.001
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    44   0.001
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    44   0.001
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    44   0.001
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    44   0.001
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    44   0.001
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    44   0.001
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    44   0.001
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    44   0.001
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    44   0.001
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    44   0.001
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    44   0.001
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    44   0.001
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    44   0.001
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    44   0.001
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    44   0.001
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    44   0.001
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    44   0.001
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    43   0.001
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.001
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    44   0.001
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    44   0.001
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.001
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    44   0.001
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    44   0.001
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    44   0.001
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    44   0.001
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    44   0.001
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    44   0.001
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    44   0.001
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    43   0.001
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    44   0.001
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    43   0.001
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    44   0.001
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    44   0.001
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    44   0.002
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    43   0.002
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    43   0.002
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    43   0.002
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    44   0.002
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    43   0.002
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    43   0.002
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    43   0.002
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    43   0.002
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    43   0.002
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    43   0.002
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     43   0.002
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    43   0.002
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    43   0.002
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    43   0.002
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    43   0.002
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    43   0.002
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     42   0.002
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    43   0.003
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    42   0.003
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    43   0.003
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    43   0.003
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    43   0.003
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.003
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    43   0.003
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    42   0.003
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    43   0.003
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    43   0.003
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.003
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    42   0.003
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    42   0.003
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    42   0.003
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    42   0.003
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    42   0.003
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    42   0.004
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    42   0.004
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    42   0.004
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    42   0.004
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    42   0.004
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    42   0.004
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    42   0.004
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    42   0.004
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    42   0.004
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    42   0.004
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    42   0.004
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     42   0.004
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    42   0.004
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    42   0.004
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               42   0.004
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    42   0.004
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    42   0.005
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      42   0.005
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     42   0.005
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    42   0.005
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    42   0.005
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    42   0.005
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    42   0.005
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    42   0.005
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    41   0.005
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    42   0.005
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    42   0.005
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    41   0.005
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    42   0.005
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    41   0.006
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    42   0.006
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    41   0.006
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    41   0.006
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    42   0.006
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    42   0.006
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.006
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    42   0.007
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    42   0.007
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    40   0.007
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    41   0.007
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    41   0.008
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    41   0.008
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    41   0.009
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               41   0.009
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    41   0.009
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    41   0.009
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    41   0.009
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    40   0.010
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    41   0.010
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    41   0.010
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    41   0.010
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    41   0.010
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    41   0.011
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    41   0.011
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    41   0.011
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    41   0.011
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    40   0.012
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    40   0.013
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    41   0.013
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    40   0.013
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    40   0.013
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    41   0.013
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    40   0.013
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    41   0.013
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    40   0.014
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    40   0.015
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    40   0.015
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    40   0.015
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    40   0.015
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    40   0.015
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    40   0.016
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    40   0.017
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    40   0.017
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    40   0.017
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    40   0.018
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    40   0.020
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    40   0.020
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    40   0.021
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    39   0.021
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    40   0.021
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    40   0.024
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    40   0.024
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    40   0.025
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    40   0.026
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    39   0.026
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               39   0.029
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    39   0.029
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    39   0.029
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    39   0.034
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    39   0.034
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      39   0.036
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    39   0.038
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    39   0.038
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    39   0.039
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    39   0.040
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    39   0.042
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             39   0.043
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    39   0.047
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    39   0.047
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    39   0.047
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    39   0.048
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    38   0.051
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 39   0.051
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    39   0.053
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    39   0.067
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    38   0.071
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    38   0.074
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    38   0.074
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    38   0.076
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    38   0.078
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    38   0.083
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    38   0.083
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    38   0.084
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    37   0.089
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    38   0.090
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    38   0.099
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    38   0.11 
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    37   0.12 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    37   0.12 
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    37   0.12 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    37   0.12 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    37   0.14 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    37   0.17 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    37   0.17 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    37   0.18 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    36   0.18 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    37   0.18 
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    37   0.18 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    37   0.19 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    37   0.19 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    37   0.19 
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    37   0.19 
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    37   0.20 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    36   0.20 
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    37   0.21 
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    37   0.22 
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    36   0.22 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.23 
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    36   0.26 
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    36   0.27 
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    36   0.29 
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    36   0.30 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    36   0.30 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    36   0.30 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    36   0.31 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    36   0.31 
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    36   0.31 
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    36   0.34 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    35   0.36 
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    35   0.36 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    36   0.36 
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    36   0.37 
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    36   0.37 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    35   0.38 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    35   0.38 
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     36   0.41 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    35   0.41 
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    35   0.45 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    35   0.48 
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    35   0.49 
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    35   0.56 
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    35   0.57 
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    35   0.59 
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    35   0.60 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    35   0.65 
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    35   0.66 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    35   0.68 
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    35   0.81 
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      35   0.87 
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    35   0.89 
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     34   0.91 
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...    35   0.97 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    34   1.0  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    34   1.0  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    34   1.1  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    34   1.2  
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    33   1.3  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    34   1.3  
KNAG0B01260 Chr2 (237922..240345) [2424 bp, 807 aa] {ON} Anc_3.3...    34   1.3  
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    34   1.4  
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    34   1.6  
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    33   1.6  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    33   1.6  
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    33   1.6  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    33   1.7  
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    33   1.7  
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    33   2.1  
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    33   2.2  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    33   2.2  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    33   2.5  
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    33   2.6  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    33   3.1  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    33   3.1  
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    33   3.2  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    33   3.9  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    32   3.9  
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    32   4.0  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    32   4.2  
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    32   5.3  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    32   5.4  
KNAG0A07620 Chr1 (1197252..1200422) [3171 bp, 1056 aa] {ON} Anc_...    32   5.4  
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    32   5.5  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    32   7.0  
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    31   7.1  
YMR234W Chr13 (740266..741312) [1047 bp, 348 aa] {ON}  RNH1Ribon...    31   8.7  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    31   9.4  

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/632 (91%), Positives = 579/632 (91%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360
           NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360

Query: 361 TAQSLPTRENSQAFINATSSSLTGSPSIFETGVCNTLNIFNQPNTNPTTKLKQAIDSEAH 420
           TAQSLPTRENSQAFINATSSSLTGSPSIFETGVCNTLNIFNQPNTNPTTKLKQAIDSEAH
Sbjct: 361 TAQSLPTRENSQAFINATSSSLTGSPSIFETGVCNTLNIFNQPNTNPTTKLKQAIDSEAH 420

Query: 421 SFRKSDPINLSLPNIIPQXXXXXXXXXXXYTGDVDELKKTRSLGSYSTHENAKGGESVKG 480
           SFRKSDPINLSLPNIIPQ           YTGDVDELKKTRSLGSYSTHENAKGGESVKG
Sbjct: 421 SFRKSDPINLSLPNIIPQDNDSSSSSDESYTGDVDELKKTRSLGSYSTHENAKGGESVKG 480

Query: 481 ESVXXXXXXXXXXXXXXXXXXAKIESKRQSLPETAFVGVVDSGKDSLPSDPKSNRPVKDS 540
           ESV                  AKIESKRQSLPETAFVGVVDSGKDSLPSDPKSNRPVKDS
Sbjct: 481 ESVKASLTTSSSPGSSSALKPAKIESKRQSLPETAFVGVVDSGKDSLPSDPKSNRPVKDS 540

Query: 541 VSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATEDEGPGKPIASILRTPVLXXXX 600
           VSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATEDEGPGKPIASILRTPVL    
Sbjct: 541 VSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATEDEGPGKPIASILRTPVLKEKK 600

Query: 601 XXXXXXXXXXXXXXXXXXXXSFLAGQKLCSEK 632
                               SFLAGQKLCSEK
Sbjct: 601 AKPIPPPKPFHLKPKPPPKPSFLAGQKLCSEK 632

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/604 (68%), Positives = 462/604 (76%), Gaps = 24/604 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQPQIGTYNVGTQLTVGSHQVEI+KYLTSGGFAQVYSALISPPDPH++SN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAM+LLRNNRYVVSYIDSHAAKA LHNGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRLHE EILQIM QVTQGVAAMHALQPPLIHRDIKIENVLISA NEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPPRNPQELSYV+QD+ KNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEKGGEPAIL+G FEF PYP+YSEQLR+LI  +LVQNP QRPNV+QLLK+I+ MQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360
           N P PI D+Q  Q P +HLNL ELHQ SATQNI+SLNSHS  E  + N  FQ  MP    
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSHSTIERPIPNAAFQSSMPD--A 358

Query: 361 TAQSLPTRENSQAFINAT----------------SSSLTGSPSIFETGVCNTLNIFNQPN 404
             Q+L +R+ SQ   N T                S S    P +FE+G+ NT    N+  
Sbjct: 359 ATQTLFSRKKSQTSDNTTLNYSAENPQTSLDKSESVSHVLDPLLFESGMSNTSKSLNRAK 418

Query: 405 TNPTTKLKQAIDSEAHSFRKSDPINLSLPNIIPQXXXXXXXXXXXYTGDVDELKKTRSLG 464
            + TTKLKQ IDSEAH+FR +  +NL L NIIPQ           Y  DVD+L+KT+SLG
Sbjct: 419 VSSTTKLKQVIDSEAHNFRHNYTMNLPLRNIIPQDDDSSSSSDELYPEDVDKLEKTQSLG 478

Query: 465 SYSTHENAKGGESVKGESVXXXXXXXXXXXXXXXXXXAKIESKRQSLPETAFVGVVDSGK 524
           SY + +N       KGESV                   K++ K ++LP + FV  VD+ K
Sbjct: 479 SYISRDNK------KGESVKESLTSSSLPGSSLTATPTKLDLKLETLPNSTFVNTVDNSK 532

Query: 525 DSLPSDPKSNRPVKDSVSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATEDEGPG 584
           +S  +  KSN    D VSVS+QDLKNSI+QRM++ LNSSEESFNARK  +AKA+E E  G
Sbjct: 533 NSFRNFSKSNPLAYDDVSVSRQDLKNSIRQRMLDKLNSSEESFNARKMPKAKASEKESTG 592

Query: 585 KPIA 588
           KPIA
Sbjct: 593 KPIA 596

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/599 (67%), Positives = 450/599 (75%), Gaps = 19/599 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQPQIGTYNVGT+LTVGSHQVEIIKYLTSGGFAQVYS LISPPDPHTN+NVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAM+LL+NNRYVVSYIDSHAAKA L NGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRLHE EILQI+ QVTQGVAAMHALQPPLIHRDIKIENVLIS  NEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR PRN QELSYV+QD+LKNTTAQYRSPEM+DIFRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEKGGEPAIL+G+FEF  YPNYSEQL++LI  +LVQNP  RP+VFQLLK+I+ MQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360
           N P PI D+QTVQ PS+HLNL ELHQ SATQNIQSLNSH +  NS+    FQF  P N+ 
Sbjct: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360

Query: 361 TAQSLPTRENSQAFINATS------------SSLTGSPSIFETGVCNTLNIFNQPNTNPT 408
           TAQ+LP +E S  F + TS            ++L+ SP  FE    + LN   +   N T
Sbjct: 361 TAQTLPIKEESNIFYDPTSCNFAKDSQSRLNNALSRSP--FELEAVSDLNNV-KDEANST 417

Query: 409 TKLKQAIDSEAHSFRKSDPINLSLPNIIPQXXXXXXXXXXXYTGDVDELKKTRSLGSYST 468
           T+LKQ I SEAH+FR+++ +NLSLPN+IP            Y GD DELKKT+SL SYST
Sbjct: 418 TRLKQTIVSEAHNFRQNNSLNLSLPNMIPHNDDSSSSSDESYPGDTDELKKTQSLSSYST 477

Query: 469 HENAKGGESVKGESVXXXXXXXXXXXXXXXXXXAKIESKRQSLPETAFVGVVDSGKDSLP 528
             N K  + V+                        ++ K  S   T+    VD  K++  
Sbjct: 478 RSNTKRDQPVEE---YLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTS-TNTVDGLKNNTL 533

Query: 529 SDPKSNRPVKDSVSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATEDEGPGKPI 587
           S  K+N P  D V  SKQDLKNSIQQRM+  LNSSEESFNARK S  K    EG   PI
Sbjct: 534 SLSKNNLPAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGGQEGTNIPI 592

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/603 (67%), Positives = 456/603 (75%), Gaps = 28/603 (4%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI+PPDPH+NS+VACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAM+LL+NNRYVVSYIDSHAAKA LHNGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRLHE EILQIM QVTQGVAAMHALQPPLIHRDIKIENVLISA NEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPPRN QELSYV+QD+LKNTTAQYRSPEM+D FRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEKGG+ AIL+G+FEF  YPNYSEQL+ LI  +LVQ+P  RPNV+QLLK+I+ MQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360
           N P PI D+Q VQ PS+HLNL ELHQ SATQNI SLNS +  EN+M N  FQ  M  N  
Sbjct: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT 360

Query: 361 TAQSLPTRENSQAFINAT-SSSLTGS---------------PSIFETGVCNTLNIFNQPN 404
           TAQ  P R+ SQ   +A+ S+S  GS               P + E    +  N  N+  
Sbjct: 361 TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK 420

Query: 405 TNPTTKLKQAIDSEAHSFRKSDPINLSLPNIIPQXXXXXXXXXXXYTGDVDELKKTRSLG 464
            N  TKLKQAI SEAH+FR+++ I+  L NIIPQ           Y+GDVDELKKTRSLG
Sbjct: 421 ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQYEDSSSSSDESYSGDVDELKKTRSLG 480

Query: 465 SYSTHENAKGGESVKGESVXXXXXXXXXXXXXXXXXXAKIESKRQSLP-ETAFVGVVDSG 523
           SYST  N K  +SVK ES+                   K+  K ++ P ++ FV  +D+ 
Sbjct: 481 SYSTRGNIKKNQSVK-ESL----TSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNS 535

Query: 524 KDSLPSDPKSNRPVKDSVSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATEDEGP 583
           KD L      N+P  + + VSKQ+LKNSIQQRMI+ LNSSEESFNARK S+ K  E    
Sbjct: 536 KDDL------NKPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEI 589

Query: 584 GKP 586
            KP
Sbjct: 590 DKP 592

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  498 bits (1282), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 274/319 (85%), Gaps = 1/319 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP+I TY+ GT L VGSHQV IIKY+TSGGFAQ+Y+  ISPPD   +SN+ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMKLLRNN++VVSYIDSHA+K+  +NGSYEVF+LMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL ESE+L I  QV QG+AAMHALQPPL+HRDIKIENVLIS  N+YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IRPP NPQEL YV+ DVLKNTTAQYRSPEM+D +RGLPIDEKSDIWA+G+FLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-GGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
           YYTTPFEK GGE AIL+ ++E+  +P YSE+L++LI  +L++NP QRPN++Q++++I+ M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QNAPYPIRDVQTVQRPSNH 318
           QN P PI +   V +   H
Sbjct: 301 QNVPCPIVNFYLVTQQQKH 319

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  497 bits (1280), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 314/431 (72%), Gaps = 9/431 (2%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQPQI  Y  GT LTVGSH+V+++KYLTSGGFAQ+Y+  ISPPD  TN+NVACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVD MKLLRNN +VVSYIDSHAAK   + GSYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQ RL E EIL IM QVTQG+AAMHAL PPL+HRDIKIENVL+++K EYK+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP N QE+SYV+ D++KNTTAQYR+PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL+  F+F  YP YS++L+ LI  +L++ PSQRPN +Q+L+++++MQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360
           N   PI +   +   +N++   ++   +  QN  ++ +    +  + N NF +  P N +
Sbjct: 301 NVQCPIPNFYLM---NNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTP-NAV 356

Query: 361 TAQSLPTRENSQAFINATSSSLTGS-PSIFETGVCNTLNIFNQPNTNPTTKLKQAIDSEA 419
           +   +         +N+T +  TG  P    T +  T+ +  QP     T    +I +  
Sbjct: 357 SMNDIQMMNAINLKVNSTHN--TGMIPPTMATNMARTIPM--QPVQKSQTLPVSSIPTNL 412

Query: 420 HSFRKSDPINL 430
            +  KS P NL
Sbjct: 413 QNTNKSSPFNL 423

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  497 bits (1279), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/308 (74%), Positives = 264/308 (85%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP+I  YN GT LTVGSH  ++I YLTSGGFAQVYSA I P D   +SNVACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMKLLRNN++VVSYIDSHAAK++  NGSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E EIL IM QVTQG+AAMHALQPPLIHRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPP+NPQE +YV+ DVLKNTTAQYRSPEM+D++RG PIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEKGGE AIL+ +F+F   P YS++L+ LI ++L++NP QRPNV Q+L+ ++ MQ
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NAPYPIRD 308
               P+R+
Sbjct: 301 GIQCPVRN 308

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  500 bits (1288), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 225/308 (73%), Positives = 271/308 (87%), Gaps = 1/308 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           M+QP + TY  GT LTVGSH+  IIKYLTSGGFA +YSA ISPPDP+++S +ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN+LRAEVDAMKLL+ +++VVSYIDSHAAK++L+NGSYEVF+LMEYC RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E E+L+IM QV+QGVAAMHALQPPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPP+NPQEL+YV+ D+LKNTTAQYRSPEM+D++RGLP+DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL+ +F+F  YP YS+QL+NLI  LL +NP QRPN+ QLL +++ +Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NAPYPIRD 308
             P P+++
Sbjct: 300 GVPCPVKN 307

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  491 bits (1264), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/308 (72%), Positives = 267/308 (86%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQPQ+  Y+ GT L+VGSHQ  IIKYLTSGGFAQVY+A ISP DP  NS++ CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMKLLRNN +VVSYIDSHAAK   + GSYEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRLHE+EIL IM QV+QGVAAMHALQPPL+HRDIKIENVL++++  YKLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP NPQE +YV+ D++KNTTAQYRSPEM+++ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL+  F+F  +P+YS+++++LI   L   PSQRPN++QLL++++ +Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NAPYPIRD 308
           N P PI D
Sbjct: 301 NVPCPIPD 308

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  494 bits (1272), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/309 (72%), Positives = 269/309 (87%), Gaps = 3/309 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVYSA ISPPDP++++N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAMKLL+NN++VVSYIDSHAAK+   NG +YEVFVLMEYCERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEYCERGGLID 118

Query: 120 FMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG 179
           FMNTRL+NRL ESEIL IM Q  QG+AAMHALQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239
           SV GVIRPP+NPQE +YV+ D+L NTTAQYRSPEM+D++RGLPIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
           CYYTTPFEK GE AIL+ ++++  +P YS++L+NLI  +L++ PSQRPN+ Q+L++++ +
Sbjct: 239 CYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QNAPYPIRD 308
           QN P PIR+
Sbjct: 299 QNRPCPIRN 307

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/309 (72%), Positives = 267/309 (86%), Gaps = 3/309 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+A ISPPDP+TN+N+ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAMKLL+NN++VVSYIDSHAAK+   NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG 179
           FMNTRLQNRL ESEIL+IM Q  QG+AAMHALQPPLIHRDIKIENVLIS    YK+CDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239
           SV GVIRPPRN QE +YV+ D+L NTTAQYRSPEM+D++RGLPIDEKSDIWALGIFLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
           CYYTTPFEK GE  IL+ ++++ P+P YS++L+NLI  +L++ PS+RPN+ Q+L++++ +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 300 QNAPYPIRD 308
           Q  P PIR+
Sbjct: 299 QIKPCPIRN 307

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  491 bits (1263), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 228/332 (68%), Positives = 273/332 (82%), Gaps = 12/332 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+A ISPPDP++N+N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG-SYEVFVLMEYCERGGLID 119
           P K  LNTLRAEVDAMKLLRNN++VVSYIDSHAA++   NG +YEVFVLME+CERGGLID
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG 179
           FMNTRLQNRL ESEIL+IM Q  QG+ AMHALQPPLIHRDIKIENVLIS    YK+CDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239
           SV GVIRPPRN QE +YV+ D+L NTTAQYRSPEM+D++RGLPIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
           CYYTTPFEK GE  IL+ ++++  +P YS++L+NLI  +L++ PSQRPN+ Q+L++++ +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QNAPYPIRDVQTVQRPSNHLNLMELHQNSATQ 331
           QN P PIR         N   L  ++QN+ TQ
Sbjct: 299 QNKPCPIR---------NFYLLRAMNQNANTQ 321

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  488 bits (1257), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 262/308 (85%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP  G Y  GT LTVGSHQ  IIKYLTSGGFA +YSA ISP DP++  NVACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAMKLLR N++VVSYIDSHAAK+   +GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E+E+L+IM  +TQG+AAMHAL PPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPP+N QE SYV+ D+LKNTTAQYRSPEM+D++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK G+ AIL+ +F+F  YP YS++L+NLI  +L +NP+QRPN+ Q+L++++ +Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NAPYPIRD 308
           N P P+R+
Sbjct: 301 NVPCPLRN 308

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  479 bits (1233), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 224/345 (64%), Positives = 274/345 (79%), Gaps = 13/345 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP I TY  GT LTVGSHQV+IIKYLT+GGFAQ+Y   ISP DP + +N+ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAMKLLRNNR VVSYIDSHAAK++  NG+YEVF+LMEYCE GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           +N+RLQNRL ESE++ IM  V+QGVAAMHALQPPL+HRDIKIENVL+S  NE+KLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G IRPP NPQEL+ V+ D+++NTTAQYRSPEM+D+ RG PIDEKSDIWALG+FLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE  IL  ++EF  +P YS++LR+LI KLL   P+ RPN++ ++K++++M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENS 345
           N   PI +             ++ +   A+ NIQ L  HSI  N+
Sbjct: 301 NISCPIINF-----------YLKPNMTDASNNIQHL--HSIMNNT 332

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  483 bits (1244), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/306 (71%), Positives = 264/306 (86%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP I TY  GT LTVGSH  +IIKYLTSGGFAQ+Y+  ISP +P+ NS  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NNR+VVSYIDSHAA++T+  G+YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E EIL I+ Q  QGV+AMHALQP LIHRDIKIENVLISAK E+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VC  IRPPRNPQEL+YV+ DVLKNTTAQYR+PEM+D++RGLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEKGGE AIL+ ++++  +P Y+++L+NLI   L+++PS+RPN+ QLL++I+ +Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NAPYPI 306
             P PI
Sbjct: 301 GIPCPI 306

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  484 bits (1246), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 281/349 (80%), Gaps = 12/349 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MN PQI T+  G  LTVGSH  ++IKYLTSGG+AQVY   ISP DP+ NSN+ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMKLL+NNR+VVSYIDSHA+K+ ++NG+YEVFVLME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MN+RLQ+RL E+EIL IM   +QG+AAMH LQP L+HRDIKIENVLIS  NEYK+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG++RPP+N QE ++V  D++KNTTAQYRSPEM+D+ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-GGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
           YYTTPFEK GGE AIL  +F++  YP YS++L+NLI  +L +NPS RPNV Q+L++++ +
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QNAPYPIRDV----------QTVQRPSNHLNL-MELHQNSATQNIQSLN 337
           Q  P PIR+           +T+++P  ++ +   L Q S   N+ SLN
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLN 349

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  483 bits (1244), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/309 (71%), Positives = 264/309 (85%), Gaps = 3/309 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MN PQI  Y+ GT LTVGSH  +IIKYLTSGGFAQVY+A ISPPDP++N+N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAMKLL+NN++VVSYIDSHAAK+   NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG 179
           FMNTRLQ+RL ESEIL+IM Q  QG+AAMH LQPPLIHRDIKIENVLIS    YK+CDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239
           SV GVIRPPRN QE +YV+ D+L NTTAQYRSPEM+D++R  PIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
           CYYTTPFEK GE AIL+ ++++  +P YS++L+ LI  +L++ PSQRPN+ Q+L++++ +
Sbjct: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 300 QNAPYPIRD 308
           QN P PIR+
Sbjct: 299 QNEPCPIRN 307

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  471 bits (1213), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/308 (69%), Positives = 255/308 (82%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP I TY  G  L VG H   I+KYLTSGG+AQVY A ISPPD  T S++ CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  +VVSYIDS+AAK+ LHNG+YEV +LME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E EIL IM QVTQGVAAMH+L+PPL+HRDIKIENVLIS   EYKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPP + QE ++V+ D+LKNTTAQYR+PEM+D+ R LPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL+ ++E+L YP+YS+ L+NLI  +L   PSQRPN+ Q+L++++ +Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NAPYPIRD 308
             P PI++
Sbjct: 301 GIPCPIKN 308

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  472 bits (1214), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/308 (68%), Positives = 258/308 (83%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQ     Y  GT+LTVGSH+  IIKYLTSGGFA +Y+A I P D  + + +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAMKLLR N++VVSYIDSHAAK+ +H+GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E E+L+I   +TQG+AAMHALQPPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPP+NPQE +YV+ D+LKNTTAQYR+PEM+D++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL+ +F+F  YP YS+ L++LI  +L +NP+QRPN+ Q+L++++ +Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NAPYPIRD 308
             P P+R+
Sbjct: 301 GTPCPLRN 308

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  468 bits (1205), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/308 (69%), Positives = 258/308 (83%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP++   NVGTQLTVG+H V+I+KYLTSGGFAQ+Y+  I        SNVACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAMKLL NN++VVSYIDSHA ++  ++G+YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E EIL IM Q TQG+A MHAL PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V GVIRPPRN QEL YV+ D++KNTTAQYR PEM+D++RGLPIDEK+DIWALG+FLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GEPAIL+ +F+F  +PNYS++L+NLI  +L ++PS RPNV Q+L++++ MQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NAPYPIRD 308
           N P PIR+
Sbjct: 301 NVPCPIRN 308

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  468 bits (1203), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/308 (68%), Positives = 255/308 (82%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQPQI  Y  GT L VGSHQV+++KYL SGGFA VYS  ISPPDP    NVACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVD+MK LR N+++VSYIDSHA K+ ++ G YEV++LMEYC  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E EIL IM QV+QGVAAMHALQPPLIHRDIKIENVL+S  +E+KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V GVIR PRN +E +YV+ D++KNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL  +FEF  YP YS++++NLI  +L  +P +RPN+ Q++++++ +Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NAPYPIRD 308
             P PI++
Sbjct: 301 GIPCPIKN 308

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  464 bits (1194), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 221/345 (64%), Positives = 276/345 (80%), Gaps = 5/345 (1%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP I  Y  GT LTVG+H+  I KYLTSGGFAQ+Y+  I+P D ++ SNVACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           P K+ LNTLRAEVDAMKLL+NNR+VVSYIDS+A K+  +NGSYEV +LMEYCE GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MN+RLQNRL E+EIL I+ Q  QGVA MHALQP L+HRDIKIENVL S   E+KLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG IRPPRN QELSYV+ D+LKNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL+ +F++  +P YS++L+NLI  +L +NP++RPN+ +LL++I+++Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NAPYPIRDVQTV--QRPSNHLNLME---LHQNSATQNIQSLNSHS 340
             P PI++   +  Q+ +N + L     + + +  Q IQ LN+ +
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNART 345

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  462 bits (1189), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/308 (67%), Positives = 255/308 (82%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MN P+I TY  GT L+VG+H  +I+KY+ SGGFAQVYSA + P D  T +N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           P+K  LN LRAEV+AMKLL+ +++VV YIDSHAA++ L NG+YEVF+LME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E EIL IM QVTQG+AAMHALQPPLIHRDIKIENVLISA  EYK+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G IRPPRNPQE ++V+ D+LKNTTAQYRSPEM+D++R   IDEKSDIWALGIFLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEKGG+ AIL+ +++FL +P YS++L+NLI  +L Q P QRPN+ Q+L++++ MQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NAPYPIRD 308
               P+R+
Sbjct: 301 GVSSPMRN 308

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  461 bits (1187), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 236/402 (58%), Positives = 293/402 (72%), Gaps = 19/402 (4%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP+I  Y  G  L VGSHQ +I+KYLTSGGFAQVY   ISP D H+ SN+ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKAT----LHNGSYEVFVLMEYCERGG 116
           PDKTSLN  RAEV+AMKLLRNN+YVVSYIDSHAAK+     + NGSYEVF+LMEYC   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLC 176
           LIDFMNTRLQNRL E EIL IM  V+QGVAAMHALQPPL+HRDIKIENVLIS KNE+KLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFL 236
           DFGSVCGVIRPP N  EL +V+ D+LKNTTAQYRSPEM+ + + +PI+EKSDIWALG+FL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
           YK+CYYTTPFEK GE AIL+ ++++  YP YS+ L+NLI  +L+ +PS+RPN+ Q+++++
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 TNMQNAPYPI------RDVQTVQRPSNHLN-LME----LHQNSATQNIQSLNSHSINEN- 344
           + +Q  P P+      R ++      NH N  ME    LH      +I S    ++N N 
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLH---LQHSISSPALSTVNNNI 357

Query: 345 SMSNQNFQFRMPANVITAQSLPTRENSQAFINATSSSLTGSP 386
            +SN NF   +  + I   +  +R N+  +    SS+L  +P
Sbjct: 358 GLSNINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTP 399

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  444 bits (1141), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 197/310 (63%), Positives = 249/310 (80%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MN P I  Y  GT +TVGSH V I+KYLTSGG+AQ+YSA I P D    +N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK+ LNTLRAEVDAMK L++++Y+VSYIDSHAAK+   +G+YEVF++MEYC RGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E+EIL I   ++QGVAAMH LQPPLIHRDIKIENVLIS  ++YKLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G IRPP+ P+EL+YV  D++ +TTAQYR+PEM+D+ +G  +++KSDIWALG+FLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFE+ GE  ILNG  EF PYP+YS+ ++ LI  +L +NP  RPN+FQ+++ ++ + 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NAPYPIRDVQ 310
           N   PI ++ 
Sbjct: 301 NVNCPIPNIH 310

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  446 bits (1147), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 249/308 (80%), Gaps = 1/308 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQ    ++  GT LTVGSH+V+++KYLTSGGFAQ+Y   +  PD     +VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMKLLR N+++VSYIDSHA+K+ L+NGSYEV +LMEYC RGGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQ+RL E E+L+IM QV QG+ AMHALQPPLIHRDIKIENVLI+   + K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPP+N  ELSYV+ D+LKNTTAQYR+PEM+D++RG  +DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL   F+F  YP YS +L+NLI  +L +NP  RPN  Q+L+++  +Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 NAPYPIRD 308
             P P+++
Sbjct: 300 GQPCPVKN 307

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  442 bits (1137), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 253/306 (82%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP I  Y+ GT+L VG HQV IIKYLTSGGFAQ+Y   ++PP+P    N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           P+K+ LNTLRAEV+AM+LL+   +VV YIDS+AA++  ++G+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNTRLQNRL E E+L IM QVTQG+ AMH+L PPLIHRDIKIENVLIS+  EYK+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IRPP+N +E ++V+QD++KNTTAQYR PEM+D++RG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFE GGE AIL+ ++++  YP YS +L+NLI  +L++ P QRPNV Q+L+++++MQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NAPYPI 306
             P P+
Sbjct: 301 GIPCPL 306

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  437 bits (1125), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 248/306 (81%), Gaps = 1/306 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQ        G  LTVGSH+V+II+YLTSGGFAQ+YS  +  P P    ++ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMK+L+ +R+VVSYIDSHAAK+  H+G+YEV++LMEYC RGGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MN+RLQ RL E E+L+IM  V QG+ AMHAL PPLIHRDIKIENVLIS   ++K+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           V GVIRPP+N  E +YV+ D+LKNTTAQYR+PEM+D++R LP+DEKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           Y+TTPFEK GE AIL  +F+F  YP Y+++L+NLI  +L ++P QRPN+ Q+L++++ +Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NAPYPI 306
             P P+
Sbjct: 300 GVPCPL 305

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  433 bits (1114), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 256/329 (77%), Gaps = 1/329 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQ Q+  Y   T +TVGSH  +I+KYL SGG+AQVYSA ++P D    +N+ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDA+K+LRN +YVVSYIDSHA+K + H GSYEVFVLMEYC  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           +NTRL+NRL E EIL IM QV  GVA MH LQP LIHRDIKIEN+LIS   EYK+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGVIRPPR+ +E+ Y++ D++KNTTAQYRSPEM+D+ +G  I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300
           YYTTPFEK GE AIL  QF++  YP YS+ L+N+I  LL  +P +RPN+ QL+++++ +Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSA 329
               P+++   + R     +LM+  QN++
Sbjct: 301 GIVPPMKNFY-LSRALETSSLMQPLQNNS 328

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  436 bits (1122), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 197/310 (63%), Positives = 241/310 (77%), Gaps = 2/310 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTN--SNVACLKRV 58
           MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +       N    +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLI 118
           IVPDK+ LNTLRAEVDAMKLL+ N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDF 178
           DF+NTRL +RL E EIL+IM  V QGVAAMH LQPPLIHRDIKIENVLIS   +YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYK 238
           GS C V+RPP+ PQE +++  D++ NTTAQYRSPEM+D + G PIDEKSDIWALG+FLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITN 298
           LCYYTTPFEK GE AILN +F+F  YP YS+ +RN+I  +L ++P +RPN+ Q+L+Q++ 
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 MQNAPYPIRD 308
           +Q  P PI +
Sbjct: 301 LQGVPCPIEN 310

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  409 bits (1050), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 194/309 (62%), Positives = 242/309 (78%), Gaps = 6/309 (1%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           MNQP I  Y  G  + VGSHQ +I+KYLTSGGFAQ+YS  ISP D +TNSN+ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           P+K+ LN LR EVDAMKLL+NNR+VVSYIDS+AAK+   NGSYEVF+LMEYCERG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           MNT+L+ RL E E+L IM QV QG+AAMH L PPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKS---DIWALGIFLY 237
           VCG+IRPPRNPQEL YV+ DV+KNTTAQYRSPEM+D+ +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQIT 297
            L +YT  F +  E AILNG++++  YP YS++L+N++  LL  +P +RPN+ QLL++I+
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 NMQNAPYPI 306
            +QN P PI
Sbjct: 298 KIQNIPCPI 306

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  384 bits (987), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 230/313 (73%), Gaps = 1/313 (0%)

Query: 9   YNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNT 68
           Y  GT+L V SH+V I  YLTSGGFAQVY+A I+    +    + CLKRVIVP+K SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128
           LRAEVDAMK+L+NN+Y+VSYIDSHA +      SY V +LMEYC   GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPP 188
           L E EIL+IM  V+QGV  MH LQPPL+HRDIKIENVL+S    +KLCDFGSV GV+R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 RNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            + +E  Y++ D+LKNTTAQYRSPEMV++  G PI+EKSDIWALGI LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 GGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPYPIRD 308
            G  AI+ G+F +  YP Y++ L+N+I  LL  NP QRPN+ QLL+++  +Q+   P+ +
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 VQTVQRPSNHLNL 321
              VQR  + L +
Sbjct: 309 FY-VQRAMSSLQM 320

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  309 bits (792), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 209/321 (65%), Gaps = 22/321 (6%)

Query: 9   YNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA--------LISPPDPHTNSNV-------- 52
           +N G  + VG H+VEIIKYL  GGFAQ+YS           + PD   +SN+        
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 53  -----ACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFV 107
                ACLKRV+VPD+  LN LR EV+ M+ L+    +V Y DS+A++    N  +EV +
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLI 167
           LME C    L+D+MN RL  +L E EIL+IM  VT G++ MH LQ PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 SAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKS 227
            + N +KLCDFGS         + QE++ + Q++  +TT QYRSPEM+D++R LPIDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRP 287
           DIWALG+FLYKL +YTTPFE  G+ AIL+ ++E +P  NYS +L NLI  +L +NP+ RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYE-IPPNNYSSRLINLIIIMLAENPNLRP 317

Query: 288 NVFQLLKQITNMQNAPYPIRD 308
           N++Q++ Q+        PI+D
Sbjct: 318 NIYQVMHQVCITIGIEPPIKD 338

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  308 bits (789), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 167/357 (46%), Positives = 227/357 (63%), Gaps = 34/357 (9%)

Query: 6   IGT--YNVGTQLTVGSHQVEIIKYLTSGGFAQVYS-----ALISPPDPHTNSN------- 51
           +GT  +  GTQ+ VGSH+VEIIKY+  GGFAQ+Y+     +L    D +T+ N       
Sbjct: 19  VGTEKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDR 78

Query: 52  ------------VACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLH 99
                       +ACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++   H
Sbjct: 79  QAPNPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRR--H 136

Query: 100 NGS--YEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIH 157
           NG+  +EV +LME C    L+D+MN RL  +L E EIL+IM  +T  V+ MH L+ PL+H
Sbjct: 137 NGASGFEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLH 196

Query: 158 RDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDI 217
           RDIKIENVL+ A+N +KLCDFGS    +      Q+++ + Q++  +TT QYRSPEM+D+
Sbjct: 197 RDIKIENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL 256

Query: 218 FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICK 277
           +R LPIDEKSDIWALGIFLYKL ++ TPFE  G+ AIL+ ++EF P  NYS +L NLI  
Sbjct: 257 YRCLPIDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEF-PKNNYSSKLINLIII 315

Query: 278 LLVQNPSQRPNVFQLLKQITNMQNAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQ 334
           +L +NP+ RPN++Q+L  I +M N   PI D+   Q P N       H  +  QNIQ
Sbjct: 316 MLAENPNLRPNIYQVLDNICSMMNVEVPIEDIYE-QGPYNFEKYT--HFQNKIQNIQ 369

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  302 bits (774), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 207/312 (66%), Gaps = 10/312 (3%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LISPPDPH-----TNSNVACLK 56
           + +Y  GT + VG H+VE++KYL  GGFA++Y       +S  DP+      N +  CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGG 116
           RV+V D   LN +R EV+ M+ L+    VV Y DS+A++       YEV +LME C    
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLC 176
           L+D+MN RL  +L E EIL+IM  VT  VA MH L  PLIHRDIKIENVL+ +KN +KLC
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFL 236
           DFGS    +    + Q+++ + Q++  +TT QYRSPEM+D++R LP++EKSDIWALG+FL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
           YKL +YTTPFE+ G+ AIL+ ++EF P  NYS +L NLI  +L +NP+ RPN++Q+L QI
Sbjct: 266 YKLMFYTTPFERTGQFAILHSKYEF-PLNNYSSKLINLIIVMLAENPNLRPNIYQVLNQI 324

Query: 297 TNMQNAPYPIRD 308
             +     P+ D
Sbjct: 325 CYISGIKNPMDD 336

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  303 bits (775), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 147/305 (48%), Positives = 204/305 (66%), Gaps = 9/305 (2%)

Query: 12  GTQLTVGSHQVEIIKYLTSGGFAQVY--------SALISPPDPHTNSNVACLKRVIVPDK 63
           GT + VGSH+VEI+KYL  GGFA +Y        + L +P       ++ACLKRV+V D+
Sbjct: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94

Query: 64  TSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNT 123
             LN LR EV+ MK L+N+  +V Y DS+A++    +  YEV +LME C    L+D+MN 
Sbjct: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154

Query: 124 RLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCG 183
           RL  +L E E+L+IM  VT+ VA MH L  PLIHRDIKIENVL+ ++N +KLCDFGS   
Sbjct: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214

Query: 184 VIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYT 243
                   Q+++ +  ++  +TT QYR+PEM+D++R LPIDEKSDIWALGIFLYKL +YT
Sbjct: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYT 274

Query: 244 TPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAP 303
           TPFE  G+ AIL+ +++ +P  NYS +L NLI  +L +NP+ RPN++Q++ Q+  +    
Sbjct: 275 TPFELTGQFAILHSKYD-IPANNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVD 333

Query: 304 YPIRD 308
            P  D
Sbjct: 334 VPFED 338

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  306 bits (783), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 211/318 (66%), Gaps = 11/318 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSAL----------ISPPDPHTNS 50
           +N P    Y  G  ++VG+H+VEI+ YL  GGFAQ+Y             +      T  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLME 110
           ++ACLKRVIV D+  LN +R EV+ MK L+++  +V Y DS+A++ T     +EV +LME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            C    L+D+MN RL+ +L ESEIL+IM  V+ G++ MH L  PLIHRDIKIENVL+ A 
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIW 230
           N +KLCD GS      P  + Q+++ + Q++  +TT QYR+PEM+D++R LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVF 290
           ALGIFLYKL +YTTPFE  G+ AIL+ +++F P   YS ++ NLI  +L +NP+ RPN+F
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QLLKQITNMQNAPYPIRD 308
           Q++  I ++ N P PI D
Sbjct: 311 QVVYHICSIMNLPVPIED 328

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  303 bits (777), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 211/324 (65%), Gaps = 24/324 (7%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI-----------SP--PDPHTNSNV 52
           +  Y  G  + VGSH+VEI++Y+  GGFAQ+YS              SP   D     ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGS--------YE 104
           ACLKRVIV D+  LN LR EV+ MK L     +V Y DS+A++  L NG+        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V +LME C    L+D+MN RL  +L E EIL++M  V+  +A MH L+ PLIHRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           VL+  KN +KLCDFGS           ++++Y+ Q++  +TT QYRSPEM+D++R LPID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPS 284
           EKSDIWALGIFLYKL ++TTPFE+ G+ AIL+ +FEF P  NYS +L NLI  +L +NP+
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEF-PQNNYSFKLINLIIVMLSENPN 311

Query: 285 QRPNVFQLLKQITNMQNAPYPIRD 308
            RPN++Q+L QI  ++  P PI D
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIAD 335

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  306 bits (783), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 212/324 (65%), Gaps = 26/324 (8%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTN---------------- 49
           I  ++ G  + VGSH VEI+KYLT GGFAQ+Y   ++    + N                
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTE---YLNEFDAIDIQNQRQQQEL 82

Query: 50  --SNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFV 107
              ++ CLKRV+V D+  L+ ++ EV+ MK LR    VV Y DS+A +    NG +EVF+
Sbjct: 83  KIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFL 142

Query: 108 LMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLI 167
           LMEYC    L+D+MN RL  +L ESEIL IM  +T GV+ +H L  PLIHRDIKIENVL+
Sbjct: 143 LMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLV 202

Query: 168 SAKNEYKLCDFGSVCGVIRPP--RNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDE 225
              N +KLCDFGS    I PP     Q++S +  D+  +TT QYRSPEM+D+FR LP++E
Sbjct: 203 DHNNRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNE 260

Query: 226 KSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQ 285
           K+DIWALG+FLYKL +YTTPFE  G+ AIL+ ++E +P  +YSE+L NLI  +L +NP+ 
Sbjct: 261 KADIWALGVFLYKLLFYTTPFELTGQFAILHSKYE-IPQSHYSERLLNLIVVMLAENPNL 319

Query: 286 RPNVFQLLKQITNMQNAPYPIRDV 309
           RPN++Q+L +I ++ N   PI D+
Sbjct: 320 RPNIYQVLSEICSILNVEVPIPDI 343

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  304 bits (779), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 211/318 (66%), Gaps = 15/318 (4%)

Query: 3   QPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LISPPDPHTNS---------NV 52
           +P    Y  GTQ+ VG+H+VEIIKY+  GGFAQ+Y+   I   +   N+         +V
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG--SYEVFVLME 110
           ACLKRV+V D+  LN +R EV+ MK L+    +V Y DS+A++   HNG   +EV +LME
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLME 133

Query: 111 YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            C    L+D+MN RL  +L E EIL+IM  VT  V+ MH L  PL+HRDIKIENVL+ A+
Sbjct: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193

Query: 171 NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIW 230
           N +KLCDFGS           Q+++ + Q++  +TT QYRSPEM+D++R LPIDEKSDIW
Sbjct: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253

Query: 231 ALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVF 290
           ALGIFLYKL ++TTPFE  G+ AIL+ ++EF P  NYS +L NLI  +L +NP+ RPN++
Sbjct: 254 ALGIFLYKLLFFTTPFELTGQFAILHSKYEF-PKNNYSSKLINLIIIMLAENPNLRPNIY 312

Query: 291 QLLKQITNMQNAPYPIRD 308
           Q+L  I ++     PI D
Sbjct: 313 QVLHNICSISGMKVPIED 330

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  303 bits (777), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 207/316 (65%), Gaps = 15/316 (4%)

Query: 7   GTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA--------LISPPDPHTN------SNV 52
           G Y  GT + VGSH+VE+IKY+  GGFAQ+Y+           S P  + N       ++
Sbjct: 97  GNYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDI 156

Query: 53  ACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYC 112
           ACLKRV+V D   LN +R EV+ M+ L+    VV Y DS+A+  +     YEV +LME+C
Sbjct: 157 ACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFC 216

Query: 113 ERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE 172
               L+D+MN RL  RL E EI++IM   T G+A +H L+ PLIHRDIKIENVL+  +N 
Sbjct: 217 PNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENN 276

Query: 173 YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWAL 232
           +KLCDFGS         N ++++   Q++  NTT QYRSPEM+D++R  PIDEKSDIWAL
Sbjct: 277 FKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWAL 336

Query: 233 GIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           G+FLYKL ++TTPFE+ G+ AIL+ ++EF P  NYS +L NLI  +L +NPS RPN++Q+
Sbjct: 337 GVFLYKLLFFTTPFERTGQFAILHSKYEF-PKNNYSSKLINLIIIMLAENPSVRPNIYQV 395

Query: 293 LKQITNMQNAPYPIRD 308
           L+ + ++     P+ D
Sbjct: 396 LQYLCSINGWKVPLND 411

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  301 bits (772), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 201/307 (65%), Gaps = 11/307 (3%)

Query: 12  GTQLTVGSHQVEIIKYLTSGGFAQVYSALI---SPPDPHTNSNV-------ACLKRVIVP 61
           G+ + VG+ +VEI+KYLT GGFAQ+Y       S      NSN+       ACLKRV+V 
Sbjct: 28  GSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRVLVQ 87

Query: 62  DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFM 121
           D+  LN +R EV+ MKLL+    +V Y DS+A++       +EV +LME C    L+DFM
Sbjct: 88  DENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLLDFM 147

Query: 122 NTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSV 181
           N RL  +L E EIL IM  VT  VA MH L PPLIHRDIKIENVL+ ++N +KL DFGS 
Sbjct: 148 NQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADFGST 207

Query: 182 CGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCY 241
                     Q+++ + QD+  +TT QYRSPEM+D+++ LPIDEKSDIWALGIFLYKL +
Sbjct: 208 SKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYKLLF 267

Query: 242 YTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQN 301
           Y TPFE  G+ AIL+ +++F P  NYS +L NLI  +L +NP+ RPN++Q+L +I ++  
Sbjct: 268 YITPFEMTGQFAILHSKYDF-PQTNYSSRLINLIIIMLSENPNLRPNIYQVLHEICSISG 326

Query: 302 APYPIRD 308
               I D
Sbjct: 327 TRLEITD 333

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  297 bits (761), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 199/314 (63%), Gaps = 10/314 (3%)

Query: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSNVAC 54
           P +     G+Q+ VG+H+VEI+KYL  GGFA +Y             +P         AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV  MK L     +V Y DSHA+++      +EV +LME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
             L+D+MN RL  +L E EIL+IM  VT+ +A MH L  PLIHRD+KIENVL+   N +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGI 234
           LCDFGS    +      QE++ +  ++  +TT QYRSPEM+D++R LPIDEKSDIWALGI
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
           FLYKL +YTTPFE  G+ AIL+ ++EF P  NYS +L NLI  +L +NP+ RPN++Q++ 
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEF-PINNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 QITNMQNAPYPIRD 308
            + ++     PI D
Sbjct: 323 NLCSIMKVENPIED 336

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  297 bits (761), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 204/317 (64%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSN 51
           M  P +  Y  G  + VG+H+VEI+ YL  GGFAQ+Y+            +   P    +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN 171
           C    L+D+MN RL  +L ESEI++IM  V   ++ MH L  PLIHRDIKIENVL+ A+N
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q++  +TT QYRSPEM+D++R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
           LGIFLYKL ++TTPFE  G+ AIL+ ++EF P   YS +L NLI  +L +NP+ RPN++Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKQITNMQNAPYPIRD 308
           +L  I ++ NA  PI D
Sbjct: 313 VLYHICDILNAEVPIED 329

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  294 bits (753), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 201/314 (64%), Gaps = 10/314 (3%)

Query: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSNVAC 54
           P +     G+Q+ VG+H+VEI+KYL  GGFA +Y              P       ++AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV  MK L     +V Y DSHA++A   +  +EV +LME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
             L+D+MN RL  +L E EIL+IM  VT+ +A MH L  PLIHRD+KIENVL+ A + +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGI 234
           LCDFGS           QE++ +  ++  +TT QYRSPEM+D++R LPI+EKSDIWALGI
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
           FLYKL +YTTPFE  G+ AIL+ ++EF P  NYS +L NLI  +L +NP+ RPN++Q++ 
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEF-PVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 295 QITNMQNAPYPIRD 308
            + ++     P+ D
Sbjct: 365 NLCSILKVKNPLED 378

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  296 bits (759), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 203/317 (64%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSN 51
           + +P +  Y  GT + VG+ QVEII ++  GGFAQ+YS                P    +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  VACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEY 111
           +ACLKRV+VPD+  L+ +R EV+ MK LR  + ++ Y DS+A++ T     YEV +LME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN 171
           C    L+D+MN RL  RL E EIL++M   T  ++ MH L  PLIHRDIKIENVL+ A+N
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWA 231
            +KLCDFGS           Q+++ + Q++  NTT QYRSPEM+D++R LPI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
           LGIFLYKL ++ TPFE  G+ +IL+ ++EF P   YS +L NLI  +L +NP  RPN++Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEF-PANKYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 LLKQITNMQNAPYPIRD 308
           ++  I ++     PI D
Sbjct: 313 VMHHICSVIGCEVPIED 329

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  292 bits (748), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 146/306 (47%), Positives = 202/306 (66%), Gaps = 9/306 (2%)

Query: 11  VGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LISPPDPHTN----SNVACLKRVIVPD 62
            G+ L VG H+VEII+YL  GGFA +Y        +  D H +     ++ACLKRV V D
Sbjct: 30  AGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVND 89

Query: 63  KTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMN 122
           +  LN LR EV+ MK L+    VV Y DS+A++ T     +EV +LME C  G L+D+MN
Sbjct: 90  ENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMN 149

Query: 123 TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVC 182
            RL  +L E E+L+IM  +T+G++ MH L+ PLIHRDIKIENVL+ + N +KLCDFGS  
Sbjct: 150 QRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTS 209

Query: 183 GVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYY 242
             +      QE++ +  ++  +TT QYRSPEM+D++R L I+EKSDIWALGIFLYKL +Y
Sbjct: 210 TCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFY 269

Query: 243 TTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNA 302
           TTPFE  G+ AIL+ +++ +P  N+S +L NLI  +L +NP  RPN++Q+L  I ++   
Sbjct: 270 TTPFELTGQFAILHSKYD-IPQNNFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMEC 328

Query: 303 PYPIRD 308
             PI D
Sbjct: 329 DVPIED 334

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  292 bits (748), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 205/321 (63%), Gaps = 18/321 (5%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LISPPDPHTNS----------- 50
           I  +  G  L VG+H+VEI+ YLT GGFAQ+Y      +++  D   N            
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 51  --NVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVL 108
             +VACLKRV+V D+  LN +R EV+ MK LR    +V Y DS+A ++   N  YEV +L
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLIS 168
           ME C    L+++MN RL  +L E E+L+IM  VT GVA MH L+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 AKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSD 228
           + N +KLCDFGS           Q+++ + Q+V  +TT QYRSPEM+D++R LPI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPN 288
           IWALG+FLYKL +YTTPFE  G+ A+L+ +F+ +P   YS ++ NL+  +L +N + RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFD-IPANKYSSKIINLVIIMLSENLNLRPN 326

Query: 289 VFQLLKQITNMQNAPYPIRDV 309
           ++Q++  I  +     PI D+
Sbjct: 327 IYQVMHYICQLIQVDTPILDI 347

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  293 bits (749), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 208/321 (64%), Gaps = 19/321 (5%)

Query: 3   QPQIG-TYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI-------------SPPDPHT 48
           QPQI   +  G  +TVGSH+VE++ YL  GGFAQ+Y                 S   P  
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 49  NSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGS----YE 104
             + ACLKRV+V D+  LN +R+EV+ MK L+    +V Y DS+A++   ++G+    +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V +LME C    L+D+MN RL  +L E EI +IM  +T  VA MH L  PLIHRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           VL+ A N +KLCDFGS         + Q+++ + QD+  +TT QYRSPEM+D+F+ +PI+
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPS 284
           EKSDIWALG+FLYKL ++TTPFE+ G+ A+L+ +FEF P  +YS +L NLI  +L +NPS
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPS 387

Query: 285 QRPNVFQLLKQITNMQNAPYP 305
            RPN++Q+L  ++ + N   P
Sbjct: 388 LRPNIYQVLYYLSEVTNREVP 408

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  293 bits (749), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/335 (46%), Positives = 209/335 (62%), Gaps = 35/335 (10%)

Query: 2   NQP-QIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LISPPDPHTN---------- 49
           N+P  I  Y  GT LTVG  ++EI+KYLT GGFAQ+Y+   I   +   N          
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 50  ----SNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG---- 101
                +VACLKRV+VPD+  L+ +R EVD MK L N   +V Y DS+A+K   ++     
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTT 151

Query: 102 -----------SYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
                       +E+ +LMEYC    L+DFMN RL  +L E+EIL+ M  +T  V  MH 
Sbjct: 152 NNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHY 211

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYR 210
           L  PLIHRDIKIENVL+ + N +KL DFGS   +  P    Q+++ + +D+  NTT QYR
Sbjct: 212 LAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYR 271

Query: 211 SPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQ 270
           SPEM+D+++ LPIDEKSDIWALG+ LYKL +YTTPFE  G+ AIL+ ++EF P  NYS +
Sbjct: 272 SPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEF-PANNYSSK 330

Query: 271 LRNLICKLLVQNPSQRPNVFQL---LKQITNMQNA 302
             NLI  +L +NP+ RPN+FQ+   LK I+N  N+
Sbjct: 331 FINLIIIMLAENPNLRPNIFQVLYYLKSISNTMNS 365

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  286 bits (733), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 165/384 (42%), Positives = 232/384 (60%), Gaps = 37/384 (9%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA---------------LISPPDPHTNS 50
           I TY  G  + VG H+VEIIKYL  GGFA++Y A               ++ P D     
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGD----- 150

Query: 51  NVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLME 110
            + CLKRV+V D   LN +R EV  MK L     +V   DS+A++ T     YEV +LME
Sbjct: 151 -LICLKRVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLME 209

Query: 111 YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            C    L+D+MN RL  +L E EIL+IM  VT  VA MH L  PLIHRDIKIENVL+ ++
Sbjct: 210 LCSNKSLLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQ 269

Query: 171 NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIW 230
           N +KLCDFGS    +      ++++ + Q++  +TT QYRSPEM+D++R + I+EKSDIW
Sbjct: 270 NNFKLCDFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIW 329

Query: 231 ALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVF 290
           ALGIFLYKL +Y TPFE+ G+ AIL+ ++EF P  +YS +L NLI  +L +NP+ RPN++
Sbjct: 330 ALGIFLYKLLFYITPFERTGQFAILHSKYEF-PQHSYSMKLINLIIIMLAENPNLRPNIY 388

Query: 291 QLLKQITNMQNAPYPIRDVQTV-----QRPSNHLNLMELHQNSATQ-NIQSLNSHSI--- 341
           Q+L  I  + N   PI D+  +     Q+ +N+   ++  QN   Q  I+S+ +  I   
Sbjct: 389 QVLAYICKIINIKTPIDDIYGLGPYDFQKYTNYQTALQNSQNQMYQVQIRSMQNRGILTL 448

Query: 342 -NE---NSMSNQNFQF--RMPANV 359
            +E   NS+  Q+F+   ++P NV
Sbjct: 449 KDEALMNSLFIQSFEVGPKIPTNV 472

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  287 bits (735), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 202/307 (65%), Gaps = 11/307 (3%)

Query: 12  GTQLTVGSHQVEIIKYLTSGGFAQVYSA----LISPPDPHTNS------NVACLKRVIVP 61
            TQ+ VG+H+ EI+++L  GGFA +Y      L +  D   +S      ++ACLKRVIVP
Sbjct: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91

Query: 62  DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFM 121
           D+  LN LR EV+ MK LR +  +V Y DS+A++    +  +E+ +LME C +  L+D+M
Sbjct: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151

Query: 122 NTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSV 181
           N +L  +L E+EIL+IM  V+  +A MH L  PLIHRDIKIENVL+   + +KLCDFGS 
Sbjct: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211

Query: 182 CGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCY 241
                     Q+++ +  ++  +TT QYRSPEM+D++R LPI+EKSDIWALGIFLYKL +
Sbjct: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271

Query: 242 YTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQN 301
           YTTPFE  G+ AIL+ ++E +P   YS +L NLI  +L +NPS RPN++Q++  + ++  
Sbjct: 272 YTTPFELTGQFAILHSKYE-IPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330

Query: 302 APYPIRD 308
              P  D
Sbjct: 331 CDVPFTD 337

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  291 bits (744), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 202/317 (63%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSN 51
           M  P +  Y  G  + VG+H+VEI+ YL  GGFAQ+Y             +   P    +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++       +EV +LME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN 171
           C    L+D+MN RL  +L E+EI++IM  V   ++ MH L  PLIHRDIKIENVL+ AK+
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q++  +TT QYRSPEM+D++R LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
           LGIFLYKL ++TTPFE  G+ AIL+ ++EF P   YS +L NLI  +L +NP+ RPN++Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKQITNMQNAPYPIRD 308
           +L  + ++ N   PI D
Sbjct: 313 VLCHLCDILNVEVPIED 329

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  290 bits (743), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 147/320 (45%), Positives = 201/320 (62%), Gaps = 10/320 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSN 51
           M  P +  +  G  + VG+H+VE+I YL  GGFAQ+Y             +   P    +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN 171
           C    L+D+MN RL  +L ESEI++IM  V   ++ MH L  PLIHRDIKIENVL+ A N
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q++  +TT QYRSPEM+D++R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
           LGIFLYKL ++TTPFE  G+ AIL+ ++EF P   YS +L NLI  +L +NP+ RPN++Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKQITNMQNAPYPIRDVQT 311
           +L  +  + N   PI D  T
Sbjct: 313 VLYHLCEILNIEVPIEDKYT 332

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  289 bits (739), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 198/314 (63%), Gaps = 10/314 (3%)

Query: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSNVAC 54
           P +  +  G  + VG+H+VE++ YL  GGFAQ+Y                 P    +VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCER 114
           LKRV+V D+  L+ +R EV+ MK L   + +V Y DS+A +    N  +EV +LME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
             L+D+MN RL  +L E EIL+IM  V+  V+ MH L+ PLIHRDIKIENVL+ A+N +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGI 234
           LCDFGS           QE++ + Q++  +TT QYR PEM+D++R LPI+EKSDIWALGI
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
           FLYKL ++ TPFE  G+ AIL+ ++EF P  +YS QL NLI  +L +NP  RPN++Q+L 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 QITNMQNAPYPIRD 308
            I  M     PI D
Sbjct: 316 HICTMIGVEVPIED 329

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  287 bits (735), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (63%), Gaps = 21/313 (6%)

Query: 11  VGTQLTVGSHQVEIIKYLTSGGFAQVYSA--------------LISPPDPHTNSNVACLK 56
            G+ + VG HQVE+I+YL  GGFA +Y                ++ P D        CLK
Sbjct: 31  AGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGD------TVCLK 84

Query: 57  RVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGG 116
           RV V D+  LN LR EV+ MK LRN   +V Y DS+A++       YEV +LME C  G 
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 117 LIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLC 176
           L+D+MN RL  +L E+E+L+IM  +T G++ MH  + PLIHRDIKIENVL+ A N +KLC
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 177 DFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFL 236
           DFGS    +    + QE++ +  ++  +TT QYRSPEM+D++R LPI+EKSDIWALGIFL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 237 YKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
           YKL +YTTPFE  G+ AIL+ ++E +P  ++S +L NL+  +L +NP  RPNV+Q++  I
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYE-IPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323

Query: 297 TNMQNAPYPIRDV 309
            +M      I D+
Sbjct: 324 CSMMECEVKIDDL 336

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  288 bits (737), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 200/317 (63%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------SPPDPHTNSN 51
           M  P +  Y  G  + VG+H+VE++ YL  GGFAQ+Y             +   P    +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+    +V Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN 171
           C    L+D+MN RL  +L E+EI++IM  V   ++ MH L   LIHRDIKIENVL+ AKN
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q++  +TT QYRSPEM+D++R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
           LG+FLYKL ++TTPFE  G+ AIL+ ++EF P   YS +L NLI  +L +NP+ RPN++Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKQITNMQNAPYPIRD 308
           +L  +  + N   PI D
Sbjct: 313 VLYHLCEILNVEVPIED 329

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  282 bits (721), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 137/314 (43%), Positives = 203/314 (64%), Gaps = 12/314 (3%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LISPPDPHTN----------SNVAC 54
           I  Y  G  ++VG+HQV+I  YL  GGFAQ+Y    I   +   N           ++AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV+ MKLL+    +V Y DS+A +       YE+ +LME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
             L+D+MN RL+ +L+E+EI++IM   T  V+ MH L  PLIH+DIK+EN+L+ + N +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGI 234
           LCDFGS         +  +++ + Q++  +TT QYRSPEM+D++R LPI+E SDIWALG+
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
           FLYKL ++ TPFE+ G+ +IL+ +F+ +P  NY  +L NLI  +L +N + RPN++Q++ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFD-IPVNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 QITNMQNAPYPIRD 308
           +I ++ N P PI D
Sbjct: 331 EICSITNTPLPIED 344

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 85/354 (24%), Positives = 154/354 (43%), Gaps = 72/354 (20%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVP--DKTSLNTLR 70
           + + +      I + L  GGF+ VY           N+++  LK++  P  +  S++   
Sbjct: 19  SSVLINGQHYAIQRLLGEGGFSFVYLV-----QSRENNDLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQN--R 128
            EV++ K  R+  Y+   + S   +    +GS  VF+L+ Y   G L+D +NT L +   
Sbjct: 74  REVNSYKKFRS-PYITHCVSSQVLQE--QDGSKTVFILLPYFPTGSLLDKINTHLLDGTT 130

Query: 129 LHESEILQIMCQVTQGVAAMH-------------ALQPPLIHRD---------------- 159
           + E EI++I+  V +G+  MH             ++   L +RD                
Sbjct: 131 ISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDS 190

Query: 160 ------------------------IKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELS 195
                                   IK  N++ S+     +CD GS         +  +L 
Sbjct: 191 LELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLV 250

Query: 196 YVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP--- 252
             ++   ++ T  +RSPE++++     IDEK DIW+LG  LY +C+  +PFE+  +    
Sbjct: 251 EFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGA 310

Query: 253 ----AILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNA 302
               AI  G+F   P  NYS +L  +I   +  +  +RP++ +LL ++ ++Q +
Sbjct: 311 SMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQGS 364

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 146/305 (47%), Gaps = 49/305 (16%)

Query: 5   QIGTYNVGTQLTVGS-HQVEIIKYLTSGGFA--QVYSALISPPDPHTNSNVACLKRVIVP 61
           QIG++ +G  L +GS  +V++    T+G  A  +V S  I       +SNV  +     P
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI-----FQDSNVTSMVDNTTP 68

Query: 62  DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  MKLL N+  V+   D     + L       ++++EY E+G L + +
Sbjct: 69  DALPYGIER-EIVIMKLL-NHANVLRLYDVWETNSNL-------YMVLEYAEKGELFNLL 119

Query: 122 NTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSV 181
             R    L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG  
Sbjct: 120 VER--GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDTKYNIKIADFG-- 173

Query: 182 CGVIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFL 236
                       ++ +E +D L  T+     Y +PE+V    G+P     SD+W+ G+ L
Sbjct: 174 ------------MAALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVIL 218

Query: 237 YKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVF 290
           Y L     PF  E G    +L     GQFE       S++ +NLI K+LV NP++R    
Sbjct: 219 YALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITAR 278

Query: 291 QLLKQ 295
            +LK 
Sbjct: 279 DILKH 283

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/337 (25%), Positives = 145/337 (43%), Gaps = 63/337 (18%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVD 74
           +++   +  I K L  GG + VY  L+   +      +  LK+   P      ++ +   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVY--LVESKE----GELFALKKTRCP----FGSIGSISP 68

Query: 75  AMKLLRNNR-----YVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQN-- 127
           AMK + N +     Y+   +DS   +    +GS  V+VL+ Y  +G L D +N  L +  
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLHESEILQIMCQVTQGVAAMHALQP---------------------------------- 153
           ++ E +IL++   + +G+  +H   P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 154 -PLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNP-QELSYVEQDVLKNTTAQYRS 211
               HRD+K  N++IS ++   + D GS C   R   N  Q L   ++    N T  Y +
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAA 245

Query: 212 PEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AILNGQFEFLPY 264
           PE++D+     I EK DIW+ G  +Y +C+  +PFE+  +        AI  G++     
Sbjct: 246 PEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRG 305

Query: 265 PNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQN 301
            +YS  L  LI K L  NP QRP+V +L+  +  +Q 
Sbjct: 306 TSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 118/240 (49%), Gaps = 38/240 (15%)

Query: 68  TLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQN 127
           T+  E++  KL+  ++ ++S ID     AT+       ++++E C  G L D +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFEIDATM-------YMVLELCGAGSLYDII-CRSKR 146

Query: 128 RLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRP 187
            L E E  ++M Q+   V  +H  +  ++H D+K+ N+LI + N  +LCDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 188 PRNPQELSYVEQDVLKNT-----TAQYRSPEMVDIF-----RGLPIDEKSDIWALGIFLY 237
                  S+V  D+  N+     T  Y SPE++  F     + L   ++SDIW++GI LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 238 KLCYYTTPFE----KGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
            + +  TPFE    +     I+  ++ F+     S +++ LI  +L   P +R  + +++
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 135/297 (45%), Gaps = 72/297 (24%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVP--DKTSLNTLRAEVD 74
           VG+++  I+K +  G F +VY AL  P            K+V++   DKT  N +R    
Sbjct: 36  VGNYK--ILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNVVR---- 79

Query: 75  AMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEI 134
             ++  + ++   YI              +V++++EYC    L D++ ++ +  L ES  
Sbjct: 80  --EIFYHRQFDFPYITKLYEVIITET---KVWMVIEYCPNKELYDYLLSKKRISLDES-- 132

Query: 135 LQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQEL 194
            +I  Q+   V   H+L    +HRD+K+EN+L+   N  KL DFG               
Sbjct: 133 ARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFG--------------- 175

Query: 195 SYVEQDVLKNT-------TAQYRSPEMV--DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
               +D  KNT       T  Y +PE++  + + G  I    DIWALGI LY +   T P
Sbjct: 176 --FTRDFSKNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIINGTMP 229

Query: 246 FE----KGGEPAILNGQFEFLPYPNYSEQLRN-----LICKLLVQNPSQRPNVFQLL 293
           F+    K  E  I++        P+Y  +  N     L+ +LL ++PS RP + Q+L
Sbjct: 230 FDEDDPKKTELKIISAS------PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 133/280 (47%), Gaps = 33/280 (11%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKL 78
           S Q  + + +  G +  VY A+    + HT+  VA +K ++  +   LN + AE+  +K 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYENDEELNDIMAEISLLKN 76

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIM 138
           L N+  +V Y   H         SYE+++L+EYC  G L   + +R    L E+E    +
Sbjct: 77  L-NHHNIVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYV 127

Query: 139 CQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVE 198
            Q   G+  +H     +IHRDIK  N+L+SA N  KL DFG V  ++    N   L+   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLA- 179

Query: 199 QDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQ 258
                  T  + +PE++   RG      SDIW+LG  + ++     P+    +  I    
Sbjct: 180 ------GTLNWMAPEILGN-RG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFLPYP--NYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
                YP  ++SE L++ + K  V+N  +RP   QLLK +
Sbjct: 231 ENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 133/280 (47%), Gaps = 33/280 (11%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKL 78
           S Q  + + +  G +  VY A+    + HT+  VA +K V+  +   LN + AE+  +K 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEVVYENDEELNDIMAEISLLKN 76

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIM 138
           L +N  +V Y   H         SYE+++L+EYC  G L   + +R    L E+E    +
Sbjct: 77  LNHNN-IVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYV 127

Query: 139 CQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVE 198
            Q   G+  +H     +IHRDIK  N+L+SA N  KL DFG V  ++    N   L+   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLA- 179

Query: 199 QDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQ 258
                  T  + +PE++   RG      SDIW+LG  + ++     P+    +  I    
Sbjct: 180 ------GTLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFLPYP--NYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
                YP  ++SE L++ + K  V+N  +RP   QLLK +
Sbjct: 231 ENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 149/333 (44%), Gaps = 55/333 (16%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKT--SLNTLRAE 72
           ++V  H+  I + L  GGF+ VY       +   N  +A LK++  P  +  S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLV-----ESRENGLMA-LKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQN--RLH 130
           VD  +  ++  Y+   IDS   +    +GS  V++L+ Y  +G L D +N  L +  ++ 
Sbjct: 73  VDNYQKFKSP-YIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 ESEILQIMCQVTQGVAAMHALQPP-----------------------------------L 155
           E E++++   V +G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV 215
            H DIK  N++IS++    + D GS         + Q L   ++   ++ T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AILNGQFEFLPYPNYS 268
           D+     I EK D+W+ G  +Y +C+  +PFE+  +        ++  G++      NYS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 EQLRNLICKLLVQNPSQRPNVFQLLKQITNMQN 301
             L +++ K L  +P  RP+V +L+  + ++Q+
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 93.6 bits (231), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 115/234 (49%), Gaps = 29/234 (12%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E +    Q+ QGV+  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 164 NVLISAKNEY-KLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRG 220
           N+L+  KN+  K+ DFG     +  P    E S          +  Y SPE+V    + G
Sbjct: 256 NLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 305

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLIC 276
            P    SD+W+ GI L+ L     PF       +L     G+F+  PY   +   ++LI 
Sbjct: 306 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLIT 359

Query: 277 KLLVQNPSQRPNVFQLLKQ--ITNMQNAPYPIRDVQTVQRPSNHLNLMELHQNS 328
           ++LV NP +R  + ++L    I   +N P  IR +  + R  ++ +L  L  N+
Sbjct: 360 RILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEYNT 413

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 136/288 (47%), Gaps = 35/288 (12%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKL 78
           S Q  + + +  G +  VY A+    + HT+  VA +K ++      LN + AE+  +K 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYESDEELNDIMAEISLLKN 76

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIM 138
           L N+  +V Y   H         SYE+++L+EYC  G L   + +R    L E+E    +
Sbjct: 77  L-NHDNIVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYV 127

Query: 139 CQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVE 198
            Q   G+  +H     +IHRDIK  N+L+SA N  KL DFG V  ++    N   L+   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLA- 179

Query: 199 QDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQ 258
                  T  + +PE++   RG      SDIW+LG  + ++     P+    +  I    
Sbjct: 180 ------GTLNWMAPEILGN-RG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFLPYP--NYSEQLRNLICKLLVQNPSQRPNVFQLLKQ--ITNMQNA 302
                YP  ++SE L++ + K  V+N  +RP   QLLK   IT+ +N 
Sbjct: 231 ENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 100/207 (48%), Gaps = 47/207 (22%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L +++   +Q+R+   E  ++  Q+   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISAKNEYKLCDFG------------SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRS 211
           N+L+  K   K+ DFG            +VCG                      T  Y +
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMVD--IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPN--- 266
           PE+++   + G  I    DIW+LG+ LY + + T PF++  E           P+ N   
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDV 251

Query: 267 YSEQLRNLICKLLVQNPSQRPNVFQLL 293
            S+  ++LI +LL ++PSQRP + Q+L
Sbjct: 252 VSKDAKDLISQLLCKDPSQRPQLSQVL 278

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 157/365 (43%), Gaps = 73/365 (20%)

Query: 7   GTYN-VGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LISPPDPHTNSNVA---------CL 55
            TYN   T + VGS +  + K +  G FA V+ A LI+P  PH + +V          C 
Sbjct: 22  NTYNNERTTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCF 81

Query: 56  KRVIVP-----DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLME 110
              IVP     +K  L  L  E+  +K + ++ ++V  ID           S + +++ME
Sbjct: 82  AIKIVPRSKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIME 133

Query: 111 YCERGGLIDFMNTRLQ----------------------NRLHESEILQIMCQVTQGVAAM 148
           YC  G L   +  R Q                      N LH++ IL  + Q++  +  +
Sbjct: 134 YCSLGDLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFL 193

Query: 149 HALQPPLIHRDIKIENVLISA-----KNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLK 203
            +    L+HRDIK +N+L+SA      +     D G V     P     +  +     L 
Sbjct: 194 RSKN--LVHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLP 249

Query: 204 NTTAQ--------YRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAI- 254
           NT+          Y +PE+++  +    + K+D+W++G  LY++CY   PF+      + 
Sbjct: 250 NTSMAETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELY 306

Query: 255 --LNGQFEFLPYPNYSE---QLRNLICKLLVQNPSQRPNVFQLL-KQITNMQNAPYPIRD 308
             +    + + +P Y E    L++LI KLL  +P +R    +    ++ N   +PY  RD
Sbjct: 307 KKIKKANDLIYFPTYIEIDNNLKSLISKLLTFDPQERIEFDEFFNNELVNADLSPYETRD 366

Query: 309 VQTVQ 313
              +Q
Sbjct: 367 NDDIQ 371

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 151/321 (47%), Gaps = 47/321 (14%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVY---SALISPPDPHTNSNVACLKRVIVP 61
           IG + +G  L +GS  +V++ +  ++G  A V     A+ +  +    S V      I P
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGS----ITP 71

Query: 62  DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  MKLL N+  V+   D       +   + ++++++EY E+G L + +
Sbjct: 72  DALPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLL 122

Query: 122 NTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSV 181
             R    L E+E ++   Q+  GV+  HAL   ++HRD+K EN+L+  K   K+ DFG  
Sbjct: 123 VER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA 178

Query: 182 CGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMVDIFRGLPIDE-KSDIWALGIFLYK 238
                           E  +L+ +  +  Y +PE+V    G+P     SD+W+ G+ L+ 
Sbjct: 179 A------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 LCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           L     PF  E G    +L     GQFE       S + ++LICK+L  +P +R     +
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDI 283

Query: 293 LKQITNMQNAPYPIRDVQTVQ 313
           LK    +Q  P  IRD ++++
Sbjct: 284 LKHPL-LQKYP-SIRDSKSIR 302

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 93/330 (28%), Positives = 155/330 (46%), Gaps = 49/330 (14%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS 65
           +G + +G  L +GS     + Y +S G  Q    +IS    + ++  A    ++ PD   
Sbjct: 17  VGPWKLGETLGLGSTGKVQLAYNSSTG-QQAAIKVISKAVFNNDNANASDSALLTPDSLP 75

Query: 66  LNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRL 125
               R E+  MKLL N+  V+   D     + L       ++++EY E+G L + +  R 
Sbjct: 76  YGIER-EIIIMKLL-NHPNVLRLYDVWETDSNL-------YMVLEYAEKGELFNLLVER- 125

Query: 126 QNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVI 185
              L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG      
Sbjct: 126 -GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFG------ 176

Query: 186 RPPRNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKLC 240
                   ++ +E +D L  T+     Y +PE   I  GLP    ++D+W+ GI L+ L 
Sbjct: 177 --------MAALETEDKLLETSCGSPHYAAPE---IISGLPYHGLETDVWSCGIILFALL 225

Query: 241 YYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
               PF  E G    +L    +GQFE       S + ++LI K+L  +P +R    ++LK
Sbjct: 226 TGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

Query: 295 QITNMQNAPYP-IRDVQTVQ---RPSNHLN 320
                +   YP I+D +T++   R   +LN
Sbjct: 286 HPLVQK---YPSIKDSKTIRNLPREDTYLN 312

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 134/303 (44%), Gaps = 58/303 (19%)

Query: 55  LKRVIVP--DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYC 112
           LKR+  P  +  S++    EVD  K  ++  Y+++ +DS   +    +GS  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQSP-YIITLVDSQVVQE--KDGSKTLCILLPYF 129

Query: 113 ERGGLIDFMNTRL--QNRLHESEILQIMCQVTQGVAAMH--------------------- 149
             G L D +N  L     + E+E ++IM  + +G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 -------ALQPPL----------------IHRDIKIENVLISAKNEYKLCDFGSVCGVIR 186
                      PL                +HRDI++ N+L S++    + D GS C    
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 PPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
                 +L+ ++  V  N +  Y +PE++++     ID K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EKGGEP-------AILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
           E+  +        AI  G++ F     YSE L  +I   L  +P+ RP++ +LL  + ++
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 300 QNA 302
           Q +
Sbjct: 370 QTS 372

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 131/277 (47%), Gaps = 32/277 (11%)

Query: 24  IIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLR--AEVDAMKLLRN 81
           I K +  G F  V+ A+      +    V  +K +I  D +   T     E+  M LL++
Sbjct: 18  IDKCVGKGNFGDVFKAM-----NNVTKEVVAIK-IINLDDSEEETFEIIKEMRLMSLLKS 71

Query: 82  NRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQV 141
             Y+  YI       T  N  Y ++++MEYC  G   D + T  +  L E+++  ++  V
Sbjct: 72  -PYIARYI-------TTINEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSV 123

Query: 142 TQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDV 201
             G+  +HA     IHRDIK  N+L++     K+ DFG V   +R     +  ++V    
Sbjct: 124 LLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRSTMKAK--TFV---- 174

Query: 202 LKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEF 261
               T  + +PE+V +  G+  +EKSDIW+LGI  Y+L     P  K     ++    + 
Sbjct: 175 ---GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKR 230

Query: 262 LP---YPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
            P   +  Y+  +++ I   L+++P +RP+  +LL+ 
Sbjct: 231 KPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEH 267

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/347 (24%), Positives = 149/347 (42%), Gaps = 61/347 (17%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVAC-----LKRVIVPDKTSLN 67
           T + V   + +I + L  GG + VY   +        + VA      LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRL-- 125
               E++  K  ++  YV+  IDS   +    +GS  +++++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLHESEILQIMCQVTQGVAAMHA---------------------------------LQ 152
              + E+E ++IM  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDV 201
             ++           HRDI   N+L S+     + D GS         N  +L  +++ V
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AI 254
             N T  Y +PE++ +     +D K DIW+LG   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQN 301
             G++ F     +SE L ++I K +  +P QRP   QLL  + ++++
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLES 364

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 93/343 (27%), Positives = 160/343 (46%), Gaps = 45/343 (13%)

Query: 5   QIGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDK 63
           +IG + +G+ L  GS  +V + ++ T+G  A V     S       +N + +     PD 
Sbjct: 22  KIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSNDPDL 81

Query: 64  TSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNT 123
                 R E+  MKLL N+  V+   D    K+ L       ++++EY E+G L + +  
Sbjct: 82  LPYGIER-EIIIMKLL-NHTNVLRLYDVWETKSNL-------YMVLEYVEKGELFNLLVE 132

Query: 124 RLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCG 183
           R    L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG    
Sbjct: 133 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA- 187

Query: 184 VIRPPRNPQELSYVEQDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKL 239
                          +D L  T+     Y +PE+V    GLP    +SD+W+ G+ LY L
Sbjct: 188 ------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYAL 232

Query: 240 CYYTTPFEK--GGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                PF++  G   ++L    +G++E       S + ++LI K+L  +P +R    ++L
Sbjct: 233 LTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREIL 292

Query: 294 KQITNMQNAPYPIRDVQTVQ---RPSNHLNLMELHQNSATQNI 333
           K    +Q  P  I+D ++++   R   +LN ++    S    I
Sbjct: 293 KHPL-LQKYPS-IKDSKSIRNLPREDTYLNPLDHGDGSIDDGI 333

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 100/382 (26%), Positives = 175/382 (45%), Gaps = 77/382 (20%)

Query: 2   NQPQIGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           N+  +G + +G  L  GS  +V + K + +G  A +    I P            KR + 
Sbjct: 57  NRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIK---IVP------------KRNVR 101

Query: 61  PDKTSLNTL----RAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGG 116
            + T L +L      E+  MKL+ +   +  Y         +     E+++++EY E G 
Sbjct: 102 HNNTQLTSLPYGIEREIIIMKLISHPNVMALY--------EVWENKPELYLVLEYVEGGE 153

Query: 117 LIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN-EYKL 175
           L D++ +R   +L E E +    Q+ QGV+  H     + HRD+K EN+L+  KN   K+
Sbjct: 154 LFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPENLLLDKKNLSVKI 209

Query: 176 CDFGSVCGVIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMV--DIFRGLPIDEKSDI 229
            DFG              ++ +E  D L  T+     Y SPE+V    + G P    SD+
Sbjct: 210 ADFG--------------MAALETTDKLLETSCGSPHYASPEIVMGQKYHGSP----SDV 251

Query: 230 WALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQ 285
           W+ GI L+ L     PF       +L    +G+++ +P  N S + ++LI K+L+ +P+ 
Sbjct: 252 WSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQ-MPQ-NISNEAKDLIAKILIVDPAM 309

Query: 286 RPNVFQLLKQITNMQNAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHS-INEN 344
           R  + ++L+        P  ++  +T  + S++L+ ++     +T NI  L S   I+E+
Sbjct: 310 RITIDEVLEH-------PLLLKYQKTRSKSSSNLHALD-----STPNIVVLESEDKIDES 357

Query: 345 SMSN-QNFQFRMPANVITAQSL 365
            +SN Q      P   +T + L
Sbjct: 358 ILSNLQILWHGAPKEYLTGKLL 379

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/354 (22%), Positives = 146/354 (41%), Gaps = 71/354 (20%)

Query: 7   GTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSL 66
           G +  G ++++      +   L  G    +Y   +  P    +  V  LK+V  P   + 
Sbjct: 16  GFWFDGVRISINGKSYLVTTLLREGELTALYQ--VKCPKRSHSGGVYALKKVTCPIGRAD 73

Query: 67  NTLRAEVDAMKLLR-NNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRL 125
              RA  +     R N+ Y+ + +D   A+    NG+  +++L+ Y   G L D +N  +
Sbjct: 74  FVTRAMTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNMI 131

Query: 126 --QNRLHESEILQIMCQVTQGVAAMHA--------------------------------- 150
              + L ES ++++M  + +GV  MH                                  
Sbjct: 132 IRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAM 191

Query: 151 ----LQPPL--------IHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY-- 196
               L PPL        +H  +  EN+++S++    + +  S        R P EL+   
Sbjct: 192 ELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASCV------RAPLELTSNS 245

Query: 197 ----VEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK---- 248
               +++ + +N+   Y  PE++D+     I  + DIW+LG   Y L Y  + F +    
Sbjct: 246 KLLGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQL 305

Query: 249 GGEP---AILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299
            G P   +I  G F F   P YS+ L+ ++ + LV +P +RP++++ L Q   +
Sbjct: 306 CGTPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 134/297 (45%), Gaps = 72/297 (24%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQVGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
           ++  + ++   YI              +V++ +EYC    L D + +   +R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTET---KVWMALEYCPGKELYDHLLS--LHRISLLECAE 136

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG------------SVCGV 184
           +  Q++  V   H++    +HRD+K+EN+L+      KL DFG            +VCG 
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCG- 193

Query: 185 IRPPRNPQELSYVEQDVLKNTTAQYRSPEMVD--IFRGLPIDEKSDIWALGIFLYKLCYY 242
                                T  Y +PE+++   + G  I    DIW+LG+ LY L   
Sbjct: 194 ---------------------TTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITG 228

Query: 243 TTPFEKGGEPAILNGQFEFL-PYPNYSEQL-----RNLICKLLVQNPSQRPNVFQLL 293
           + PF+   E   +  +++ +   PNY   L     ++LI +LL +NP +RP++ Q+L
Sbjct: 229 SLPFDDDDE---VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 142/336 (42%), Gaps = 66/336 (19%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVY-----SALISPPDPHTNSNVACLKRVIVP--DKTSLN 67
           L++   +  I K L    F+ +Y      ++ +   P TN  +  LKR+  P  +  S++
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTN--LYALKRIRCPFGNIESIS 83

Query: 68  TLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQN 127
               EVD  K  ++  Y++  +DS  A+    +GS  V++L+ Y   G L D  +  L N
Sbjct: 84  GAMKEVDNYKRFQSP-YIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLN 140

Query: 128 R--LHESEILQIMCQVTQGVAAMH--------ALQ---------------------PPL- 155
              + E+E ++I+  + +G+  +H        A Q                      PL 
Sbjct: 141 GTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 156 ---------------IHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQD 200
                           HRDIK  N+L S+     + + GS            +L+ ++  
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAW 260

Query: 201 VLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GG--EPA 253
           V  + T  Y +PE++ I     +D K DIW+LG   Y + +  +PFE+     G   + A
Sbjct: 261 VSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYA 320

Query: 254 ILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
           I  G F F     YSE L  LI K L  NP+ RP++
Sbjct: 321 IGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 155/334 (46%), Gaps = 49/334 (14%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS 65
           IG + +G+ L VGS    ++ Y  + G  Q    +IS      N+  + +     PD   
Sbjct: 14  IGPWKLGSTLGVGSTGKVVMAYNETKG-QQAAVKIIS--KSIFNAQGSTMIGGNDPDVLP 70

Query: 66  LNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRL 125
               R E+  MKLL N+  V+   D       +   S ++++++EY E+G L + +  R 
Sbjct: 71  YGIER-EIIIMKLL-NHPNVLRLYD-------VWETSKDLYMVLEYVEKGELFNLLVER- 120

Query: 126 QNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVI 185
              L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   KL DFG      
Sbjct: 121 -GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAA--- 174

Query: 186 RPPRNPQELSYVEQDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKLCY 241
                        +D L  T+     Y +PE+V    GLP    +SD+W+ G+ LY L  
Sbjct: 175 ----------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLT 221

Query: 242 YTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
              PF  E G    +L    +G+FE       S + ++LI ++L  +P QR    ++LK 
Sbjct: 222 GRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKH 281

Query: 296 ITNMQNAPYP-IRDVQTVQ---RPSNHLNLMELH 325
               +   YP I+D ++++   R   +LN + L 
Sbjct: 282 PLLRK---YPSIKDSKSIRNLPREDTYLNPLSLE 312

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 130/284 (45%), Gaps = 48/284 (16%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRV-IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYI 89
           G F  VY A         +  V  +K V +      +N L  E+  +  L++  Y+ +YI
Sbjct: 26  GNFGDVYKAC-----EKVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELKSP-YITNYI 79

Query: 90  DSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMH 149
            +     ++       +++MEYC  G   D +       L ES+   I  +V +G+  +H
Sbjct: 80  TTMTEDVSM-------WIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLH 132

Query: 150 ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQY 209
             +   IHRDIK  N+L++ + + KL DFG V G IR     +  ++V        T  +
Sbjct: 133 EQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TLKRGTFV-------GTPFW 180

Query: 210 RSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG-----------EPAILNGQ 258
            +PE+V        DEK+DIW+LGI +Y+L   + P  K             +P +L+G 
Sbjct: 181 MAPEVVSK-DSDGYDEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVLHG- 238

Query: 259 FEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ--ITNMQ 300
                  +YS   ++ +   LV+NP  RP+  +LL    +TN+Q
Sbjct: 239 -------HYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 138/331 (41%), Gaps = 61/331 (18%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVA-----CLKRVIVPDKTSLNTL 69
           + V   +  I + L  GG + VY   +S      ++ +A      LK++I P   S++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRL--QN 127
             E++  K  ++  YV+  IDS   +    +GS  +++++ Y   G L D +N RL    
Sbjct: 83  MREIENYKRFQSP-YVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 128 RLHESEILQIMCQVTQGVAAMH-------------------------------------- 149
            + E+E ++IM  VT+G+  +H                                      
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 150 ------ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLK 203
                 A      HRDI   N+L S+     + D GS         N  +LS +++ V  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AILN 256
           N T  Y  PE++++     +  K DIW+LG   Y L +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 GQFEFLPYPNYSEQLRNLICKLLVQNPSQRP 287
           G++ F     +SE L ++I K +  +P QRP
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 124/276 (44%), Gaps = 39/276 (14%)

Query: 28  LTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAE---VDAMKLLRNNRY 84
           L  GGFA+ +         H   +V       +  K S+ T R +   +  +++ +N RY
Sbjct: 99  LGEGGFARCF---------HIKDDVGISFACKIVSKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 85  --VVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVT 142
             +V ++D    +         V++L+E C  G L+D +  R    L E+E+  +  QV 
Sbjct: 150 SHIVKFMDCFEDELN-------VYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVC 200

Query: 143 QGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVL 202
             +  MH+    +IHRD+K+ NV        K+ DFG    +     N  E  Y      
Sbjct: 201 GAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-- 252

Query: 203 KNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNG----Q 258
              T  Y +PE++ + + +    ++DIW+LGI +Y +     PF+      I       Q
Sbjct: 253 ---TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQ 308

Query: 259 FEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
           +EF P    +  ++ LI  LLV +PSQRP +  +LK
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
            G ID  +   L+N + E E+  I  Q+  G+  +H     +IHRDIK ENV++ A    K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWAL 232
            L DFGS   V   P           DV   T   Y +PE++  D + G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGPF----------DVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
            GI LY + +   PF    E  IL G+  F    + S + + LI  +L +N  +RP +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 92/355 (25%), Positives = 159/355 (44%), Gaps = 73/355 (20%)

Query: 5   QIGTYNVGTQLTVGS------------HQVEIIKYLTSGGFAQVYSALISPPDPHTNSNV 52
           +IG + +G  L VGS             Q+  +K ++   F    S  +   DP      
Sbjct: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPD----- 70

Query: 53  ACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYC 112
                 ++P       +  E+  MKLL N+  V+   D       +   S ++++++EY 
Sbjct: 71  ------VLP-----YGIEREITIMKLL-NHPNVLRLYD-------VWETSTDLYMVLEYV 111

Query: 113 ERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE 172
           E+G L + +  R    L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K  
Sbjct: 112 EKGELFNLLIER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFN 167

Query: 173 YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSD 228
            KL DFG                   +D L  T+     Y +PE+V    GLP    +SD
Sbjct: 168 IKLADFGMAA-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESD 211

Query: 229 IWALGIFLYKLCYYTTPFEK--GGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQN 282
           +W+ G+ LY L     PF++  G    +L    +G+FE       S + ++LI K+L  +
Sbjct: 212 VWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVD 271

Query: 283 PSQRPNVFQLLKQITNMQNAPYP-IRDVQTVQ---RPSNHLNLMELHQNSATQNI 333
           PS R    ++LK     +   YP I+D ++++   R   +LN ++ +  +  + I
Sbjct: 272 PSGRIKTREILKHPLLKK---YPSIKDSKSIRNLPREDTYLNPLDHNDGTVDRTI 323

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 129/273 (47%), Gaps = 26/273 (9%)

Query: 28  LTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVS 87
           L  G ++ V   L +  D      V  L +  +  +  +  +  E +A++ + N++ +V 
Sbjct: 185 LGDGAYSTV--MLATSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAA 147
              +   +++L       + L+EYC  G  +  M  +    L+E+       QV   +  
Sbjct: 243 LFFTFQDESSL-------YFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA 207
           +H     +IHRDIK EN+L+  + + KL DFG+   +     N  +L    +  +   TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTA 349

Query: 208 QYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFL 262
           +Y +PE++ D F    +D + D+WA G  LY++     PF+   E      ++  Q+ F 
Sbjct: 350 EYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFT 405

Query: 263 PYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
               +   +R+L+ K+LV++ +QRP++ Q+ K 
Sbjct: 406 --AGFPLIIRDLVKKILVKDLNQRPSISQIEKH 436

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 135/288 (46%), Gaps = 35/288 (12%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKL 78
           S Q  + + +  G +  VY A+    + HT+  VA +K ++  +   LN + AE+ ++  
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYENDEELNDIMAEI-SLLK 75

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIM 138
             NN  +V Y   H         SYE+++L+EYC  G L   + +R    L E+E    +
Sbjct: 76  NLNNNNIVKY---HG----FIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENESKTYV 127

Query: 139 CQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVE 198
            Q   G+  +H     +IHRDIK  N+L+SA N  KL DFG V  ++    N   L+   
Sbjct: 128 TQTLWGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLA- 179

Query: 199 QDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQ 258
                  T  + +PE++   RG      SDIW+LG  + +L     P+    +  I    
Sbjct: 180 ------GTLNWMAPEILG-NRG--ASTLSDIWSLGATVVELLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFLPYP--NYSEQLRNLICKLLVQNPSQRPNVFQLLKQ--ITNMQNA 302
                YP   +SE L++ + K  V+N  +RP   QLLK   IT+ +N 
Sbjct: 231 ENDTYYPPTAFSESLKDFLSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 84/176 (47%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
            G ID  +   L+  + E E   I  QV   +  +H+    ++HRDIK ENV++ +K   K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDIWALG 233
            L DFGS   V   P           DV   T   Y +PE   +  G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLSGEPFDGKPQDIWAIG 1197

Query: 234  IFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
            + LY + +   PF    E  IL    +F      SE+  NLI  +L +NPSQRP +
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTI 1251

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 85.9 bits (211), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 129/275 (46%), Gaps = 46/275 (16%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRV-IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYI 89
           G F  VY A        TN  +  +K V +   +  ++ L  E+  +  LR+  Y+ +YI
Sbjct: 24  GNFGDVYKAF-----DKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITNYI 77

Query: 90  DSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMH 149
            +     ++       +++MEYC  G   D + T   N L E+++  I  +V +G+  +H
Sbjct: 78  TTMIEDVSM-------WIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLH 130

Query: 150 ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQY 209
             +   IHRDIK  N+L++ + + KL DFG V G IR     +  ++V        T  +
Sbjct: 131 DQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATM--KRGTFV-------GTPYW 178

Query: 210 RSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG-----------EPAILNGQ 258
            +PE+V+       +EK+DIW+LGI +Y+L     P  K             +P  L+GQ
Sbjct: 179 MAPEVVNK-ESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQ 237

Query: 259 FEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                   YS+  +  +   LV++P+ RP+   LL
Sbjct: 238 --------YSDVAKGFVAACLVKDPNLRPSAEMLL 264

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 157/354 (44%), Gaps = 71/354 (20%)

Query: 5   QIGTYNVGTQLTVGS------------HQVEIIKYLTSGGFAQVYSALISPPDPHTNSNV 52
           +IG + +G  L  GS             Q+  +K ++   F    S  +   DP      
Sbjct: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD----- 69

Query: 53  ACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYC 112
                 ++P       +  E+  MKLL N+  V+   D       +   + ++++++EY 
Sbjct: 70  ------VLP-----YGIEREIIIMKLL-NHPNVLRLYD-------VWETAQDLYMVLEYV 110

Query: 113 ERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE 172
           E+G L + +  R    L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K  
Sbjct: 111 EKGELFNLLVQR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFN 166

Query: 173 YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSD 228
            KL DFG               +   +D L  T+     Y +PE+V    GLP    +SD
Sbjct: 167 IKLADFGMA-------------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESD 210

Query: 229 IWALGIFLYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQN 282
           +W+ G+ LY L     PF  E G    +L    +G++E       S + R+LI ++L   
Sbjct: 211 VWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVE 270

Query: 283 PSQRPNVFQLLKQITNMQNAPYPIRDVQTVQ---RPSNHLNLMELHQNSATQNI 333
           P QR    ++LK    +Q  P  I+D ++++   R   +LN ++ +  +  Q I
Sbjct: 271 PEQRIKTREILKHPL-LQKYP-SIKDSKSIRNLPREDTYLNPLDHNDGTIDQAI 322

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 153/330 (46%), Gaps = 43/330 (13%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS--LNTLRAEVDAM 76
           +H   + + +  G F  VY A+    D  TN  VA   +V+  + T+  L  L  E+  +
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAI----DRTTNKVVAI--KVVDLENTNERLEVLAQEIFFL 72

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
             L++  Y+++YI +    A++       +++MEYC  G   D +     N L E ++  
Sbjct: 73  AELKSP-YIINYITTLLEDASM-------WIVMEYCGGGSCSDLLKYYFNNGLPEKKVAY 124

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY 196
           I  ++ +G+  +H  +   IHRDIK  N+L++ +   KL DFG V G ++        S 
Sbjct: 125 ITREILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------ST 173

Query: 197 VEQDVLKNTTAQYRSPEMVDI-FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL 255
           + +  +   T  + +PE+      G   DEK DIW+LGI +++L     P  K  +P  +
Sbjct: 174 LRRGTIVG-TPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVK-LDPIRV 229

Query: 256 NGQFEFLPYPN----YSEQLRNLICKLLVQNPSQRPNVFQLLK-------QITNMQNAPY 304
                    P     YS+  ++ +   L++NP++RP    LLK        +TN+++   
Sbjct: 230 LANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLKFPFVRFITVTNLKHEIE 289

Query: 305 PIRDVQTVQRPSNHLNLMELHQNSATQNIQ 334
            +++ +   +   H+    L+   +  NI+
Sbjct: 290 LVKEYKRYPKSPGHMMQDRLYNALSRTNIE 319

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 103/414 (24%), Positives = 183/414 (44%), Gaps = 67/414 (16%)

Query: 6   IGTYNVGTQLTVGSH---QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPD 62
           IG + +G  L +GS    Q+   +        ++ S  I    P++N           PD
Sbjct: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVAN---TPD 75

Query: 63  KTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMN 122
                  R E+  MKLLR+   V+S  D     + L       ++++EY E+G L + + 
Sbjct: 76  SLPYGIER-EIIIMKLLRHAN-VLSLYDVWETNSNL-------YMILEYAEKGELFNLLV 126

Query: 123 TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVC 182
            +    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG   
Sbjct: 127 EK--GPLPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFG--- 179

Query: 183 GVIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFLY 237
                      ++ +E +D L  T+     Y +PE+V    G+P    +SD+W+ G+ L+
Sbjct: 180 -----------MAALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILF 225

Query: 238 KLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
            L     PF  E G    +L    +GQFE       S   ++LI ++L  +P++R    +
Sbjct: 226 ALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTRE 285

Query: 292 LLKQ-----------ITNMQNAP------YPIRDVQTVQRPSNHLNLMEL-HQNSATQNI 333
           +LK              +++N P      +P+ D  +V  PS   NL+ L H     Q  
Sbjct: 286 ILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIA 345

Query: 334 QSLNSHSIN-ENSMSNQNFQFRMPANVITAQSLPTRENSQAFINATSSSLTGSP 386
             L     N E ++    ++F++ A  ++A+    +   Q+ I  ++++++  P
Sbjct: 346 AKLKESGANAEKTIYALLYRFKIEAENLSAKQEQVKR-KQSIIKKSTANVSTPP 398

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 84.0 bits (206), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 66/207 (31%), Positives = 102/207 (49%), Gaps = 29/207 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++LMEY   G L   +  R     ++    + + Q+   +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT---TAQYRSPEMVDIFRGL 221
           +LI   N  KL DFG    +I P           + V + T   T  Y SPEM+   R  
Sbjct: 220 ILIGFNNVIKLTDFG--WSIINP-----------RGVKRKTLCGTIDYLSPEMI---RSR 263

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNLICK 277
             D+K D+WALG+  Y+L   + PFE+  +      IL    +F P    S  +++LI K
Sbjct: 264 EYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKF-P-ETVSHDVKDLISK 321

Query: 278 LLVQNPSQRPNVFQLLKQITNMQNAPY 304
           LL  NPS+R ++  ++K    ++N P+
Sbjct: 322 LLKYNPSERISMRDVMKHPWIIRNKPF 348

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 144/333 (43%), Gaps = 61/333 (18%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVY-----SALISPPDPHTNSNVACLKRVIVPDKTSLN 67
           T + V   + +I + L  GG + VY        +S  +    + +  LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRL-- 125
               E++  K  ++  YV+  IDS   +    +GS  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLHESEILQIMCQVTQGVAAMHA---------------------------------LQ 152
              + E+E ++IM  VT+G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDV 201
             ++           HRDI   N+L S+     + D GS         N  +LS +++ V
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AI 254
             N T  Y +PE++++     +  K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRP 287
             G++ F     +SE+L ++I + +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 91/331 (27%), Positives = 156/331 (47%), Gaps = 51/331 (15%)

Query: 5   QIGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDK 63
           Q+G + +G  L +GS  +V++    T+G  A +   +IS      N+N A    +  PD 
Sbjct: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAI--KVIS--KSVFNNNSAQSSSLTTPDA 69

Query: 64  TSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNT 123
                 R E+  MKLL N+  V+   D     + L       ++++EY E+G L + +  
Sbjct: 70  LPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVE 120

Query: 124 RLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCG 183
           +    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG    
Sbjct: 121 K--GPLQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFG---- 172

Query: 184 VIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFLYK 238
                     ++ +E +D L  T+     Y +PE+V    G+P     SD+W+ G+ L+ 
Sbjct: 173 ----------MAALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFA 219

Query: 239 LCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           L     PF  E G    +L    +G+FE       S + ++L+ K+L  +P +R     +
Sbjct: 220 LLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDI 279

Query: 293 LKQITNMQNAPYPIRDVQTVQ---RPSNHLN 320
           LK    +Q  P  I+D ++++   R   +LN
Sbjct: 280 LKHPL-LQKYP-SIKDSKSIRNLPREDTYLN 308

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 96/209 (45%), Gaps = 47/209 (22%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D + +   +R+   E +Q+  Q+  GV   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISAKNEYKLCDFG------------SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRS 211
           N+L+    + KL DFG            ++CG                      T  Y +
Sbjct: 159 NILLDKSGDAKLTDFGFTRECMTKTTLETICG----------------------TTVYMA 196

Query: 212 PEMVD--IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPN--- 266
           PE+++   + G  I    DIW+LG+ LY +   + PF++  E           P  N   
Sbjct: 197 PELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENI 252

Query: 267 YSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
            +   ++LI +LL +NP+ RP V Q+LK 
Sbjct: 253 VTADAKDLILRLLAKNPNDRPTVEQILKH 281

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 157/333 (47%), Gaps = 47/333 (14%)

Query: 5   QIGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDK 63
           +IG + +G+ L  GS  +V + ++ ++G  A V   ++S       SN + +     PD 
Sbjct: 22  KIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAV--KIVSKSIFGNQSNSSTIVGSNDPDV 79

Query: 64  TSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNT 123
                 R E+  MKLL N+  V+   D     ++L       ++++EY E+G L + +  
Sbjct: 80  LPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSSL-------YMVLEYVEKGELFNLLVD 130

Query: 124 RLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCG 183
           R    L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG    
Sbjct: 131 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA- 185

Query: 184 VIRPPRNPQELSYVEQDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKL 239
                          +D L  T+     Y +PE+V    GLP    +SD+W+ GI L+ L
Sbjct: 186 ------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILFAL 230

Query: 240 CYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                PF  E G    +L    +G+FE       S + ++LI K+L  +P+ R     +L
Sbjct: 231 LTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGIL 290

Query: 294 KQITNMQNAPYPIRDVQTVQ---RPSNHLNLME 323
           K    +Q  P  I+D ++++   R   +LN ++
Sbjct: 291 KHPL-LQKYPS-IKDSKSIRNLPREDTYLNPLD 321

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 102/203 (50%), Gaps = 35/203 (17%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D++   +  R+   E  ++  Q+   V   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGL 221
           N+L+  +   KL DF    G  R      +L  +        T  Y +PE++  D + G 
Sbjct: 158 NILLDMQGNAKLADF----GFTRECATKNQLETI------CGTTVYMAPELLRRDTYDGF 207

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGEP----AILNGQFEFLPYPNYSEQLRN---- 273
            I    DIW+LG+ LY L   + PF++  E      I+N +      P+Y+E++ N    
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDETRTEWKIINEE------PDYNEKIFNANSI 257

Query: 274 -LICKLLVQNPSQRPNVFQLLKQ 295
            LI  LL+++P +RP++ ++LK 
Sbjct: 258 ELIKSLLIKDPKKRPSMTEILKH 280

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 103/201 (51%), Gaps = 31/201 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   RL E E +    Q+ QGV+  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 164 NVLISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMV--DIF 218
           N+L+  KN   K+ DFG                 V   +L+ +  +  Y SPE+V    +
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNL 274
            G P    SD+W+ GI L+ L     PF       +L    +G+++ +P  N S++ ++L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQ-MPQ-NLSKEAQDL 347

Query: 275 ICKLLVQNPSQRPNVFQLLKQ 295
           I K+L  NP++R    ++L+ 
Sbjct: 348 IAKILTVNPAKRLTTEEILRH 368

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 136/304 (44%), Gaps = 51/304 (16%)

Query: 2   NQPQIGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPD--PHTNSNVACLKRV 58
           N+  +G + +G  L  GS  +V + K + SG  A +    I P     H    V  L   
Sbjct: 54  NRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIK---IVPKRNVRHNQKQVTALPYG 110

Query: 59  IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLI 118
           I            E+  MKL+ +   +  Y         +     E+++++EY E G L 
Sbjct: 111 I----------EREIIIMKLITHPNIMALY--------EVWENKSELYLVLEYVEGGELF 152

Query: 119 DFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE-YKLCD 177
           D++  R   +L E E +    Q+ QGV+  H     + HRD+K EN+L+  KN+  K+ D
Sbjct: 153 DYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIAD 208

Query: 178 FGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWALGIF 235
           FG     +       E S          +  Y SPE+V    + G P    SD+W+ GI 
Sbjct: 209 FG--MAALETTNRLLETSC--------GSPHYASPEIVMGQKYHGSP----SDVWSCGII 254

Query: 236 LYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
           L+ L     PF       +L    +G+++ +P  N S++ ++LI K+LV +P +R  V +
Sbjct: 255 LFALLTGHLPFNDDNVRKLLLKVQHGRYQ-MPS-NVSKEAKDLISKILVVDPEKRITVDK 312

Query: 292 LLKQ 295
           +L+ 
Sbjct: 313 ILEH 316

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 125/290 (43%), Gaps = 41/290 (14%)

Query: 23  EIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVI----VPDKTSLNTLRAEVDAMKL 78
           EI + L  G F +VY         H  S + C  +V+    + +       + E+D    
Sbjct: 119 EIGRKLGKGKFGKVYCV------RHKPSGLICALKVMNKMEIVNFNVQKQFKREIDIQYH 172

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIM 138
           L +      Y   H +K         V+++MEY   G L   +  +    +++      +
Sbjct: 173 LNHKNLTKLYAFFHDSK--------NVYLVMEYLIGGELYKLL--KKNGPMNDITASNYV 222

Query: 139 CQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVE 198
            Q+T  +  MH  +  +IHRD+K EN+LI   N+ KL DFG     I  P N +  +   
Sbjct: 223 YQMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC- 276

Query: 199 QDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAI 254
                  T  Y SPE++        DE  D+WALGI  Y+L     PFE+  +      I
Sbjct: 277 ------GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRI 327

Query: 255 LNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPY 304
                +F P PN S + R+LI  LL   PS+R N+ Q++      +N P+
Sbjct: 328 AKSDLKF-P-PNVSSEARDLITNLLKVVPSERFNLQQVMNHPWIEKNKPF 375

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/318 (26%), Positives = 146/318 (45%), Gaps = 57/318 (17%)

Query: 6   IGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKT 64
           +G + +G  L  GS  +V + K + +G  A +         P   + V C     VP+  
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIV------PKKKAFVHCSNNGTVPNSY 131

Query: 65  SLNTLRAEVDAMKLL--------RNNRY----------VVSYIDSHAAKATLHNGSYEVF 106
           S + + + V +  +         + N Y          ++S+ +  A      N S E++
Sbjct: 132 SSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKS-ELY 190

Query: 107 VLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVL 166
           +++EY + G L D++ ++   +L E E +    Q+ +GV+  H+    + HRD+K EN+L
Sbjct: 191 LVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLL 246

Query: 167 ISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMV--DIFRGL 221
           +  KN   K+ DFG     +     P +L       LK +  +  Y SPE+V    + G 
Sbjct: 247 LDKKNRRIKIADFGMAALEL-----PNKL-------LKTSCGSPHYASPEIVMGRPYHGG 294

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLICK 277
           P    SD+W+ GI L+ L     PF       +L    +G+++ +P  N S + R+LI K
Sbjct: 295 P----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQ-MP-SNLSSEARDLISK 348

Query: 278 LLVQNPSQRPNVFQLLKQ 295
           +LV +P +R    ++LK 
Sbjct: 349 ILVIDPEKRITTQEILKH 366

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 101/199 (50%), Gaps = 27/199 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           ++F+++EY + G L D++ ++   +L E E +    Q+ +GVA  H+    + HRD+K E
Sbjct: 189 DLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN--ICHRDLKPE 244

Query: 164 NVLISAKNEY-KLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRG 220
           N+L+  KN+  K+ DFG     +  P    E S          +  Y SPE+V    + G
Sbjct: 245 NLLLDKKNKIIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 294

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLIC 276
            P    SD+W+ GI L+ L     PF       +L    +G+F  LP  N S + ++LI 
Sbjct: 295 GP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFR-LPR-NISLEAQDLIA 348

Query: 277 KLLVQNPSQRPNVFQLLKQ 295
           K+LV NP QR  +  +LK 
Sbjct: 349 KILVVNPRQRIKISDILKH 367

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 118/230 (51%), Gaps = 37/230 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  +    L E+E ++   Q+  G++  HAL   ++HRD+K EN
Sbjct: 118 LYMVLEYAEKGELFNLLVEK--GPLAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPEN 173

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRG 220
           +L+  K+  K+ DFG              ++ +E +D L  T+     Y +PE+V    G
Sbjct: 174 ILLDHKSNIKIADFG--------------MAALETEDKLLETSCGSPHYAAPEIVS---G 216

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRN 273
           LP +  ++DIW+ G+ L+ L     PF  E G    +L     G+FE       S + ++
Sbjct: 217 LPYNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQD 276

Query: 274 LICKLLVQNPSQRPNVFQLLKQITNMQNAPYPIRDVQTVQ---RPSNHLN 320
           LI K+L  NP QR    ++LK    +Q  P  I+D +T++   R   +LN
Sbjct: 277 LIGKILTVNPKQRIKTREILKHPL-LQKYPN-IKDSKTIRDLPREDTYLN 324

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 132/302 (43%), Gaps = 78/302 (25%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
           ++  + ++   YI          +   +V++ +EYC    L D  +     R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRRISLLECGE 136

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG------------SVCGV 184
           +  Q++  V   H++    +HRD+K+EN+L+      KL DFG            +VCG 
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCG- 193

Query: 185 IRPPRNPQELSYVEQDVLKNTTAQYRSPEMVD--IFRGLPIDEKSDIWALGIFLYKLCYY 242
                                T  Y +PE+++   + G  I    DIW+LG+ LY L   
Sbjct: 194 ---------------------TTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITG 228

Query: 243 TTPFEKGGEP----AILNGQFEFLPYPNYSEQL-----RNLICKLLVQNPSQRPNVFQLL 293
             PF+   E      I+N +      P Y  ++     R+LI +LL +NP +RP++ Q+L
Sbjct: 229 YLPFDDDDEAKTKWKIVNEE------PKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

Query: 294 KQ 295
           + 
Sbjct: 283 RH 284

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 135/288 (46%), Gaps = 49/288 (17%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKT--SLNTLRAEVDAM 76
           S   +I + +  G F  VY A+    D  T   VA   ++I  ++T   ++ L  E+  +
Sbjct: 33  SQLYDIKECVGKGSFGDVYRAI----DKETGEMVAV--KIINLEETQDDIDVLAQEIYFL 86

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
             LR   +V +Y  ++    ++       +++ME+C  G   D +    ++RL E+++  
Sbjct: 87  SELRAP-FVTTYYKTYVEDVSM-------WIVMEFCGGGSCADLLKHLPEHRLPENKVAY 138

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY 196
           I+ +V  G+  +H+ +   IHRD+K  N+L++ + E KL DFG V G I        ++ 
Sbjct: 139 IIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQI--------MAT 187

Query: 197 VEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG------ 250
           ++++     T  + +PE+  I R    DEK+DIW+LGI   +L     P+ K        
Sbjct: 188 LKRNTFVG-TPYWMAPEI--IARDNGYDEKADIWSLGITAMELLTGQPPYAKYDPMKVLM 244

Query: 251 -----EPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                +P  L G+F        +   R+ I   L ++P+ RP    LL
Sbjct: 245 NIPLRKPPRLQGRF--------TSSARDFIALCLTKDPALRPTASDLL 284

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 103/200 (51%), Gaps = 33/200 (16%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L ESE +    Q+  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLISAKNEY-KLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMV--DIF 218
           N+L+  K    K+ DFG                 V   +L+ +  +  Y SPE+V    +
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNY-SEQLRN 273
            G P    SDIW+ GI L+ L     PF       +L    NG+++    P+Y S++ +N
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQM---PSYISQEAKN 365

Query: 274 LICKLLVQNPSQRPNVFQLL 293
           LI ++LV +PS+R +  Q+L
Sbjct: 366 LISRILVVDPSKRISTEQIL 385

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 142/334 (42%), Gaps = 63/334 (18%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVY------SALISPPDPHTNSNVACLKRVIVPDKTSL 66
           T + V   + +I + L  GG + VY      ++LI      T    A LK++I P   S+
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYA-LKKIICPSVESI 79

Query: 67  NTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRL- 125
           +    E++  K  ++  YV+  IDS   +    NGS  +++++ Y   G L D +N RL 
Sbjct: 80  SNGMREIENYKRFQSP-YVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLL 136

Query: 126 -QNRLHESEILQIMCQVTQGVAAMH----------------------------------- 149
               + E+E ++IM  VT+G+  +H                                   
Sbjct: 137 EGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPL 196

Query: 150 ---------ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQD 200
                    A      HRDI   N+L S++    + D GS         +  +LS +++ 
Sbjct: 197 EMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEW 256

Query: 201 VLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------A 253
           V  N T  Y +PE++++     +  K DIW++G   Y L +  +PFE+  +        A
Sbjct: 257 VNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYA 316

Query: 254 ILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRP 287
           I  G++ F     +SE L N+I K +  +P QRP
Sbjct: 317 INTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 152/320 (47%), Gaps = 45/320 (14%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVI--VPD 62
           IG + +G  L +GS  +V++ +  ++G  A V   +IS      + NV+    V    PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAV--KVISKA-VFNSGNVSGTSIVGSNTPD 72

Query: 63  KTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMN 122
                  R E+  MKLL N+  V+   D       +   + ++++++EY E+G L + + 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLV 123

Query: 123 TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVC 182
            R    L E+E ++   Q+  GV+  HAL   ++HRD+K EN+L+  K   K+ DFG   
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 183 GVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKL 239
                          E  +L+ +  +  Y +PE+V    G+P     SD+W+ G+ L+ L
Sbjct: 180 ------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFAL 224

Query: 240 CYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                PF  E G   A+L     G+FE       S + ++LI K+L  +P +R     +L
Sbjct: 225 LTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDIL 284

Query: 294 KQITNMQNAPYPIRDVQTVQ 313
           K    +Q  P  IRD ++++
Sbjct: 285 KHPL-LQKYP-SIRDSKSIR 302

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 105/201 (52%), Gaps = 31/201 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   +L E E +    Q+ +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMV--DIF 218
           N+L+  KN+  K+ DFG     +     P +L       LK +  +  Y SPE+V    +
Sbjct: 244 NLLLDKKNKKIKIADFGMAALEL-----PNKL-------LKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNL 274
            G P    SD+W+ GI L+ L     PF       +L    +G+++ +P  N S + RNL
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQ-MPM-NLSLEARNL 345

Query: 275 ICKLLVQNPSQRPNVFQLLKQ 295
           I K+LV +P +R    ++L+ 
Sbjct: 346 ISKILVIDPEKRITTQEILEH 366

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 89/180 (49%), Gaps = 20/180 (11%)

Query: 116  GLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
            G ID  +    ++ + ESE   I  QV  G+  +H     ++HRD+K ENV++ AK   K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLP-IDEKSDIWALG 233
            L DFGS   V   P           DV   T   Y +PE   +  G P + +  DIWA+G
Sbjct: 1257 LIDFGSAAYVNSGPF----------DVFVGTI-DYAAPE---VLSGEPYLGKPQDIWAIG 1302

Query: 234  IFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
            I LY + +   PF    E  IL  + +     + S+   +LI ++L +NP++RP + +++
Sbjct: 1303 ILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIV 1360

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/180 (33%), Positives = 86/180 (47%), Gaps = 19/180 (10%)

Query: 111  YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            + E G +  F    L+  + E E   I  QV  G+  +H  +  ++HRDIK ENV++ +K
Sbjct: 1065 HGETGSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSK 1122

Query: 171  NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDI 229
               KL DFGS   V   P           DV   T   Y +PE   +  G P + K  DI
Sbjct: 1123 GFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGGEPYEGKPQDI 1168

Query: 230  WALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
            WA+GI LY + +   PF    E  I+ G  +F      SE+  NLI K+L +N  +RP +
Sbjct: 1169 WAVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTI 1226

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 143/307 (46%), Gaps = 47/307 (15%)

Query: 21  QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS-LNTLRAEVDAMKLL 79
           Q EI++ +  G F  VY A        T++ +  +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKA-----RDLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMC 139
           R+  Y+ +Y  +     ++       +++MEYC  G   + +    ++++ E +   I+ 
Sbjct: 74  RSP-YITNYKTAFLVDVSM-------WIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 QVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQ 199
           +V  G+  +H+ +   IHRDIK  N+L++     KL DFG V G +   R        ++
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTR--------KR 174

Query: 200 DVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG--------- 250
           D    T   + +PE++D  +    +E +DIW+LGI + +L     P +K           
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 251 --EPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPYPIRD 308
             +P  L+ +F        S   R+ + + L+++PSQRP   +LLK     +   Y +RD
Sbjct: 233 KRDPPKLDKRF--------SSHARDFVAQCLIKDPSQRPTAAELLKHRFVKRVRLYNLRD 284

Query: 309 -VQTVQR 314
            V  V+R
Sbjct: 285 QVDLVKR 291

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 133/302 (44%), Gaps = 78/302 (25%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
           ++  + ++   YI          +   +V++ +EYC    L D + +   +R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYDHLLS--LHRISLLECGE 136

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG------------SVCGV 184
           +  Q++  V   H++    +HRD+K+EN+L+      KL DFG            +VCG 
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCG- 193

Query: 185 IRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWALGIFLYKLCYY 242
                                T  Y +PE++    + G  I    D W+LG+ LY L   
Sbjct: 194 ---------------------TTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITG 228

Query: 243 TTPFEKGGEP----AILNGQFEFLPYPNYSEQL-----RNLICKLLVQNPSQRPNVFQLL 293
           + PF+   E      I+N +      P Y  +L     ++LI +LL +NP +RP++ Q+L
Sbjct: 229 SLPFDDDDEAKTKWKIVNEE------PKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

Query: 294 KQ 295
           + 
Sbjct: 283 RH 284

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 98/213 (46%), Gaps = 38/213 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY    E++V+MEYC  G L   +      ++ E  I  IM ++   +A MH  +
Sbjct: 79  THYYGSYLNNTELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHK 133

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +P
Sbjct: 134 DGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAP 184

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPAILNGQFEF 261
           E+  I  G+  D K DIW+LGI  Y++     P+               +P  L G+   
Sbjct: 185 EV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR--- 239

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
                +S  L+  I   L ++P +RP+  +LLK
Sbjct: 240 ----QHSSALKEFIALCLDEDPKERPSAEELLK 268

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 87/342 (25%), Positives = 157/342 (45%), Gaps = 59/342 (17%)

Query: 69  LRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128
           +  E+  MKLLR+   V+S  D     + L       ++++EY E+G L + +  R    
Sbjct: 77  IEREIIIMKLLRHPN-VLSLYDVWETNSKL-------YMILEYAEKGELFNLLVER--GP 126

Query: 129 LHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPP 188
           L E E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG         
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKLNIKIADFG--------- 175

Query: 189 RNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKLCYYT 243
                ++ +E +D +  T+     Y +PE+V    G+P    +SD+W+ G+ L+ L    
Sbjct: 176 -----MAALETKDKMLETSCGSPHYAAPEIVS---GVPYHGFQSDVWSCGVILFALLTGR 227

Query: 244 TPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ-- 295
            PF  E G    +L    +G++E       S++ ++LI ++L  +P QR     +LK   
Sbjct: 228 LPFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPL 287

Query: 296 ---------ITNMQNAP------YPIRDVQTVQRPSNHLNLMELHQNSATQNIQS--LNS 338
                      +++N P      YP+ +  ++   S   NL+ L       +I      S
Sbjct: 288 LQKYPSIKDSRSIKNLPREDTYLYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRES 347

Query: 339 HSINENSMSNQNFQFRMPANVITAQSLPTRENSQAFINATSS 380
            +  E ++    ++F++ A  +   S P R+N  + I+ +SS
Sbjct: 348 GADAEKTVYALLYRFKVEAEKMNTCSSPRRKNRISMISVSSS 389

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 113/220 (51%), Gaps = 32/220 (14%)

Query: 85  VVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQG 144
           ++S+ +  A      N S E+++++EY + G L D++ ++   +L E E +    Q+ +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLIHRDIKIENVLISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVEQDVLK 203
           V+  H+    + HRD+K EN+L+  KN   K+ DFG     +     P +L       LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFGMAALEL-----PNKL-------LK 272

Query: 204 NT--TAQYRSPEMV--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL---- 255
            +  +  Y SPE+V    + G P    SD+W+ GI L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
           +G+++ +P  N S + R+LI K+LV +P++R    ++LK 
Sbjct: 329 SGKYQ-MPM-NLSAEARDLISKILVIDPAKRITTQEILKH 366

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 125/267 (46%), Gaps = 27/267 (10%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYID 90
           G F  VY A+    D  T   VA     +      ++ L  E+  +  L+++ Y+++YI 
Sbjct: 25  GNFGDVYKAI----DNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELKSD-YIINYIT 79

Query: 91  SHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
           +     ++       +++M+YC  G   D +     N + E ++  I+  V  G+  +H 
Sbjct: 80  TIMEDVSM-------WIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHE 132

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYR 210
            +   IHRDIK  N+L++   + KL DFG V G I+        + +++D    T   + 
Sbjct: 133 QKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIK--------ATLKRDTFVGT-PYWM 180

Query: 211 SPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLP---YPNY 267
           +PE+++       DEK DIW+LGI  Y+L     P  K     ++    +  P   +  Y
Sbjct: 181 APEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPY 240

Query: 268 SEQLRNLICKLLVQNPSQRPNVFQLLK 294
           ++  ++ I   L+++P  RPNV  LLK
Sbjct: 241 NDFTKSFISFCLIKDPKLRPNVQNLLK 267

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 128/290 (44%), Gaps = 41/290 (14%)

Query: 23  EIIKYLTSGGFAQVYSALISPPDPHTNSNVAC-LKRVIVPDKTSLNT---LRAEVDAMKL 78
           EI K L  G F +VY         H  S   C LK +   D    N     R EV+    
Sbjct: 110 EIGKVLGKGKFGRVYCVR------HIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ-- 136
           LR+      Y   H  K         V++LMEY   G L       L+ R H ++++   
Sbjct: 164 LRHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELY----KHLKGRSHFNDVVASY 211

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY 196
            + Q+   +  MH  +  ++HRDIK EN++I   N  KL DFG    VI P  + ++   
Sbjct: 212 YVYQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRKTL- 266

Query: 197 VEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILN 256
                    T  Y SPE++   R    +EK D+WALG+  Y+L   + PFE+  +     
Sbjct: 267 -------CGTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYK 316

Query: 257 GQFEF-LPYPNYSE-QLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPY 304
              +  L +P++ + + R+LI +LL  +P  R  + ++ K     +N P+
Sbjct: 317 RILKRNLIFPDHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEKNKPF 366

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 115/281 (40%), Gaps = 57/281 (20%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS--LNTLRAEVDAMKLLRNNRYVVSY 88
           G F  VY A       H  +      +V+  D T   +  +R E+  +  L+    +  Y
Sbjct: 25  GKFGVVYKAF------HVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNITHY 78

Query: 89  IDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAM 148
             S+     L       +V+MEYC  G L   +   +   + E  I  IM ++   + ++
Sbjct: 79  YGSYLIDTKL-------WVIMEYCAGGSLRTLLRPGI---IEEKYIGVIMREILVALISI 128

Query: 149 HALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQ 208
           H  +  +IHRDIK  N+LI+     KLCDFG                 + Q +LK  T  
Sbjct: 129 H--RDNVIHRDIKAANILIANNGSVKLCDFGVAA-------------QLSQSMLKRQTMA 173

Query: 209 ----YRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPA 253
               + +PE+  I  G+  D K DIW+LGI  Y++     P+               +P 
Sbjct: 174 GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPP 231

Query: 254 ILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
            L G+        YS+ L+  I   L ++P +RP   +L K
Sbjct: 232 RLEGR-------EYSQPLKEFIALCLDEDPKERPYAEELFK 265

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 104/199 (52%), Gaps = 31/199 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E +    Q+ +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSFCHSFN--ICHRDLKPE 243

Query: 164 NVLISAKN-EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMV--DIF 218
           N+L+  KN + K+ DFG     +     P +L       LK +  +  Y SPE+V    +
Sbjct: 244 NLLLDKKNRKIKIADFGMAALEL-----PNKL-------LKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNL 274
            G P    SD+W+ GI L+ L     PF       +L    +G+++ +P  N S + R+L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQ-MPM-NLSAEARDL 345

Query: 275 ICKLLVQNPSQRPNVFQLL 293
           I K+LV NP +R    ++L
Sbjct: 346 ISKILVINPEKRITTQEIL 364

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 94/197 (47%), Gaps = 33/197 (16%)

Query: 101  GSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDI 160
            GS ++F ++E+              ++ + E E   I  Q+  G+  +H     ++HRDI
Sbjct: 1038 GSVDLFDIIEF--------------KSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDI 1081

Query: 161  KIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRG 220
            K ENV++ +K   KL DFGS   V   P           DV   T   Y +PE   +  G
Sbjct: 1082 KDENVIVDSKGFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGG 1127

Query: 221  LPIDEKS-DIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLL 279
             P + KS DIWA+GI LY L Y   PF    E  IL G+  F    + S++ + LI K+L
Sbjct: 1128 NPYEGKSQDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKIL 1185

Query: 280  VQNPSQRPNVFQLLKQI 296
             +   +RP + ++ + +
Sbjct: 1186 NRCVRKRPTIDEICQDV 1202

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 150/320 (46%), Gaps = 45/320 (14%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRV--IVPD 62
           IG + +G  L +GS  +V++ +  ++G  A V   +IS    +T  NV+    V    PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAV--KVISKTVFNT-GNVSGTSIVGSTTPD 72

Query: 63  KTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMN 122
                  R E+  MKLL N+  V+   D     A L       ++++EY E+G L + + 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNADL-------YLVLEYAEKGELFNLLV 123

Query: 123 TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVC 182
            R    L E+E ++   Q+  GV+  HAL   ++HRD+K EN+L+  K   K+ DFG   
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 183 GVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKL 239
                          E  +L+ +  +  Y +PE+V    G+P     SD+W+ G+ L+ L
Sbjct: 180 ------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFAL 224

Query: 240 CYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                PF  E G    +L     G+FE       S + ++LI ++L  +P +R     +L
Sbjct: 225 LTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDIL 284

Query: 294 KQITNMQNAPYPIRDVQTVQ 313
           K    +Q  P  I+D ++++
Sbjct: 285 KHPL-LQKYP-SIKDSKSIR 302

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 86/181 (47%), Gaps = 21/181 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            + E G +  F    L+  + E E   +  Q+T GV  +H     ++HRDIK ENV++  K
Sbjct: 1153 HGETGSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNK 1210

Query: 171  NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSD 228
               KL DFGS   V R P           DV   T   Y +PE++  D + G P     D
Sbjct: 1211 GCVKLIDFGSAAYVKRGPF----------DVFVGTI-DYAAPEVLEGDPYEGKP----QD 1255

Query: 229  IWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPN 288
            IWA+G+ LY + Y   PF    E  IL+G     P    SE+   LI  +L ++ S+RP 
Sbjct: 1256 IWAIGVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPT 1313

Query: 289  V 289
            V
Sbjct: 1314 V 1314

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 98/206 (47%), Gaps = 24/206 (11%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +
Sbjct: 76  TRYYGSYLRGTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKVIH--K 130

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ + + KLCDFG    + +     Q ++          T  + +P
Sbjct: 131 DNVIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAP 181

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF----EKGGEPAILNGQFEFLPYPNYS 268
           E+  I  G+  D K DIW+LGI  Y++     P+           I+  +   L   NY+
Sbjct: 182 EV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYT 239

Query: 269 EQLRNLICKLLVQNPSQRPNVFQLLK 294
            QL+  I   L ++P +R +  +LLK
Sbjct: 240 PQLKEFIALCLDEDPQERLSAEELLK 265

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 99/204 (48%), Gaps = 39/204 (19%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC    L D++   L+ R+   E  ++  Q+   V   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLP 222
           +L+       L DF    G  R      +L  V        T  Y +PE++  + + G  
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGG-----------EPAILNGQFEFLPYPNYSEQL 271
           +    D W+LGI LY + +   PF++             EPA+L+   E+      S Q 
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLD---EYT-----SPQA 256

Query: 272 RNLICKLLVQNPSQRPNVFQLLKQ 295
           ++LI +LL +N +QRPN+ ++L+ 
Sbjct: 257 KDLIVRLLDKNAAQRPNLNEVLQH 280

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 118/259 (45%), Gaps = 49/259 (18%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   V+  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG--IVHRDLKPEN 157

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA----QYRSPEMVDIFRG 220
           +L+ +    K+ DFG              ++ ++ D     T+     Y +PE+V    G
Sbjct: 158 LLLDSDYNIKVADFG--------------MAALQTDAALLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRN 273
           LP +   SD+W+ G+ L+ L     PF  E G    +L     GQFE       S+  ++
Sbjct: 201 LPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQD 260

Query: 274 LICKLLVQNPSQRPNV-----------FQLLKQITNMQNAP------YPIRDVQTVQRPS 316
           LI K+LV +P+QR  +           +Q +K   ++++ P      YP+ D       S
Sbjct: 261 LISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADAGAAIDDS 320

Query: 317 NHLNLMELHQNSATQNIQS 335
              NL+ L        I++
Sbjct: 321 ILQNLVVLWHGRHADEIKA 339

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 151/320 (47%), Gaps = 45/320 (14%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRV--IVPD 62
           IG + +G  L +GS  +V++ +  ++G  A V   +IS    +T  NV+    V    PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAV--KVISKAVFNT-GNVSGTSIVGSTTPD 72

Query: 63  KTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMN 122
                  R E+  MKLL N+  V+   D       +   + ++++++EY E+G L + + 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLV 123

Query: 123 TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVC 182
            R    L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+  K   K+ DFG   
Sbjct: 124 ER--GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 183 GVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMVDIFRGLPIDE-KSDIWALGIFLYKL 239
                          E  +L+ +  +  Y +PE+V    G+P     SD+W+ G+ L+ L
Sbjct: 180 ------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFAL 224

Query: 240 CYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                PF  E G    +L     G+FE       S + ++LI K+L  +P +R     +L
Sbjct: 225 LTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDIL 284

Query: 294 KQITNMQNAPYPIRDVQTVQ 313
           K    +Q  P  IRD ++++
Sbjct: 285 KHPL-LQKYP-SIRDSKSIR 302

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 98/192 (51%), Gaps = 31/192 (16%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   +L E E +    Q+ QGV+  H+    + HRD+K E
Sbjct: 216 ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICHRDLKPE 271

Query: 164 NVLISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMV--DIF 218
           N+L+  KN+  K+ DFG                 V   +L+ +  +  Y SPE+V    +
Sbjct: 272 NLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGRPY 319

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNL 274
            G P    SD+W+ GI L+ L     PF       +L    +G+F  +P  N S + ++L
Sbjct: 320 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKF-HMPQ-NLSAEAKDL 373

Query: 275 ICKLLVQNPSQR 286
           + K+LV NP +R
Sbjct: 374 MSKILVVNPFKR 385

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 143/307 (46%), Gaps = 47/307 (15%)

Query: 21  QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS-LNTLRAEVDAMKLL 79
           Q EI++ +  G F  VY A        TN  VA +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLA----TNEIVA-IKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMC 139
           R+  Y+ +Y  +     ++       +++MEYC  G   + +    +++L E +   I+ 
Sbjct: 74  RSP-YITNYKTAFLVDVSM-------WIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVS 125

Query: 140 QVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQ 199
           +V  G+  +H+ +   IHRDIK  N+L++     KL DFG V G +   R        ++
Sbjct: 126 EVLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTR--------KR 174

Query: 200 DVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK----------- 248
           D    T   + +PE++D  +    +E +DIW+LGI + +L     P +K           
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 249 GGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPYPIRD 308
             +P  L+ +F        S   ++ + + L+++PSQRP   +LLK     +   Y +RD
Sbjct: 233 KRDPPKLDKRF--------SSHAKDFVAQCLIKDPSQRPTASELLKHRFVKRVRLYNLRD 284

Query: 309 -VQTVQR 314
            V  V+R
Sbjct: 285 QVDLVKR 291

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 131/288 (45%), Gaps = 31/288 (10%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRV-IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYI 89
           G F  VY A            V  +K V +   +  ++ L  E+  +  LR+  ++ +YI
Sbjct: 24  GNFGDVYKAC-----DKVEGKVVAVKVVNLEHSEEDIDLLAQEIFFLAELRS-PFITNYI 77

Query: 90  DSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMH 149
            +     ++       +++MEYC  G   D +     N + E ++  I  QV +G+  +H
Sbjct: 78  TTLTEDVSM-------WIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH 130

Query: 150 ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQY 209
             +   IHRDIK  N+L++ +   KL DFG V G IR     +  ++V        T  +
Sbjct: 131 EQKK--IHRDIKAANILLTDEGTVKLGDFG-VSGQIRA--TLKRGTFV-------GTPYW 178

Query: 210 RSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLP---YPN 266
            +PE+V        DEK+DIW+LGI +Y+L     P  K     ++    +  P   + +
Sbjct: 179 MAPEVVSK-ENDGYDEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGH 237

Query: 267 YSEQLRNLICKLLVQNPSQRPNVFQLLKQ-ITNMQNAPYPIRDVQTVQ 313
           YS   +N +   LV+NP  R + +++++    N    P    DV+ ++
Sbjct: 238 YSHSAKNFVSSCLVKNPVGRASAYEMVEHNFVNQLAVPNLKEDVEYLK 285

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 133/301 (44%), Gaps = 76/301 (25%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
           ++  + ++   YI          +   +V++ +EYC    L D  +     RL   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRRLSLLECGE 136

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG------------SVCGV 184
           +  Q++  V   H++    +HRD+K+EN+L+      KL DFG            +VCG 
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCG- 193

Query: 185 IRPPRNPQELSYVEQDVLKNTTAQYRSPEMVD--IFRGLPIDEKSDIWALGIFLYKLCYY 242
                                T  Y +PE+++   + G  I    DIW+LG+ LY L   
Sbjct: 194 ---------------------TTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITG 228

Query: 243 TTPFEKGGE----PAILNGQ----FEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
             PF+   E      I+N +     +F+P     +  ++LI +LL +NP +RP++ Q+L+
Sbjct: 229 YLPFDDDDEVKTKWKIVNEEPKYDSKFIP-----DDAKDLISRLLAKNPGERPSLPQVLR 283

Query: 295 Q 295
            
Sbjct: 284 H 284

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 97/213 (45%), Gaps = 38/213 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +
Sbjct: 95  TRYYGSYLKNTSLWIIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKYIH--K 149

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +P
Sbjct: 150 DNVIHRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTPYWMAP 200

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPAILNGQFEF 261
           E+  I  G+  D K+DIW+ GI  Y++     P+               +P  L G+   
Sbjct: 201 EV--IMEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGR--- 255

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
               NYS  ++  I   L ++PS+RP   +LLK
Sbjct: 256 ----NYSALIKEFIATCLDEDPSERPTADELLK 284

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 131/293 (44%), Gaps = 47/293 (16%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYID 90
           G F  VY A+    D  T   VA     +      +  +  E+  +  L++  Y+ +YI 
Sbjct: 30  GNFGDVYKAI----DKLTGEIVAIKVVNLESSDEDIELIAQEIFFLAELKS-PYITNYIT 84

Query: 91  SHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
           +     ++       +++MEYC  G   D +       LHE ++  I   V +G+  +H 
Sbjct: 85  TMLEDVSM-------WIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE 137

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIR--PPRNPQELSYVEQDVLKNTTAQ 208
            +   IHRD+K  NVL++     KL DFG V G +R    RN    ++V        T  
Sbjct: 138 QRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRSTAKRN----TFV-------GTPY 183

Query: 209 YRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPN-- 266
           + +PE++        +EK+DIW+LGI +Y+L     P+ K     ++      +P  N  
Sbjct: 184 WMAPEIIS-NSSHGYNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRN----IPKKNLQ 238

Query: 267 -----YSEQLRNLICKLLVQNPSQRPNVFQLLKQ-------ITNMQNAPYPIR 307
                +S+  +  I   L+++P +RP   +LL+Q       IT+++N    I+
Sbjct: 239 DCMVSFSDAAKLFISACLIKDPDERPTATELLQQPFVKNIKITDLRNEVMEIK 291

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 119/247 (48%), Gaps = 38/247 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E ++   Q+ +GV   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 164 NVLISAKNEY-KLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA--QYRSPEMV--DIF 218
           N+L+  K +  K+ DFG                 V   +LK +     Y SPE+V    +
Sbjct: 290 NLLLDKKRKLIKIADFGMAA------------LQVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNY-SEQLRN 273
            G P    SD+W+ GI L+ L     PF       +L    NG+++    PNY S+  ++
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQM---PNYLSKDAKD 390

Query: 274 LICKLLVQNPSQRPNVFQLLKQ--ITNMQNAPYPIRDVQ--TVQRPSNHLNLMELHQNSA 329
           LI ++L+ NP  R    Q+L+   IT   N  Y ++     T Q   N+ NLM    N+ 
Sbjct: 391 LISRILLVNPKARLTTEQILEHPLITKYDNQ-YSLKKENKLTKQAIKNYNNLMRGKSNTD 449

Query: 330 TQNIQSL 336
              +Q++
Sbjct: 450 LAILQNI 456

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 128/277 (46%), Gaps = 48/277 (17%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPD-KTSLNTLRAEVDAMKLLRNNRYVVSYI 89
           G F  VY A+         S V  +K V + +    +  L  E+  +  L++  ++ +YI
Sbjct: 24  GNFGDVYKAI-----DKNESKVVAIKIVNLENTDEDIELLTQEIFFLSELKS-PFITNYI 77

Query: 90  DSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMH 149
            +     T+       +++MEYC  G   D +       + ES++  I+    +G+  +H
Sbjct: 78  TTLTEDVTM-------WIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLH 130

Query: 150 ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQY 209
             +   IHRDIK  N+L++   + KL DFG V G IR     +  ++V        T  +
Sbjct: 131 DQKK--IHRDIKAANILLTDCGKVKLGDFG-VSGQIRATM--KRGTFV-------GTPYW 178

Query: 210 RSPEMVDI-FRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNG 257
            +PE+++   +G   +EK+DIW+LGI  Y+L     P  K             +P  L+G
Sbjct: 179 MAPEVINKQCKGY--NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHG 236

Query: 258 QFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
           Q        YSE+ +  +   L+++P QRP++  LL+
Sbjct: 237 Q--------YSEKAKYFVSLCLIKDPKQRPSIEALLE 265

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/277 (28%), Positives = 127/277 (45%), Gaps = 51/277 (18%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYID 90
           G    VY+A     +  TN++VA +K++ +  +     +  E+  MK  ++ R +V++ID
Sbjct: 664 GASGGVYTAY----ELGTNASVA-IKQMNLEKQPKKELIINEIMVMKGSKH-RNIVNFID 717

Query: 91  SHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
           S+  K  L       +V+MEY E G L D +   +   L E +I  +  +   G+  +H+
Sbjct: 718 SYLLKGDL-------WVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFLHS 767

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYR 210
               +IHRDIK +N+L+S   E KL DFG  C  I       E++     ++   T  + 
Sbjct: 768 KG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWM 816

Query: 211 SPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL-------------NG 257
           +PE+V      P   K DIW+LGI + ++          GEP  L             NG
Sbjct: 817 APEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GEPPYLNETPLRALYLIATNG 865

Query: 258 QFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
             +     N  E+L+N +   L   P QR +  QLLK
Sbjct: 866 TPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLK 902

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 96/203 (47%), Gaps = 38/203 (18%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           +L++ +   KL DFG V G IR        S +++D     T  + +PE+V       +D
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVV----CCEVD 187

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEFLPYPNYSEQ 270
              EK+DIW+LGI  Y+L     P  K             +P  L G F        SE 
Sbjct: 188 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSF--------SEA 239

Query: 271 LRNLICKLLVQNPSQRPNVFQLL 293
            +  +   LV+ P+ RP+ + LL
Sbjct: 240 AKEFVAGCLVKAPADRPSAYDLL 262

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 98/213 (46%), Gaps = 38/213 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY    +++V+MEYC  G L   +      ++ E  I  IM ++    A MH  +
Sbjct: 79  THYYGSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHK 133

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +P
Sbjct: 134 DGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAP 184

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEF 261
           E+  I  G+  D K DIW+LGI  Y++     P+ +             +P  L G+   
Sbjct: 185 EV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGR--- 239

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
                +S  L+ +I   L ++P +RP+   LLK
Sbjct: 240 ----QHSSALKEIIALCLDEDPKERPSAEDLLK 268

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 85/178 (47%), Gaps = 20/178 (11%)

Query: 114  RGGLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE 172
            + G ID  +    +  + E E   I  Q+  G++ +H  +  ++HRDIK ENV++ AK  
Sbjct: 1092 KTGCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGF 1149

Query: 173  YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDIWA 231
             KL DFGS   V   P           DV   T   Y SPE   + RG   + K  DIWA
Sbjct: 1150 VKLIDFGSAAYVKNGPF----------DVFVGTI-DYASPE---VLRGEKYEGKPQDIWA 1195

Query: 232  LGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
            LGI LY + +   PF    E  IL G  +F    N S    +LI  +L ++  +RP++
Sbjct: 1196 LGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSI 1251

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 100/197 (50%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+F+++EY + G L D++ +R   +L E E +    Q+ +GV+  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPE 248

Query: 164 NVLISAK-NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRG 220
           N+L+  K N  K+ DFG     +     P +L      V    +  Y SPE+V    + G
Sbjct: 249 NLLLDKKINTIKIADFGMAALEL-----PNKLL-----VTSCGSPHYASPEIVMGKSYHG 298

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLIC 276
            P    SD+W+ GI L+ L     PF       +L    +G+F+ +P  N S +  +LI 
Sbjct: 299 SP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQ-MPQ-NISLEAEDLIS 352

Query: 277 KLLVQNPSQRPNVFQLL 293
           ++LV +P +R  +  +L
Sbjct: 353 RILVVDPEKRIQINDIL 369

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 100/208 (48%), Gaps = 31/208 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V+++MEY   G L   +  R     ++    + + Q+   +  +H  +  +IHRD+K EN
Sbjct: 227 VYLIMEYLVYGELYKLL--RSHGPFNDIIASRFVYQIADALNHLH--EKGIIHRDLKPEN 282

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT---TAQYRSPEMVDIFRGL 221
           +LI   N  KL DFG    +I P           + V + T   T  Y SPEM+   R  
Sbjct: 283 ILIGFNNVLKLTDFG--WSIINP-----------KGVKRKTLCGTIDYLSPEMI---RSR 326

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYP-NYSEQLRNLIC 276
             D+  D+WALG+  Y+L     PFE+  +      IL G+  F   P   S+ +R+LI 
Sbjct: 327 EYDDTVDVWALGVLTYELVAGDPPFEEDSKELTYKRILKGEIRF---PGTVSQDVRDLIS 383

Query: 277 KLLVQNPSQRPNVFQLLKQITNMQNAPY 304
           +LL  +P +R  + +++     M+N P+
Sbjct: 384 RLLKNDPKERILLKEVMVHPWIMRNKPF 411

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 97/198 (48%), Gaps = 29/198 (14%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   +L E E +    Q+ QGVA  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPE 228

Query: 164 NVLISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA---QYRSPEMV--DI 217
           N+L+  KN+  K+ DFG     +              D L +T+     Y SPE+V    
Sbjct: 229 NLLLDKKNKIIKIADFGMAALEV-------------SDKLLSTSCGSPHYASPEIVMGKS 275

Query: 218 FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG-EPAILNGQFEFLPYP-NYSEQLRNLI 275
           + G P    +D+W+ GI L+ L     PF     +  +L  Q      P + S   ++LI
Sbjct: 276 YHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPSDLSPDAKDLI 331

Query: 276 CKLLVQNPSQRPNVFQLL 293
            K+LV +P +R    ++L
Sbjct: 332 SKILVVDPDKRLTTTEIL 349

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 96/208 (46%), Gaps = 49/208 (23%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D + ++  +RL   E  ++  Q+T  V   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISAKNEYKLCDFG------------SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRS 211
           NVL+      KL DFG            +VCG                      T  Y +
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMVDIFRGLPIDE-KSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQ 270
           PEM+   +  P D  K DIW+LG+ LY L     PF++  +  +L  Q      P   E+
Sbjct: 201 PEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD--LLTKQKIINDTPVIDER 255

Query: 271 L-----RNLICKLLVQNPSQRPNVFQLL 293
           +     +NLI +LL ++P++RPN   +L
Sbjct: 256 ITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 87/181 (48%), Gaps = 21/181 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            + E G +  F    L+  + E E   +  QV  G+  +H  +  ++HRDIK ENV++  +
Sbjct: 1087 HGETGSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNR 1144

Query: 171  NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSD 228
               K+ DFGS   V R P           DV   T   Y +PE++  D + G P     D
Sbjct: 1145 GRVKIIDFGSAAYVKRGPF----------DVFVGTI-DYAAPEVLGGDPYEGKP----QD 1189

Query: 229  IWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPN 288
            +WA+G+ LY + Y   PF    E  IL+G     P    SE+   LI ++L ++ ++RP 
Sbjct: 1190 VWAVGVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPT 1247

Query: 289  V 289
            V
Sbjct: 1248 V 1248

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 95/203 (46%), Gaps = 38/203 (18%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           +L++ +   KL DFG V G IR        S  ++D     T  + +PE+V       +D
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVV----CCEVD 192

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEFLPYPNYSEQ 270
              EK+DIW+LGI  Y+L     P  K             +P  L G F        SE 
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPF--------SEA 244

Query: 271 LRNLICKLLVQNPSQRPNVFQLL 293
            +  +   LV+ P+ RP+ + LL
Sbjct: 245 AKEFVAGCLVKTPADRPSAYDLL 267

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 126/308 (40%), Gaps = 60/308 (19%)

Query: 8   TYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLN 67
            Y  G+++  GSH V             VY    S         V C      P+K +  
Sbjct: 41  VYYRGSEINRGSHSV-------------VYKVFDSEDRIFAGKKVHC------PNKENKR 81

Query: 68  TLRAEVDAMKLL--RNNRYVVSYIDS-HAAKATLHNGSYEVFVLMEYCERGGLIDFMNTR 124
            +  E++  K++   ++ ++V+  D+    K +       ++++++YC    L   +  R
Sbjct: 82  KIIKELEIYKVICRSHHNHIVALRDAFQWGKESC------IYMILDYCSNNSLQSILQYR 135

Query: 125 LQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGV 184
               L+E E  ++M Q+  G+  +H     +IH D+K+ N+L     + K+CDFGS    
Sbjct: 136 --GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQLKICDFGSSFIA 191

Query: 185 IRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRG--------LPIDEKSDIWALGIFL 236
              PR P E+           T  Y +PE V   +         L I    DIW++GI L
Sbjct: 192 TSSPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISFPIDIWSMGIVL 242

Query: 237 YKLCYYTTPFEKGGEPA-----------ILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQ 285
           Y L Y   PF K  +             I +G  EF          + LI K+L QNP +
Sbjct: 243 YSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQNPLE 302

Query: 286 RPNVFQLL 293
           R  + +++
Sbjct: 303 RITLVEIV 310

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 131/288 (45%), Gaps = 54/288 (18%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY A   P    T+  V     +   DK+  N +R      
Sbjct: 34  VGNYK--ILKQIGEGSFGKVYLASHKP----THRKVV----LKTSDKSDPNLVR------ 77

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
           ++  + ++   YI              +V++ +EYC    L + +   + +R+   E  +
Sbjct: 78  EVFYHRQFDFPYITKLYEVIVTET---KVWMALEYCPGRELYEHL--LMLHRIPLDECAK 132

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY 196
           +  Q+   V   H+L    +HRD+K+EN+L+      KL DFG     +         S 
Sbjct: 133 LFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFGFTRECV---------SK 181

Query: 197 VEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-- 252
              + +  TT  Y +PE++    + G  I    DIW+LG+ LY +   T PF++  E   
Sbjct: 182 SSLETICGTTV-YMAPELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDEDDETKT 236

Query: 253 --AILNGQFEFLPYPNY-----SEQLRNLICKLLVQNPSQRPNVFQLL 293
              I+N       +PN+     S + ++LI +LL + PS+RP + Q+L
Sbjct: 237 KWKIVND------FPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 101/198 (51%), Gaps = 21/198 (10%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G L+  +  +      E+  +    Q+   +  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT-----TAQYRSPEMV-DIF 218
           +L++   + KL DFG+   ++ P +  Q  S    ++L+ +     TA+Y SPE++ D +
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNL 274
                D + DIWA G  L++L     PF+   E      I+  Q+ F     +   LR+L
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFT--AGFPTILRDL 502

Query: 275 ICKLLVQNPSQRPNVFQL 292
           I K+L++NP+ R  + Q+
Sbjct: 503 IKKILIKNPNNRLTIHQI 520

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 126/257 (49%), Gaps = 47/257 (18%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY E G L D++ ++   +L ESE +    Q+ Q VA  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 164 NVLISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMV--D 216
           N+L+  K    K+ DFG              ++ +E  D L  T+     Y SPE+V   
Sbjct: 204 NLLLDKKKRSIKIADFG--------------MAALETSDKLLETSCGSPHYASPEIVLGR 249

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLR 272
            + G P    SD+W+ GI L+ L     PF       +L    +G+++   +   S + +
Sbjct: 250 KYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAK 303

Query: 273 NLICKLLVQNPSQRPNVFQLLKQITNMQNAPYPIRDVQTVQRPSNHLNLMELHQNSATQN 332
           +LI ++LV +P++R  + Q+L      Q+      D ++  + ++ LNL+     + T N
Sbjct: 304 DLISRILVVDPNRRITIDQIL------QHELLTKYDQKSRSKSNSDLNLL-----NRTPN 352

Query: 333 IQSLNS-HSINENSMSN 348
           I S +S   I+E  +SN
Sbjct: 353 IVSFSSERDIDETILSN 369

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 88/190 (46%), Gaps = 33/190 (17%)

Query: 101  GSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDI 160
            GS ++F L+E+              +  + E E   +  QV  GV  +H     ++HRDI
Sbjct: 1168 GSIDLFDLIEF--------------KTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDI 1211

Query: 161  KIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRG 220
            K EN+++ ++   K+ DFGS   V   P           DV   T   Y +PE   +  G
Sbjct: 1212 KDENIIVDSQGFVKIIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGG 1257

Query: 221  LPIDEK-SDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLL 279
             P + K  DIWA+GI LY + +   PF    E  IL G+ +F      SEQ   LI K+L
Sbjct: 1258 SPYEGKPQDIWAIGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKIL 1315

Query: 280  VQNPSQRPNV 289
             +N  +RP +
Sbjct: 1316 NRNVQKRPTI 1325

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 101/202 (50%), Gaps = 30/202 (14%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           ++++++EY E+G L + +  R    L E+E ++   Q+  G++  H+L   ++HRD+K E
Sbjct: 103 DLYLVLEYAEKGELFNMLVER--GPLPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPE 158

Query: 164 NVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA---QYRSPEMVDIFRG 220
           N+L+  K   K+ DFG                   +D L  T+     Y +PE   I  G
Sbjct: 159 NLLLDNKLNIKIADFGMAA-------------LESEDKLLETSCGSPHYAAPE---IISG 202

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRN 273
           LP +   SD+W+ G+ L+ L     PF  E G    +L     G+FE       +++ ++
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262

Query: 274 LICKLLVQNPSQRPNVFQLLKQ 295
           L+ +LL  +PS+R  + ++LK 
Sbjct: 263 LLARLLTVDPSKRITIREILKH 284

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 133/274 (48%), Gaps = 46/274 (16%)

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PD  S    R E+  MKLL N+  V+   D       L       ++++EY E+G L + 
Sbjct: 69  PDSLSYGIER-EIIIMKLL-NHPNVLRLYDVWETNNNL-------YMVLEYAEKGELFNL 119

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           +  +    L E+E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG 
Sbjct: 120 LVEK--GPLPENEAIRFFRQIIIGMSYCHALG--IVHRDLKPENILLDHKLNIKIADFG- 174

Query: 181 VCGVIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIF 235
                        ++ +E +D L  T+     Y +PE+V    GLP    ++D+W+ G+ 
Sbjct: 175 -------------MAALETEDKLLETSCGSPHYAAPEIVS---GLPYHGLETDVWSCGVI 218

Query: 236 LYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
           L+ L     PF  E G    +L     G+FE       S++ ++L+ K+LV +P +R   
Sbjct: 219 LFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKS 278

Query: 290 FQLLKQITNMQNAPYPIRDVQTVQ---RPSNHLN 320
            ++LK    +Q  P  I+D +T++   R   +LN
Sbjct: 279 REILKHPL-LQKYP-SIKDSKTIRNLPREDTYLN 310

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 89/185 (48%), Gaps = 24/185 (12%)

Query: 116  GLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
            G ID  +    +  + E E   I  Q+  G+  +H     ++HRDIK ENV++ +K   K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 175  LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDIWALG 233
            + DFGS   V   P           DV   T   Y +PE   +  G P + K  DIWA+G
Sbjct: 1272 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLSGEPYEGKPQDIWAIG 1317

Query: 234  IFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
            I LY + +   PF    E  IL G+ +F    + SE    LI K+L+++  +RP    L+
Sbjct: 1318 ILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRP----LI 1371

Query: 294  KQITN 298
            ++I N
Sbjct: 1372 EEIFN 1376

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 102/227 (44%), Gaps = 40/227 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++MEYC  G L   +      ++ E  I  IM +V   +  +H  +
Sbjct: 83  TRYYGSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIH--K 137

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ +   KLCDFG    V +     Q ++          T  + +P
Sbjct: 138 DNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAP 188

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEF 261
           E+  I  G+  D K DIW+LGI  Y++     P+ +             +P  L G+   
Sbjct: 189 EV--IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGR--- 243

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ--ITNMQNAPYPI 306
               +YS  L+  I   L ++P +R +   LLK   I N +  P  I
Sbjct: 244 ----SYSPSLKEFIALCLDEDPKERLSADDLLKSKFIKNHKTTPTSI 286

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 112/230 (48%), Gaps = 25/230 (10%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNT-RLQNRLH 130
           E + ++ L + R ++    +   +A+L       + L+EY   G   DF++  +    L+
Sbjct: 211 EKNTLQRLNDGRGIIKLYFTFQDEASL-------YFLLEYAPNG---DFLSVIKKYGSLN 260

Query: 131 ESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRN 190
           +   +    Q+   +  +H  Q  +IHRDIK EN+L+    + KL DFG+   ++     
Sbjct: 261 QDCSVYYSAQILDAIDYLH--QKGVIHRDIKPENILLDKDMKVKLTDFGT-AKLVEKDET 317

Query: 191 PQELSYVEQDVLKNTTAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKG 249
            Q  + +E+      TA+Y SPE++ D +    +D K DIWA G  L+++     PF+  
Sbjct: 318 TQTYNLLERSKSFVGTAEYVSPELLNDNY----VDYKCDIWAFGCILFQMIAGKPPFKAT 373

Query: 250 GE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
            E      ++  Q+ F     +   +R+LI ++LV+NP QR +  Q+ K 
Sbjct: 374 NEYLTFQKVMKVQYAFT--AGFPLIIRDLIKQILVKNPEQRLDTLQVKKH 421

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 99/211 (46%), Gaps = 53/211 (25%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC    L +++  +    L E    ++  Q+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISAKNEYKLCDFG------------SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
           +L+  K   KL DFG            ++CG                      T  Y +P
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGILETICG----------------------TTVYMAP 196

Query: 213 EMVDI--FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPY-PNYSE 269
           E+++   + G  I    D W+LGI LY + + T PF++  E   +  +++ + Y P Y  
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDN 249

Query: 270 QL-----RNLICKLLVQNPSQRPNVFQLLKQ 295
                  + LI +LL ++P+QRP++ Q+L+ 
Sbjct: 250 DYIDSNGKELISQLLEKDPNQRPSLTQVLQH 280

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 82/180 (45%), Gaps = 20/180 (11%)

Query: 116  GLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
            G ID  +    +  + E E   I  QV  G+  +H     ++HRDIK ENV++ +K   K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDIWALG 233
            + DFGS   V   P           DV   T   Y +PE   +  G P + K  DIWALG
Sbjct: 1301 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLSGEPYEGKPQDIWALG 1346

Query: 234  IFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
            I LY + +   PF    E  IL G  +F      +E    LI K+L++    RP + ++ 
Sbjct: 1347 ILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIF 1404

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 138/298 (46%), Gaps = 41/298 (13%)

Query: 6   IGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKT 64
           +G + +G  L  GS  +V + K + +G  A +    I P     ++N +  K+    +  
Sbjct: 58  VGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIK---IVPKKVVRSTNAS--KKSNAANGN 112

Query: 65  SLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTR 124
               +  E+  MKL       +S+ +  A      N S E+F+++EY E G L D++ ++
Sbjct: 113 LPYGIEREIIIMKL-------ISHPNIMALYEVWENKS-ELFLVLEYVEGGELFDYLVSK 164

Query: 125 LQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN-EYKLCDFGSVCG 183
              +L E E +    Q+ QGVA  H     + HRD+K EN+L+  KN + K+ DFG    
Sbjct: 165 --GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPENLLVDKKNHQIKIADFG--MA 218

Query: 184 VIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWALGIFLYKLCY 241
            +       E S          +  Y SPE+V    + G P    SD+W+ GI L+ L  
Sbjct: 219 ALETTNKLLETSC--------GSPHYASPEIVMGKNYHGSP----SDVWSCGIILFALLT 266

Query: 242 YTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
              PF       +L    +G++  +P  N S + ++LI K+L+ +P  R  + ++L+ 
Sbjct: 267 GHLPFNDDNIKKLLLKVQSGKYH-MPQ-NISSEAQDLISKILIVDPRGRITINEVLQH 322

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 86/176 (48%), Gaps = 23/176 (13%)

Query: 117 LIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLC 176
           L DF+  +  +++ E E   I  Q+  G+  +H L   +IHRDIK EN++I ++   ++ 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDIWALGIF 235
           DFGS       P             + + T  Y SPE   + +G P + K  D+WALGI 
Sbjct: 822 DFGSAAYATNGPFQ-----------VFHGTIDYASPE---VLKGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKGGEPAILNGQFEFLPY--PNYSEQLRNLICKLLVQNPSQRPNV 289
           LY + +  TPF    E  I+  + E  P    N S+Q R LI K+L +    RP +
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKI 921

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 97/203 (47%), Gaps = 38/203 (18%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ +VT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           +L++ +   KL DFG V G IR        S +++D     T  + +PE+V       +D
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVV----CCEVD 192

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEFLPYPNYSEQ 270
              EK+DIW+LGI  Y+L     P  K             +P  L G F        S+ 
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPF--------SDA 244

Query: 271 LRNLICKLLVQNPSQRPNVFQLL 293
            ++ +   LV+ P+ RP+ + LL
Sbjct: 245 AKDFVAGCLVKTPADRPSAYNLL 267

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 108/230 (46%), Gaps = 36/230 (15%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E+  MK  R+N  VV++I++H +K  L       +++MEY E G L D +   L   L E
Sbjct: 562 EIIVMKESRHNN-VVNFINAHLSKGNL-------WIVMEYMEGGSLTDVVTHCL---LSE 610

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNP 191
            +I  +  +  +G+  +H+    +IHRDIK +NVL+S K + KL DFG  C  I      
Sbjct: 611 GQIGAVCRETLEGLKFLHS--KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCAQIN----- 662

Query: 192 QELSYVEQDVLKNT---TAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
                 + D+ + T   T  + +PE+V      P   K DIW+LGI + ++     P+  
Sbjct: 663 ------DIDLNRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLN 713

Query: 249 GGEPAIL-----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
                 L     NG  +     N S+   N + + L   P +R +  +LL
Sbjct: 714 EAPLKALYLIATNGTPKLKEPENLSDVFSNFLDRCLRVEPEERASAIELL 763

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 98/197 (49%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++  EYC    L D +   LQ R+  S  +++  Q+   V   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISAKNEYKLCDFGSV--CGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFR 219
           N+L+      KL DFG    C           ++    + +  TT  Y +PE++  + + 
Sbjct: 159 NILLDKNGNAKLTDFGFTREC-----------MTKTSLETICGTTV-YMAPELIKRESYD 206

Query: 220 GLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPN---YSEQLRNLIC 276
           G  I    DIW+LG+ LY +   + PF++  E          +P  N    SE  ++L+ 
Sbjct: 207 GFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLI 262

Query: 277 KLLVQNPSQRPNVFQLL 293
           KLL ++P++RP++ ++L
Sbjct: 263 KLLSKDPNERPSMQEIL 279

>KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {ON}
           Anc_3.177 YAR019C
          Length = 936

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 143/347 (41%), Gaps = 52/347 (14%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYID 90
           G +  VY A+           V  +K +   + T L  +  E+D +K L +    V+ I 
Sbjct: 38  GSYGIVYKAI-----NRRTEQVVAIKELYYNNDTELQDIMVEIDLLKNLDH----VNIIK 88

Query: 91  SHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
            H     L N    +++++E+   G L + M  R +  L+E E    + Q   G+  +H 
Sbjct: 89  YHGFIQKLSN----LYIILEFASHGSLKNLMMQRPEKHLNEKETRIYIKQTINGLVYLH- 143

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRN-PQELSYVEQDVLKNTTAQY 209
            +  +IHRDIK  N+L+ A N  KL DFG    V          L+++  +++ N  A  
Sbjct: 144 -EQGVIHRDIKAANLLLDASNTIKLADFGVSTSVANSAMTLAGSLNWMAPEIITNKGAS- 201

Query: 210 RSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP----AILNGQFEFLPYP 265
                            SDIW+LG  + +L     PF K  +     AI N    FLP  
Sbjct: 202 ---------------TLSDIWSLGATIIELLTGNPPFHKLMDINIYYAIENDV--FLPPE 244

Query: 266 NYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPYPIRDVQTVQRPSNHLNLMELH 325
           N S   +N++     +N  +RP+   LLK        P+     Q+ Q P N    ++  
Sbjct: 245 NLSTNCQNILNLCFQKNMFKRPSAVSLLKH-------PWLKDITQSTQLPEN----LDFK 293

Query: 326 QNSATQNIQSLNSHSIN--ENSMSNQNFQFRMPANVITAQSLPTREN 370
                Q  +      +N  ++ M NQN Q   P+ V +  S P ++N
Sbjct: 294 SAKFLQFREDFEKDDLNWDDDFMDNQNLQNIKPS-VESRSSSPVKDN 339

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 88/350 (25%), Positives = 149/350 (42%), Gaps = 75/350 (21%)

Query: 75  AMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEI 134
           A++ L N+  VV    +   +++L       + L+EY   G  +  M  +    L E+  
Sbjct: 234 ALQKLNNSHSVVRLFSTFQDESSL-------YFLLEYAPNGDFLSLM--KKYGSLDENCA 284

Query: 135 LQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQEL 194
                Q+   +  +H     +IHRDIK EN+L+  +   KL DFG+   ++ P  N    
Sbjct: 285 CYYGSQIIDAIDHLHV--SGIIHRDIKPENILLDGEMRIKLTDFGT-AKLLEPTNNSSSK 341

Query: 195 SYVEQDVLKNT---TAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
           S  +      +   TA+Y SPE++ D F     D + DIWA G  L+++     PF+   
Sbjct: 342 SKYDLSTRSKSFVGTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPPFKATN 397

Query: 251 E----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL-----LKQIT---- 297
           E      ++  Q+ F   P +   +R+L+ K+L++N  QR  + Q+      K+I     
Sbjct: 398 EYLTFQKVMKVQYAFT--PGFPLIIRDLVKKILIKNLDQRLTINQIKEHPFFKEINFKDG 455

Query: 298 ------------------NMQNAPYPIRDVQTVQRPSNHLNLMELHQNSA---------- 329
                             +MQ  P  I D +  ++P N   L++ HQ ++          
Sbjct: 456 SIWSSTPPDIKPYKINAKSMQTMP-GIGDKKQAKKPINA--LVKTHQTTSRPASNSSLEV 512

Query: 330 --TQNIQSLNSHSINENSMSNQNFQFRMPANVITAQSLPTRENSQAFINA 377
                + S NSH   E+ +    F  + P +  TAQ L   EN++  IN+
Sbjct: 513 TGNSTVYSSNSHDSTESDI----FVKKRPTDERTAQIL---ENARKGINS 555

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 111/231 (48%), Gaps = 30/231 (12%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E  A++ L N+  VV    +   +++L       + L+EY   G  +  M  +    L E
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDESSL-------YFLLEYAPNGDFLSLM--KKYGSLDE 277

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNP 191
           +       Q+   +  +H+    +IHRDIK EN+L+  + + KL DFG+   ++ P  N 
Sbjct: 278 TCARYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDGEMKIKLTDFGT-AKLLNPTNN- 333

Query: 192 QELSYVEQDVLKNT-----TAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
             +S  E D+   +     TA+Y SPE++ D F     D + DIWA G  L+++     P
Sbjct: 334 -SVSKPEYDLSTRSKSFVGTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPP 388

Query: 246 FEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           F+   E      ++  Q+ F   P +   +R+L+ K+LV+N  +R  + Q+
Sbjct: 389 FKATNEYLTFQKVMKVQYAFT--PGFPLIIRDLVKKILVKNLDRRLTISQI 437

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 101/220 (45%), Gaps = 40/220 (18%)

Query: 76   MKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEIL 135
            M    ++ Y    ++SH        GS ++F L+E              L+  + E E  
Sbjct: 867  MDFFEDDDYYYIELESHG-----ETGSIDLFDLIE--------------LKTNMTEFEAK 907

Query: 136  QIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELS 195
             I  Q+  G+  +H     ++HRDIK ENV++ +    KL DFGS          P E+ 
Sbjct: 908  LIFKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGSAA---YTKTGPFEV- 961

Query: 196  YVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPA 253
            +V        T  Y +PE++  + ++G P     DIWALG+ LY L Y   PF    E  
Sbjct: 962  FV-------GTIDYAAPEILGGNPYKGKP----QDIWALGVLLYTLIYKENPFYNVDE-- 1008

Query: 254  ILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
            IL GQ  F    N ++   +LI  +L ++ + RP++ +++
Sbjct: 1009 ILEGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 82/176 (46%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK 174
            G ID  +    +  + E E   I  QV   +  +H     ++HRDIK ENV++ ++   K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIK 1186

Query: 175  LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLP-IDEKSDIWALG 233
            L DFGS   V   P           DV   T   Y +PE   +  G P + +  DIWA+G
Sbjct: 1187 LIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGGEPYVGKPQDIWAIG 1232

Query: 234  IFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
            I LY + +   PF    E  IL  + +F       E   +LI ++L +NP++RP +
Sbjct: 1233 ILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTI 1286

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 128/287 (44%), Gaps = 52/287 (18%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRA----- 71
           VG+++  I+K +  G F +VY A   P    T+  V     +   DK   N +R      
Sbjct: 34  VGNYK--IMKQIGEGSFGKVYLASHKP----THRKVV----LKTSDKNDPNVVREVFYHR 83

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           + D + + R    +V+                +V++ +EYC    L + +      R+  
Sbjct: 84  QFDYLYITRLYEVIVT--------------ETKVWMALEYCPGKELYEHL--LALKRISL 127

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNP 191
            E  ++  Q+   +   H+L    +HRD+K+EN+L+  K   KL DFG     +      
Sbjct: 128 DECSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECV------ 179

Query: 192 QELSYVEQDVLKNTTAQYRSPEMVD--IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKG 249
              S  + D +  TT  Y +PE+ +   + G  I    DIWALG+ LY +   + PF++ 
Sbjct: 180 ---SKSQLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFDED 231

Query: 250 GEPAILNGQFEFLPYPN---YSEQLRNLICKLLVQNPSQRPNVFQLL 293
            E          +P  N    S   ++LI +LL ++P++RP++ ++L
Sbjct: 232 DEAKTKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/348 (25%), Positives = 154/348 (44%), Gaps = 59/348 (16%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISP-------PDPHTNSNVAC--LK 56
           IGT +    +T G + V     L  G F +V      P       P   T   VA   ++
Sbjct: 36  IGTRSRKRNVTFGPYIVG--STLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIR 93

Query: 57  R-VIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERG 115
           R  IV +      +  E++A+K L +   +V        +  L N  Y + +++EY   G
Sbjct: 94  RDTIVRNSDKETKIYREINALKHLTHPNIIV-------LEEILQNSKY-IGIVLEYASGG 145

Query: 116 GLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKL 175
               ++  + + RL E    ++  Q+  GV  MH+    L+HRD+K+EN+L+       +
Sbjct: 146 EFYKYI--QRKRRLKEVNASRLFSQLVSGVHYMHSKG--LVHRDLKLENLLLDKNENLMI 201

Query: 176 CDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQ---YRSPEMVDIFRGLPIDEKSDIWAL 232
            DFG V              +  ++VL  T+     Y +PE+V + R   +  K DIW+ 
Sbjct: 202 TDFGFVN------------EFSNENVLMKTSCGSPCYAAPELV-VSREAYVGVKVDIWSC 248

Query: 233 GIFLYKLCYYTTPFEKGGEPAILNGQ-----FEF-----LPYPNYSEQL-RNLICKLLVQ 281
           G+ LY +     P++   +P+  NG      + +     L +P+Y   L R+L+ ++LV 
Sbjct: 249 GVILYAMLAGYLPWDD--DPSNPNGDDISKLYSYITATPLKFPDYVNPLPRDLLRRILVA 306

Query: 282 NPSQRPNVFQLLKQITNMQNAPYPIRDVQTVQRPSNHLNLMELHQNSA 329
           +P +R      L  I N +    P R+  +V  PS+  N+M+L  + +
Sbjct: 307 DPRRR----YTLGHIENHEWL-LPRREFLSVS-PSDWDNIMKLKNDKS 348

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 96/198 (48%), Gaps = 28/198 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +       L E E +    Q+  G++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVD--HGPLPEREAINCFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT--TAQYRSPEMVDIFRGLP 222
           +L+ +    K+ DFG                  + D+L+ +  +  Y +PE+V    GLP
Sbjct: 158 LLLDSFYNIKIADFGMAA------------LQTDADLLETSCGSPHYAAPEIVS---GLP 202

Query: 223 IDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLI 275
            +   SD+W+ G+ L+ L     PF  E G    +L     GQFE       S   ++LI
Sbjct: 203 YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLI 262

Query: 276 CKLLVQNPSQRPNVFQLL 293
            K+LV +P QR  +  +L
Sbjct: 263 GKILVVDPRQRIKIRDIL 280

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 96/197 (48%), Gaps = 18/197 (9%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  M  +    L E        Q+   +  +H  +  +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM--KRFGTLSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRN-PQELSYVEQDVLKNTTAQYRSPEMV-DIFRGLP 222
           +L+    + KL DFG+   + R   N P +L+   +  +   TA+Y SPE++ D +    
Sbjct: 332 ILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV--GTAEYVSPELLNDNY---- 385

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKL 278
           +D + DIWA G  L+++     PF+   E      ++  Q+ F     +   LR+LI +L
Sbjct: 386 VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFT--AGFPMILRDLIKQL 443

Query: 279 LVQNPSQRPNVFQLLKQ 295
           LV+ P QR  + Q+ K 
Sbjct: 444 LVKKPEQRLTILQIEKH 460

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 97/205 (47%), Gaps = 25/205 (12%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++LMEY   G L   +  R +  L +      + Q+   +  MH  Q  +IHRD+K EN
Sbjct: 182 VYLLMEYLVNGELYKLL--RAKGPLDDIFASHYVYQMADALDYMH--QRNIIHRDVKPEN 237

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           +LI   N  KL DFG     I  PR  +  +          T  Y SPE++        D
Sbjct: 238 ILIGFDNTVKLTDFG---WSIINPRGTKRKTMC-------GTLDYLSPELI---ASKEYD 284

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNY-SEQLRNLICKLL 279
           +K D+WALG+  ++L   + PFE+  +      I+ G  +F   PN+ S   ++LI KLL
Sbjct: 285 DKVDVWALGVLTFELVVNSPPFEEDSKELTSKRIVRGDLKF---PNHISSDAQDLITKLL 341

Query: 280 VQNPSQRPNVFQLLKQITNMQNAPY 304
             N   R ++ ++ +     +N P+
Sbjct: 342 RHNSKDRISLREVKQHPWITKNRPF 366

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 100/224 (44%), Gaps = 45/224 (20%)

Query: 83  RYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVT 142
           RY  SY+   +           ++++MEYC  G +   +      ++ E  I  IM ++ 
Sbjct: 103 RYYASYLKDTS-----------LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELL 148

Query: 143 QGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVL 202
             +  +H  +  +IHRDIK  N+LI+ +   KLCDFG    + +     Q ++       
Sbjct: 149 VALHYIH--KDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNTMRRQTMA------- 199

Query: 203 KNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGE 251
              T  + +PE+  I  G+  D K+DIW++GI  Y++     PF +             +
Sbjct: 200 --GTPYWMAPEV--IMEGISYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSK 255

Query: 252 PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
           PA L G+       N+   L+  I   L ++P +RP   +LL +
Sbjct: 256 PARLEGK-------NHDPLLKEFIAMCLDEDPQERPTADKLLHE 292

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 93/203 (45%), Gaps = 19/203 (9%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
            V++LMEY   G L  + + R     ++      + Q+   +  MH+    +IHRDIK E
Sbjct: 212 RVYLLMEYLVNGEL--YKHLRSHGPFNDIVASHFVYQMADALDYMHSKH--IIHRDIKPE 267

Query: 164 NVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPI 223
           N+L+  +N  KL DFG     +   R                T  Y SPE++   +    
Sbjct: 268 NILLGFQNTLKLTDFGWSVTNLNNSRRRTLCG----------TMDYLSPELI---KSREY 314

Query: 224 DEKSDIWALGIFLYKLCYYTTPF-EKGGEPAILNGQFEFLPYPNY-SEQLRNLICKLLVQ 281
           D K D+WALG+  Y+L   T PF E   E      +   L +P++ S Q R++I KLL  
Sbjct: 315 DNKVDVWALGVLTYELLVGTPPFLEDSKEMTYKRIKRRDLKFPDHISSQARDIISKLLEY 374

Query: 282 NPSQRPNVFQLLKQITNMQNAPY 304
            P+ R  +  + K    ++N P+
Sbjct: 375 EPNARIALRDVKKHPWILKNRPF 397

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 122/278 (43%), Gaps = 52/278 (18%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRV-IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYI 89
           G F  VY A+       T   +  +K V +      +  L  E+  +  L++   + +YI
Sbjct: 22  GNFGDVYKAM-----DRTTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSP-LITNYI 75

Query: 90  DSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMH 149
            +     ++       +++MEYC  G   D +     N L E ++  I+ QVT G+  +H
Sbjct: 76  TTMLEDVSM-------WIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLH 128

Query: 150 ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQY 209
             +   IHRDIK  N+L++ +   KL DFG V G +R        S +++D     T  +
Sbjct: 129 EQRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYW 176

Query: 210 RSPEMVDIFRGLPID---EKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAIL 255
            +PE+V       +D   EK+DIW+LGI  Y+L     P  K             +P  L
Sbjct: 177 MAPEVV----CCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKL 232

Query: 256 NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
            G F        S+  +  +   LV+ P+ RP+ + LL
Sbjct: 233 QGSF--------SDAAKEFVAGCLVKVPADRPSAYDLL 262

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 100/214 (46%), Gaps = 59/214 (27%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC    L +++   ++ R+   E   +  Q+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLISAKNEYKLCDFG------------SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
           +L+  K + KL DFG            +VCG                      T  Y +P
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMVDI--FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPA----ILNGQFEFLPYPN 266
           E+++   + G  I    D W+LGI LY + +   PF++  +      I+N +      P 
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGAMPFDEEDDIKTKYRIVNNE------PF 246

Query: 267 YSEQL-----RNLICKLLVQNPSQRPNVFQLLKQ 295
           Y +       ++LI +LL ++PSQRP++ Q+L+ 
Sbjct: 247 YDDNFIDANGKDLIMQLLQKDPSQRPSLTQVLQH 280

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 116/278 (41%), Gaps = 53/278 (19%)

Query: 23  EIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVI----VPDKTSLNTLRAEVDAMKL 78
           EI K L  G F +VY         H  + + C  + +    +   T     R EV+    
Sbjct: 101 EIGKILGKGKFGKVYCV------KHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGS 154

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYE---VFVLMEYCERGGLIDFMNTRLQNRLHESEIL 135
            +           H     L+   Y+   V++LMEY   G L  F+       L+E+   
Sbjct: 155 FK-----------HKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKN--NGPLNETLAS 201

Query: 136 QIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELS 195
             + Q+   +  MH+    ++HRDIK EN+LI   N  KL DFG                
Sbjct: 202 YFVYQMANALDYMHS--KNILHRDIKPENILIGFNNTIKLTDFGWSV------------- 246

Query: 196 YVEQDVLKNT---TAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP 252
           Y E    + T   T  Y SPE++   +    + K D+WALG+  Y+L   + PFE+  + 
Sbjct: 247 YNEDGQKRKTLCGTIDYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFEEDTKE 303

Query: 253 A----ILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQR 286
                IL    +F P  N S Q R+LI +LL   PS+R
Sbjct: 304 MTYRRILRCDLKF-PL-NVSPQARDLIVRLLQFEPSKR 339

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 127/275 (46%), Gaps = 32/275 (11%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYID 90
           G ++ V   L +  D      V  L +  +  +  +  +  E +A++ L N+R +V    
Sbjct: 191 GAYSTV--MLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFF 248

Query: 91  SHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
           +   +++L       + L+EY   G  +  M  +    L E        Q+  G+  +H+
Sbjct: 249 TFQDESSL-------YFLLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS 299

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT----- 205
               +IHRDIK EN+L+    + K+ DFG+    I  P+N  E    E ++L  +     
Sbjct: 300 --KGIIHRDIKPENILLDKDMKVKITDFGT--AKILEPKNEDE-DNPEFNLLTRSKSFVG 354

Query: 206 TAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFE 260
           TA+Y SPE++ D +    +D + DIWA G  ++++     PF+   E      ++  Q+ 
Sbjct: 355 TAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYA 410

Query: 261 FLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
           F     +   +R+L+ ++L++ P QR  + Q+ K 
Sbjct: 411 FT--AGFPVVVRDLVKRILLKVPEQRLTIPQIEKH 443

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 119/253 (47%), Gaps = 26/253 (10%)

Query: 52  VACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEY 111
           V  L +  +  +  +  +  E +A++ L N+R +V    +   +A+L       + L+EY
Sbjct: 239 VKVLSKEYLIKQKKVKYVNIEKNALQKLNNSRGIVRLFFTFQDEASL-------YFLLEY 291

Query: 112 CERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN 171
              G  +  +  +    ++E        Q+   +  +H+    +IHRDIK EN+L+ ++ 
Sbjct: 292 APNGDFLSLI--KKFGSMNEDCASYYSAQIIDAIHFVHSRG--IIHRDIKPENILLDSEM 347

Query: 172 EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT-----TAQYRSPEMVDIFRGLPIDEK 226
           + KL DFG+   ++ P  +     +   D+L  +     TA+Y SPE+++       D +
Sbjct: 348 KVKLTDFGT-AKILEPKSSSSSSKHETYDLLTRSKSFVGTAEYVSPELLNDSYA---DSR 403

Query: 227 SDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQN 282
            DIWA G  ++++     PF+   E      ++  Q+ F     +   +R+L+ ++L++ 
Sbjct: 404 CDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFT--AGFPLVIRDLVKRILIKA 461

Query: 283 PSQRPNVFQLLKQ 295
           P QR  + Q+ K 
Sbjct: 462 PEQRLTISQIKKH 474

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 85/356 (23%), Positives = 151/356 (42%), Gaps = 66/356 (18%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKT--SLNTLRAEVDAM 76
           S   EI + +  G F  V+ A       H  +      ++I  ++T   ++ L  E+  +
Sbjct: 36  SRLYEIKECVGKGSFGDVFRA------THRQTGEVVAIKIINLEETQDDIDVLAQEIYFL 89

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
             LR   +V +Y  +     ++       +++ME+C  G   D +    ++RL E+++  
Sbjct: 90  SELRAP-FVTTYFKTFVEDVSM-------WIVMEFCGGGSCADLLKHLPEHRLSENKVAY 141

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY 196
           I+ +V  G+  +H+ +   IHRDIK  N+L++   E KL DFG V G I           
Sbjct: 142 IIREVLFGLDYLHSQKK--IHRDIKAANILLTDDGEVKLGDFG-VSGQIMA--------- 189

Query: 197 VEQDVLKNT----TAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG-- 250
                LK T    T  + +PE++   +    +EK+DIW+LGI   +L     P+ K    
Sbjct: 190 ----TLKRTTFVGTPYWMAPEII-AKKDNGYNEKADIWSLGITAIELLTGQPPYAKHDPM 244

Query: 251 ---------EPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ----IT 297
                    +P  L G+F        +   R+ I   L+++P  RP+  +LL        
Sbjct: 245 KVLVNIPLRKPPKLQGRF--------TGSARDFIALCLIKDPDLRPSAAELLGHKFLNKA 296

Query: 298 NMQNAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQF 353
           + + +    R+V  V+      N  +  ++S   N+   +       SM  QN+ F
Sbjct: 297 SWRGSGTLKREVDLVKALKKRTNYFKEPRHSVEDNVYPAD------GSMHLQNWNF 346

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 137/315 (43%), Gaps = 69/315 (21%)

Query: 3   QPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSN---------VA 53
           QP  G Y +G+  T+G            G F +V S     P    N N         + 
Sbjct: 49  QPTFGPYYLGS--TIGE-----------GEFGKVKSGWSRKPQ---NDNGLTIGKQVAIK 92

Query: 54  CLKRVIVPDKTS--LNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEY 111
            ++R  + +K    L   R E++A+KLL +   V         +  L N  Y + +++EY
Sbjct: 93  LIRRDTLAEKKDQELKVYR-EINALKLLSHPNIV-------KLEDVLQNSKY-IGIVLEY 143

Query: 112 CERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKN 171
              G    ++  +   RL E        Q+  GVA +H+    L+HRD+K+EN+L+   +
Sbjct: 144 ASGGEFYKYLQRK--KRLKEPLACSTFAQLISGVAYIHS--KGLVHRDLKLENLLLDKHS 199

Query: 172 EYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQ--YRSPEMVDIFRGLPID-EKSD 228
              + DFG V           E+S     ++K       Y +PE+V      P D  K+D
Sbjct: 200 NLVITDFGFV----------NEIS-TNNKLMKTPCGSPCYAAPELV--LSTKPYDARKAD 246

Query: 229 IWALGIFLYKLCYYTTPFEKGGEPAILNGQ-----FEF-----LPYPNYSEQL-RNLICK 277
           IW+ G+ LY +     P++   +P   +G      +E+     L +P+Y E L R+LI K
Sbjct: 247 IWSAGVILYAMLAGYLPWD--DDPENPDGSNIMRLYEYITKNNLKFPDYIEPLARDLIRK 304

Query: 278 LLVQNPSQRPNVFQL 292
           +LV  P  R N+ Q+
Sbjct: 305 ILVIQPKSRLNIVQV 319

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 135/299 (45%), Gaps = 50/299 (16%)

Query: 14  QLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRA-- 71
           Q+T G +   I   L  G F +V       P  +   +     ++I  DK   N+ +   
Sbjct: 38  QITFGPYY--IGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIVKNSEKEIK 95

Query: 72  ---EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128
              E++A+K L +   V         +  L N  Y + +++EY   G    ++  + + R
Sbjct: 96  IFREINALKHLTHPNIV-------KLEEVLQNSKY-IGIVLEYASGGEFYRYI--QRKRR 145

Query: 129 LHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPP 188
           L E+   ++  Q+  GV  MH+    L+HRD+K+EN+L+       + DFG V   ++  
Sbjct: 146 LKETAGCRLFTQLVSGVNYMHS--KGLVHRDLKLENLLLDKHENLVITDFGFVNEFLK-- 201

Query: 189 RNPQELSYVEQDVLKNTTAQ--YRSPEMVDIFRGLPID-EKSDIWALGIFLYKLCYYTTP 245
                    + D++K +     Y +PE+V      P +  K+DIW+ GI LY +     P
Sbjct: 202 ---------DNDLMKTSCGSPCYAAPELV--ISTKPYEARKADIWSCGIILYAMLAGYLP 250

Query: 246 FE------KGGEPAILNGQFEF-----LPYPNYSEQL-RNLICKLLVQNPSQRPNVFQL 292
           ++      +G + A L   + F     L +P Y   + R+L+ +LLV +P +R N+ Q+
Sbjct: 251 WDDDPQNPEGDDIARL---YYFITRTSLKFPEYISPIPRDLLRRLLVSDPRKRLNIRQI 306

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 136/306 (44%), Gaps = 49/306 (16%)

Query: 5   QIGTYNVGTQLTVGSHQVEIIKYLTS----GGFAQVYSALISPPDPHTNSNVACLKRVIV 60
           +IG + +G  L +GS     + Y  S         +  A+ +      +S+VA       
Sbjct: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAA----ST 71

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
           PD       R E+  MKLL N+  V+   D     + L       ++++EY ++G L + 
Sbjct: 72  PDSLPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSNL-------YMVLEYAQKGELFNL 122

Query: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180
           +  R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+  K   K+ DFG 
Sbjct: 123 LVER--GPLPEKEAIRFFRQIVIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFG- 177

Query: 181 VCGVIRPPRNPQELSYVE-QDVLKNTTA---QYRSPEMVDIFRGLPIDE-KSDIWALGIF 235
                        ++ +E +D L  T+     Y +PE+V    G+P     SD+W+ G+ 
Sbjct: 178 -------------MAALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVI 221

Query: 236 LYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
           L+ L     PF  E G    +L    +G++E       S   ++LI ++L  +P QR   
Sbjct: 222 LFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKA 281

Query: 290 FQLLKQ 295
             +LK 
Sbjct: 282 RDILKH 287

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 95/198 (47%), Gaps = 29/198 (14%)

Query: 97  TLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLI 156
           T H+     FVL ++   G L+  + T  Q R +E+     MCQ+   +  +H  +  ++
Sbjct: 79  TFHDSENLYFVL-DFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDALEYIHGCK--VV 133

Query: 157 HRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVD 216
           HRD+K EN+L+S++ +  + DFG    +          S+V        TA+Y SPE++ 
Sbjct: 134 HRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFV-------GTAEYVSPELL- 185

Query: 217 IFRGLPIDEK----SDIWALGIFLYKLCYYTTPFEKGGEPA----ILNGQFEFLPYPNYS 268
                 +  K    SDIWA+G  LY+    T PF    E A    I+N  + ++     S
Sbjct: 186 ------LQNKSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYM--VS 237

Query: 269 EQLRNLICKLLVQNPSQR 286
           + + +L+ K+LV +P  R
Sbjct: 238 QHITDLVSKILVLDPDSR 255

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 132/302 (43%), Gaps = 63/302 (20%)

Query: 6   IGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKT 64
           IG + +G  L  GS  +V + K + +G  A +                      IVP   
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIK---------------------IVPKTK 93

Query: 65  SLNT------LRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLI 118
           S  T      +  E+  MKL+ +   +  Y         +     E+F+++EY + G L 
Sbjct: 94  SSRTGSLPYGIEREIIIMKLISHPNVMGLY--------EVWENKLELFLVLEYVDGGELF 145

Query: 119 DFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE-YKLCD 177
           D++ +R   RL E E +    Q+ +G A  H     + HRD+K EN+L+  KN+  K+ D
Sbjct: 146 DYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPENLLLDKKNKRIKIAD 201

Query: 178 FGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWALGIF 235
           FG     ++      E S          +  Y SPE+V    + G P    SD+W+ GI 
Sbjct: 202 FG--MAALQTSNKLLETSC--------GSPHYASPEIVMGKNYNGGP----SDVWSCGII 247

Query: 236 LYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
           L+ L     PF       +L     G+++ +P  + S   ++LI ++LV +P +R ++ +
Sbjct: 248 LFALLTGHLPFNDDNIKRLLLKVQAGKYQ-MPQ-SVSSGAQDLISRILVVDPDKRISINE 305

Query: 292 LL 293
           +L
Sbjct: 306 IL 307

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 98/213 (46%), Gaps = 38/213 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++MEYC  G L   +   +   + E  I  IM ++   +  +H  +
Sbjct: 104 TRYYGSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--K 158

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ + + KLCDFG    + +     Q ++          T  + +P
Sbjct: 159 DNVIHRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAP 209

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEF 261
           E+  I  G+  D K DIW+LGI  Y++     P+ +             +PA L G+   
Sbjct: 210 EV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGR--- 264

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
                YS  L+  I   L ++P +R +  +L K
Sbjct: 265 ----QYSSGLKEFIALCLDEDPKERLSAEELQK 293

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 85/182 (46%), Gaps = 20/182 (10%)

Query: 114  RGGLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE 172
              G ID  +    +  + E E   I  QV  G+  +H+L   ++HRDIK ENV+I +K  
Sbjct: 1129 ESGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGY 1186

Query: 173  YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDIWA 231
             K+ DFGS   V   P           DV   T   Y +PE   +  G P + K  DIWA
Sbjct: 1187 VKIIDFGSAAYVKNGPF----------DVFVGTI-DYAAPE---VLAGNPYEGKPQDIWA 1232

Query: 232  LGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQ 291
            LGI LY + +   PF    E  I+ G   F    + +     LI K+L++   +RP++ +
Sbjct: 1233 LGILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINE 1290

Query: 292  LL 293
            + 
Sbjct: 1291 VF 1292

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 108/225 (48%), Gaps = 32/225 (14%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E + ++ L+N + ++S   +   +++L       + L+EY   G L+  M  R    ++E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDESSL-------YFLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNP 191
                   Q+   +  MH     +IHRD+K EN+L+    + KL DFG+    +    + 
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGT--ARLLDSTSE 309

Query: 192 QELSYVEQDVLKNT-----TAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
            +L Y   D+L  +     TA+Y SPE++ D +    +D + DIWA G  L+++     P
Sbjct: 310 DDLKY---DLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPP 362

Query: 246 FEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQR 286
           F+   E      ++  QF F     +   +R+L+  +L++NP +R
Sbjct: 363 FKANNEYLTFQKVMKVQFAFT--AGFPMTVRDLVKNILIKNPERR 405

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 127/290 (43%), Gaps = 41/290 (14%)

Query: 23  EIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS----LNTLRAEVDAMKL 78
           E+ + L  G F +VY         H  S   C  + I  ++      L  L+ EVD    
Sbjct: 101 EVGRKLGKGKFGKVYCV------RHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLG 154

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEIL--Q 136
           + +   +  Y   H  K         V++LME+   G L       L+N    +++L   
Sbjct: 155 MDHPNIIKLYAHFHDEK--------RVYLLMEHSINGELY----KSLKNNGPFNDVLASH 202

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY 196
            + Q+   +  MH  +  +IHRD+K ENVLI   N  KL DFG    ++ P  + ++   
Sbjct: 203 YIYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFG--WSILNPEGSKRKTLC 258

Query: 197 VEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILN 256
                    T  Y SPEM+        DE+ D+WALG+  Y+L     PFE+  +     
Sbjct: 259 --------GTIDYLSPEMIT---PREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYK 307

Query: 257 GQFEF-LPYP-NYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPY 304
              +  L +P + S+  ++LI KLLV + +QR ++  +      ++N P+
Sbjct: 308 RILKCDLNFPESISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILKNKPF 357

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 106/218 (48%), Gaps = 25/218 (11%)

Query: 75  AMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEI 134
           A++ L N+R ++    +   +A+L       + L+EY   G L+  M  +    L+E   
Sbjct: 225 ALQRLNNSRSIIRLFFTFQDEASL-------YFLLEYAPNGDLLSLM--KKFGSLNEECC 275

Query: 135 LQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVI-RPPRNPQE 193
                Q+   +  MH+    +IHRDIK EN+L+    + K+ DFG+   +  +PP    +
Sbjct: 276 CYYGAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYD 333

Query: 194 LSYVEQDVLKNTTAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE- 251
           L    +  +   TA+Y SPE++ D +     D +SDIWA G  ++++     PF+   E 
Sbjct: 334 LLTRSKSFV--GTAEYVSPELLNDNY----TDARSDIWAFGCIVFQMIAGKPPFKATNEY 387

Query: 252 ---PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQR 286
                ++  Q+ F     +   +R+L+ ++L++ P QR
Sbjct: 388 LTFQKVMKVQYAFT--AGFPTVVRDLVKRILIKAPEQR 423

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 131/282 (46%), Gaps = 32/282 (11%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS--LNTLRAEVDAM 76
           S   E+ + +  G F  VY A+    D  T + VA   +V+  ++T   ++ L  E+  +
Sbjct: 31  SELYEVQECVGKGNFGDVYKAI----DKSTGNTVAI--KVVNLEETDDEIDLLAQEIYFL 84

Query: 77  KLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQ 136
             L ++ Y+ +Y  +     ++       +++MEYC  G   D +    +  L E ++  
Sbjct: 85  AEL-HSPYITNYFSTFVEDVSM-------WIVMEYCGGGSCSDLLKCLPRGTLTEEKVAF 136

Query: 137 IMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSY 196
           I  ++ +G+  +H+ +   IHRDIK  N+L++   + KL DFG V G        Q ++ 
Sbjct: 137 ITREILRGLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSG--------QMMAT 185

Query: 197 VEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILN 256
             +D    T   + +PE++        +EK+DIW+LGI +++L     P  +     +L 
Sbjct: 186 RRRDTFVGTPF-WMAPEVI-ARSEQGYNEKADIWSLGITVFELLKGQPPLSQHDPMKVLM 243

Query: 257 GQFEFLP---YPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
                 P      YS  +R  +   L ++P++RP   +LLK 
Sbjct: 244 SIPSRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLKH 285

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 94/206 (45%), Gaps = 24/206 (11%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     +++LMEYC  G L   +      ++ E  I  IM ++   +  +H   
Sbjct: 83  TRYYGSYLKDTSLWILMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ +   KLCDFG    V +     Q ++          T  + +P
Sbjct: 140 --VIHRDIKAANVLITNEGSVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAP 188

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF----EKGGEPAILNGQFEFLPYPNYS 268
           E+  I  G+  D K DIW+LGI  Y++     P+           I+  +   L   +YS
Sbjct: 189 EV--IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYS 246

Query: 269 EQLRNLICKLLVQNPSQRPNVFQLLK 294
             L+  I   L ++P +R +   LL+
Sbjct: 247 SSLKEFIALCLDEDPKERLSADDLLR 272

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 131/296 (44%), Gaps = 51/296 (17%)

Query: 6   IGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKT 64
           IG + +G  L  GS  +V + K + +G  A V    I P    +  N             
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVK---IVPKTKSSRPNALPY--------- 102

Query: 65  SLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTR 124
               +  E+  MKL+ +   +  Y         +     E+F+++EY + G L D++ +R
Sbjct: 103 ---GIEREIIIMKLISHPNVMGLY--------EVWENKLELFLVLEYVDGGELFDYLVSR 151

Query: 125 LQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNE-YKLCDFGSVCG 183
              RL E E +    Q+ +G A  H+    + HRD+K EN+L+  KN+  K+ DFG    
Sbjct: 152 --GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPENLLLDKKNKRIKIADFG--MA 205

Query: 184 VIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSDIWALGIFLYKLCY 241
            ++      E S          +  Y SPE+V    + G P    SD+W+ GI L+ L  
Sbjct: 206 ALQTSNKLLETSC--------GSPHYASPEIVMGKTYNGGP----SDVWSCGIILFALLT 253

Query: 242 YTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
              PF       +L     G+++ +P    S + ++LI ++LV +P++R  +  +L
Sbjct: 254 GHLPFNDDNIKRLLLKVQAGKYQ-MPQA-ISLEAQDLISRILVVDPNKRITINDIL 307

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E +    Q+ QGV+  H+    + HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPE 265

Query: 164 NVLISAKNE-YKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRG 220
           N+L+  KN+  K+ DFG     +  P    + S          +  Y SPE+V    + G
Sbjct: 266 NLLLDKKNKSIKIADFG--MAALELPNKLLQTSC--------GSPHYASPEIVMGKSYHG 315

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLIC 276
            P    SD+W+ GI L+ L     PF       +L     G+F  +P    S + ++LI 
Sbjct: 316 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFR-MP-STLSPEAQDLIS 369

Query: 277 KLLVQNPSQRPNVFQLL 293
           ++LV +PS+R    ++L
Sbjct: 370 RILVIDPSKRITTDRIL 386

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 113/231 (48%), Gaps = 32/231 (13%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E +A++ L N+R +V    +   +++L       + L+EY   G  +  M  +    L+E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSL-------YFLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNP 191
                   Q+   +  +H+    ++HRDIK EN+L+    + KL DFG+   ++ P  N 
Sbjct: 266 DCACYYSAQIIDAIDFLHSKG--IVHRDIKPENILLDKDFKVKLTDFGT-AKILEPKPNT 322

Query: 192 QELSYVEQDVLKNT-----TAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
            + SY   D+L  +     TA+Y SPE++ D +    +D + DIWA G  L+++     P
Sbjct: 323 TD-SY---DLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPP 374

Query: 246 FEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           F+   E      ++  Q+ F     +   +R+L+  +L++ P+QR  + Q+
Sbjct: 375 FKATNEYLTFQKVMKVQYAFT--AGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 88/191 (46%), Gaps = 24/191 (12%)

Query: 104  EVFVLMEYCERG--GLIDFMN-TRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDI 160
            E +  ME    G  G ID  +   L+  + E E   I  QV  G+  +H     ++HRDI
Sbjct: 900  EEYYYMETPAHGETGSIDLFDLIELKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDI 957

Query: 161  KIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIF 218
            K ENV++ +K   KL D+GS       P           DV   T   Y +PE++   ++
Sbjct: 958  KDENVIVDSKGHVKLIDYGSAAYTKSGPF----------DVFVGTI-DYAAPEVLGGSVY 1006

Query: 219  RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKL 278
             G P     DIWA+GI LY + +   PF    E  I++G+  F    N SE    LI K+
Sbjct: 1007 DGKP----QDIWAIGILLYTIIFKENPFYNIDE--IMDGELRFNDAGNTSEACIKLIKKI 1060

Query: 279  LVQNPSQRPNV 289
            L ++   RP V
Sbjct: 1061 LNRSIVDRPCV 1071

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 107/230 (46%), Gaps = 28/230 (12%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E  A++ L N+  VV    +   +++L       + L+EY   G  +  M  +    L E
Sbjct: 229 EKTALQKLNNSHSVVRLFSTFQDESSL-------YFLLEYAPNGDFLSLM--KKNGSLDE 279

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSV----CGVIRP 187
           +       Q+   +  +H+    +IHRDIK EN+L+  +   KL DFG+       V   
Sbjct: 280 NCACYYGAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGTAKLLDSTVSST 337

Query: 188 PRNPQELSYVEQDVLKNTTAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
            +   +LS   +  +   TA+Y SPE++ D F     D + DIWA G  L+++     PF
Sbjct: 338 SKQKYDLSTRSKSFV--GTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPPF 391

Query: 247 EKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           +   E      ++  Q+ F   P +   +R+L+ K+L++N  QR  + Q+
Sbjct: 392 KATNEYLTFQKVMKVQYAFT--PGFPLIIRDLVKKILIKNLDQRLTISQI 439

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 105/244 (43%), Gaps = 41/244 (16%)

Query: 62  DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFM 121
           D+  +  ++ EV  +  ++    +  Y  S+    TL       ++++EYC  G L   +
Sbjct: 65  DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLL 117

Query: 122 NTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSV 181
                 ++ E  I  IM +V   +  +H     +IHRDIK  NVLI+ +   KLCDFG  
Sbjct: 118 R---PGKIDEKYIGIIMREVLIALKYIHKDN--VIHRDIKAANVLITNEGHVKLCDFGVA 172

Query: 182 CGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCY 241
             + +     Q ++          T  + +PE+  I  G+  D K DIW+LGI  Y++  
Sbjct: 173 AQLNQSSLKRQTMA---------GTPYWMAPEV--IMEGVSYDTKVDIWSLGITTYEIAT 221

Query: 242 YTTPF-----------EKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVF 290
              P+               +P  L G+       +YS  L+  I   L ++P +R +  
Sbjct: 222 GNPPYCDVEALRAMQLITKSKPPRLEGR-------HYSPMLKEFIALCLDEDPKERLSAD 274

Query: 291 QLLK 294
            LLK
Sbjct: 275 DLLK 278

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 110/230 (47%), Gaps = 25/230 (10%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNT-RLQNRLH 130
           E + ++ L + R V+    +   +A+L       + L+EY   G   DF++  +    L 
Sbjct: 206 EKNTLQRLNDGRGVIKLYFTFQDEASL-------YFLLEYAPNG---DFLSVIKKFGSLS 255

Query: 131 ESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRN 190
           +   +    Q+   +  +H     ++HRDIK EN+L+    + KL DFG+   ++     
Sbjct: 256 QECAVYYSAQILDAIDYLH--HKGIVHRDIKPENILLDKDMKVKLTDFGT-ARILEKDET 312

Query: 191 PQELSYVEQDVLKNTTAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKG 249
            Q  + +E+      TA+Y SPE++ D +    +D K DIWA G  L+++     PF+  
Sbjct: 313 TQTFNLLERSKSFVGTAEYVSPELLNDNY----VDYKCDIWAFGCILFQMIAGKPPFKAT 368

Query: 250 GE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ 295
            E      ++  Q+ F     +   +R+LI K+LV++P QR +  Q+ K 
Sbjct: 369 NEYLTFQKVMKVQYAFT--AGFPLVIRDLIKKILVKSPEQRLDASQIKKH 416

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 132/298 (44%), Gaps = 52/298 (17%)

Query: 31  GGFAQVYSALISPPDPHTNSNVAC-LKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYI 89
           G +  VY A+         +N  C +K++   D++ LN    E+D +K LR+   +V Y 
Sbjct: 19  GAYGVVYRAV------KRGTNKPCAIKQIEFEDESELNEHMLEIDLLKNLRHQN-IVEY- 70

Query: 90  DSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMH 149
                       ++E+++++EYC RG L D +       L E + +  + Q   G+  +H
Sbjct: 71  ------RGFIQKAHELYIILEYCARGSLRDILK---HGPLLEDDTVNYVTQTLYGLQYLH 121

Query: 150 ALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQY 209
             +  +IHRDIK  N+L++ +   KL DFG     +    N   ++Y         +  +
Sbjct: 122 --EQGVIHRDIKAANLLLTEEGIVKLADFG-----VSTRINRMAMTYA-------GSPNW 167

Query: 210 RSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGEPAILNGQFEFLPYP 265
            +PE   +  G      SDIW+LG  + +L     PF     +    AI+N   E++P  
Sbjct: 168 MAPE---VMTGQGASTVSDIWSLGATVVELLTGNPPFHNLVNESACYAIVNE--EYIPPL 222

Query: 266 NYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPYPIRDVQTVQRPSNHLNLME 323
             S + ++ + +   +N  +R    +LL  I            ++ +Q+P + +NL E
Sbjct: 223 TLSAECKDFLSRCFQKNMFKRATAQELLAHIW-----------LKKIQKPKSKINLAE 269

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 97/213 (45%), Gaps = 38/213 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++MEYC  G L   +      ++ E  I  I  ++   +  +H  +
Sbjct: 102 TRYYGSYLKDTSLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVITREILIALKYIH--K 156

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ +   KLCDFG    + +  +  Q ++          T  + +P
Sbjct: 157 DNIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTMA---------GTPYWMAP 207

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEF 261
           E+  I  G+  D K DIW+LGI  Y++     P+ +             +P  L G+   
Sbjct: 208 EV--IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGR--- 262

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
               NYS  L+  +   L ++P +R +   LLK
Sbjct: 263 ----NYSPLLKEFVALCLDEDPKERMSAEDLLK 291

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 86/190 (45%), Gaps = 33/190 (17%)

Query: 101  GSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDI 160
            GS ++F L+E+               + + E EI  +  QV  GV  +H     ++HRDI
Sbjct: 1213 GSIDLFDLIEFT--------------SNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDI 1256

Query: 161  KIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRG 220
            K EN+++  K   K+ DFGS   V   P           DV   T   Y +PE   +  G
Sbjct: 1257 KDENIIVDNKGFIKIIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGG 1302

Query: 221  LPIDEK-SDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLL 279
             P + K  DIWALGI LY + +   PF    E  IL G  +F    N S+    LI  +L
Sbjct: 1303 NPYEGKPQDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLIL 1360

Query: 280  VQNPSQRPNV 289
             +N  +RP +
Sbjct: 1361 NRNVFKRPTI 1370

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 95/206 (46%), Gaps = 24/206 (11%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +
Sbjct: 83  TRYYGSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIH--K 137

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ +   KLCDFG    V +     Q ++          T  + +P
Sbjct: 138 DNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAP 188

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF----EKGGEPAILNGQFEFLPYPNYS 268
           E+  I  G+  D K DIW+LGI  Y++     P+           I+  +   L   +YS
Sbjct: 189 EV--IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYS 246

Query: 269 EQLRNLICKLLVQNPSQRPNVFQLLK 294
             L+  I   L ++P +R +   LL+
Sbjct: 247 PSLKEFIALCLDEDPKERLSADDLLR 272

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 115/264 (43%), Gaps = 52/264 (19%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY    +++++MEYC  G L   +      ++ E  I  IM ++   VA ++  +
Sbjct: 86  THYYGSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELL--VALLYIHK 140

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+     KLCDFG    + +        S V +  +   T  + +P
Sbjct: 141 DNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQ--------SNVRRQTMAG-TPYWMAP 191

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPAILNGQFEF 261
           E+  I  G+  D K DIW+LGI  Y++     P+               +P  L G+   
Sbjct: 192 EV--IMEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGR--- 246

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQ--ITNMQNAPYPI-----------RD 308
                YS  L+  I   L ++P +R     LLK   I   +++P  I           RD
Sbjct: 247 ----QYSPLLKEFIALCLDEDPKERLAAEDLLKTRFIKTHKSSPTSILKELITRYLLHRD 302

Query: 309 VQTVQRPSNHLNLMELHQNSATQN 332
            + + R S   NL +  Q   TQN
Sbjct: 303 -KNINRESAMANLEDDEQIKGTQN 325

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 85/185 (45%), Gaps = 19/185 (10%)

Query: 111  YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            + E G +  F    L+  + E E   +  QV  G+  +H     ++HRDIK ENV++  K
Sbjct: 1057 HGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNK 1114

Query: 171  NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEK-SDI 229
               KL DFGS   V   P           DV   T   Y +PE   +  G P + K  DI
Sbjct: 1115 GFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGGEPYEGKPQDI 1160

Query: 230  WALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNV 289
            WA+G+ LY + Y   PF    E  IL+G          S +   LI K+L ++ S+RP +
Sbjct: 1161 WAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTI 1218

Query: 290  FQLLK 294
              +++
Sbjct: 1219 DDIME 1223

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 130/294 (44%), Gaps = 67/294 (22%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   ++  HAL   ++HRD+K EN
Sbjct: 94  LYLILEYAEKGELFNLLVDR--GPLPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPEN 149

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA----QYRSPEMVDIFRG 220
           +L+      K+ DFG              ++ ++ D     T+     Y +PE+V    G
Sbjct: 150 LLLDNDYNIKIADFG--------------MAALQTDARLLETSCGSPHYAAPEIVS---G 192

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPFEK--GGEPAIL----NGQFEFLPYPNYSEQLRN 273
           LP     SD+W+ G+ L+ L     PF++  G    +L     GQFE       S+  +N
Sbjct: 193 LPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQN 252

Query: 274 LICKLLVQNPSQRPNV-----------FQLLKQITNMQNAP------YPIRDVQTVQRPS 316
           LI ++LV +P+QR              +Q ++   +++N P      YP+ D        
Sbjct: 253 LISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLADA------G 306

Query: 317 NHLN-----------LMELHQNSATQNIQSLNSHSIN-ENSMSNQNFQFRMPAN 358
           NH N           ++  H   A + + +L  +  N E ++    ++F+  AN
Sbjct: 307 NHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQEAN 360

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 96/212 (45%), Gaps = 38/212 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY    +++V+MEYC  G L   +      ++ E  +  I+ ++   +  +H  +
Sbjct: 85  TRYYGSYLYDTKLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRKLLIALVYIH--K 139

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ +   KLCDFG    +       Q ++          T  + +P
Sbjct: 140 DNVIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMA---------GTPYWMAP 190

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPAILNGQFEF 261
           E+  I  G+  + K+DIW+LGI  Y++     P+               +P  L G+   
Sbjct: 191 EV--IMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR--- 245

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
               NYS  L+  I   L ++P +RP    LL
Sbjct: 246 ----NYSPLLKEFIALCLDEDPEERPTAEDLL 273

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 107/240 (44%), Gaps = 55/240 (22%)

Query: 73  VDAMKLLRNNRY--VVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLH 130
           ++ + +++ +R+  +V++IDS+  K  L       +V+MEY E G L D +   +   L 
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKGDL-------WVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 ESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRN 190
           E +I  +  +   G+A +H+    +IHRDIK +N+L+S   + KL DFG  C  I     
Sbjct: 771 EGQIGTVCKETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN---- 823

Query: 191 PQELSYVEQDVLKNTTA----QYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
                   +  LK TT      + +PE+V      P   K DIW+LGI + ++       
Sbjct: 824 --------EVHLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIE----- 867

Query: 247 EKGGEPAIL-------------NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
              GEP  L             NG  +     N  E L+  +   L  NP +R    +LL
Sbjct: 868 ---GEPPYLNETPLRALYLIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 126/276 (45%), Gaps = 51/276 (18%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYID 90
           G    VY+A     +  TN++VA +K++ +  +     +  E+  MK  ++   +V++ID
Sbjct: 676 GASGGVYTAY----EVGTNASVA-IKQMNLEKQPKKELIINEILVMKASKHAN-IVNFID 729

Query: 91  SHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
           S+  +  L       +V+MEY E G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 730 SYLLRGDL-------WVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 779

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYR 210
               +IHRDIK +NVL+S   E KL DFG  C  I       E++     ++   T  + 
Sbjct: 780 KG--VIHRDIKSDNVLLSMSGEIKLTDFG-FCAQI------NEINLKRTTMV--GTPYWM 828

Query: 211 SPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL-------------NG 257
           +PE+V      P   K DIW+LGI + ++          GEP  L             NG
Sbjct: 829 APEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GEPPYLNETPLRALYLIATNG 877

Query: 258 QFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
             E     + S+ L++ +   L  NP +R    QLL
Sbjct: 878 TPELKDADSLSDDLKSFLGWCLHVNPDERATASQLL 913

>Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W
           (REAL)
          Length = 523

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 108/238 (45%), Gaps = 46/238 (19%)

Query: 85  VVSYIDSHAAKATLHNGSY------EVFVLMEYCERGGLIDFMNT--RLQNR-------- 128
           +V  +  H    T +   Y      E+ +LMEY + G L   ++   R   R        
Sbjct: 241 IVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRETISNKKT 300

Query: 129 -LHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRP 187
             +E  I +I C V  G+  ++  Q  +IHRDIK  NVLI++K + KLCDFG    +I  
Sbjct: 301 WFNELTISKIACGVLNGLDHLYR-QYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLI-- 357

Query: 188 PRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFE 247
             N    ++V        T+ Y SPE +   +G     K D+W+LG+ + +L   T  F 
Sbjct: 358 --NSIADTFV-------GTSTYMSPERI---QGNVYSIKGDVWSLGLMIIELV--TGEFP 403

Query: 248 KGGEPAILNGQFEFL------PYPN------YSEQLRNLICKLLVQNPSQRPNVFQLL 293
            GG     +G  + L      P P       +S++L + + +  ++N  +R ++ +LL
Sbjct: 404 LGGHNDTPDGILDLLQRIVNEPSPRLPKGRVFSKELTDFVNRCCIKNERERSSINELL 461

>TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.335
           YDL159W
          Length = 495

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 134/293 (45%), Gaps = 53/293 (18%)

Query: 28  LTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSL--NTLRAEVDAMKLLRNNRYV 85
           + SG    V  AL  P     +S +   K + V +   L  N L  E+  MK +  +  +
Sbjct: 170 IGSGNSGTVIKALHVP-----DSKIVAKKVIPVENNNHLVVNQLVRELTIMKSVHPHENI 224

Query: 86  VSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNT------RLQNRLHESE-----I 134
           VS+  ++  ++    GS E+ +LMEY   G L   ++       R QN   E       I
Sbjct: 225 VSFYGAYYTQS----GSNEIVILMEYMNCGSLDKILSVYGRYCQRRQNLREEPWFNGLVI 280

Query: 135 LQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQEL 194
            +I   V  G++ ++  +  +IHRDIK  NVLI+++ + K+CDF    GV +   N    
Sbjct: 281 SKISYAVLNGLSYLYE-KYKIIHRDIKPSNVLINSRGQVKICDF----GVSKKLINSIAD 335

Query: 195 SYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAI 254
           ++V        T+ Y SPE +   +G     K D+W+LG+ + +L   T  F  GG    
Sbjct: 336 TFV-------GTSTYMSPERI---QGNVYSTKGDVWSLGLMIIELV--TGEFPLGGRNDT 383

Query: 255 LNGQFEFL------PYP--------NYSEQLRNLICKLLVQNPSQRPNVFQLL 293
            NG  + L      P P        N+S ++ + + +  V++ ++R ++ +LL
Sbjct: 384 ANGILDLLQRIVNEPSPRLPSGGGYNFSREMIDFVNRCCVKDETERSSINELL 436

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 130/291 (44%), Gaps = 48/291 (16%)

Query: 27   YLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTL----RAEVDAMKLLRNN 82
            ++  G F QVYSA+        N  +  +K + + D T++  +    + E+  +++L + 
Sbjct: 1039 FIGGGTFGQVYSAI-----NLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHP 1093

Query: 83   RYVVSY-IDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMC-Q 140
              V  Y ++ H  K         V + MEYCE G L   ++     R+ +  + Q+   +
Sbjct: 1094 NIVQYYGVEVHRDK---------VNIFMEYCEGGSLASLLD---HGRIEDEMVTQVYTFE 1141

Query: 141  VTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVI----RPPRNPQELSY 196
            + +G+A +H  Q  ++HRDIK EN+L+      K  DFG+   V+    R  RN     +
Sbjct: 1142 LLEGLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDF 1199

Query: 197  -VEQDVLKNT--TAQYRSPEMVDIFRGLPIDEK---SDIWALGIFLYKLCYYTTPFEK-G 249
             VE   L     T  Y +PE +    G  +  K    D+WALG  + ++     P+    
Sbjct: 1200 GVETKSLNEMMGTPMYMAPETIS---GSAVKGKLGADDVWALGCVVLEMATGRRPWSNLD 1256

Query: 250  GEPAIL----NGQFEFLPYPNYSEQL---RNLICKLLVQNPSQRPNVFQLL 293
             E AI+     G+   L  PN  E     R  + + LVQ+P+ R    +LL
Sbjct: 1257 NEWAIMYHVAAGRIPQL--PNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 101/197 (51%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   +L E+E +    Q+ QGV+  H+    + HRD+K E
Sbjct: 226 ELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICHRDLKPE 281

Query: 164 NVL-ISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRG 220
           N+L    K   K+ DFG     +  P+   + S          +  Y SPE+V    + G
Sbjct: 282 NLLIDKKKKSIKIADFG--MAALELPKKLLQTSC--------GSPHYASPEIVMGKSYHG 331

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----NGQFEFLPYPNYSEQLRNLIC 276
            P    SD+W+ GI L+ L     PF       +L     G+++ +P  N S++ ++LI 
Sbjct: 332 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQ-MP-KNLSDEAKDLIS 385

Query: 277 KLLVQNPSQRPNVFQLL 293
           ++LV +PS+R    ++L
Sbjct: 386 RILVVSPSKRLTTVEIL 402

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 93/196 (47%), Gaps = 14/196 (7%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  M  +    L+E        Q+  G+  +H  +  +IHRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           +L+    + KL DFG+   ++      +E     +      TA+Y SPE+++      +D
Sbjct: 334 ILLDKSMKVKLTDFGT-AKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPELLN---DSWVD 389

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLV 280
            K DIWA G  L+++     PF+   E      ++  Q+ F     +   +R+L+ ++LV
Sbjct: 390 HKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFT--AGFPMVVRDLVKQILV 447

Query: 281 QNPSQRPNVFQLLKQI 296
           + P  R  + Q+ K +
Sbjct: 448 KKPEHRLTIPQIEKHL 463

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 94/206 (45%), Gaps = 24/206 (11%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++ME+C  G L   +      ++ E  I  IM ++   +  +H   
Sbjct: 83  TRYYGSYLKDTSLWIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ +   KLCDFG    V        + S   Q +    T  + +P
Sbjct: 140 --VIHRDIKAANVLITNEGNVKLCDFGVAAQV-------NQTSLRRQTMAG--TPYWMAP 188

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF----EKGGEPAILNGQFEFLPYPNYS 268
           E+  I  G+  D K DIW+LGI  Y++     P+           I+  +   L   +YS
Sbjct: 189 EV--IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYS 246

Query: 269 EQLRNLICKLLVQNPSQRPNVFQLLK 294
             L+  I   L ++P +R +   LLK
Sbjct: 247 TSLKEFIALCLDEDPKERLSADDLLK 272

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 96/198 (48%), Gaps = 21/198 (10%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E+       Q+   V ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRN-----PQELSYVEQDVLKNTTAQYRSPEMV-DIF 218
           +L+    + KL DFG+   +   P N     P    Y +       TA+Y SPE++ D +
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG-TAEYVSPELLNDNY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNL 274
                D + DIWA G  LY++     PF+   E      ++  Q+ F     + + +++L
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFT--AGFPQIVKDL 367

Query: 275 ICKLLVQNPSQRPNVFQL 292
           + KLLV++P+ R  + Q+
Sbjct: 368 VKKLLVRDPNDRLTIKQI 385

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 111/231 (48%), Gaps = 30/231 (12%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E  A++ L N+  VV    +   +++L       + L+EY   G  +  M  +    + E
Sbjct: 228 EKTALQKLNNSLSVVRLFSTFQDESSL-------YFLLEYAPNGDFLSLM--KKYGSIDE 278

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRN- 190
           +       Q+   +  +H+    +IHRDIK EN+L+  +   KL DFG+   ++ P  N 
Sbjct: 279 NCACYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGT-AKLLSPTSNS 335

Query: 191 ---PQ-ELSYVEQDVLKNTTAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
              P+ +LS   +  +   TA+Y SPE++ D F     D + DIWA G  L+++     P
Sbjct: 336 VSKPKYDLSTRSKSFV--GTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPP 389

Query: 246 FEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           F+   E      ++  Q+ F   P +   +R+L+ ++LV+N  QR  + Q+
Sbjct: 390 FKATNEYLTFQKVMKVQYAFT--PGFPLVIRDLVKRILVKNLDQRLTINQI 438

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 105/227 (46%), Gaps = 28/227 (12%)

Query: 75  AMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEI 134
           A++ L N+R ++    +   +A+L       + L+EY   G  +  M  +    L+E   
Sbjct: 221 ALQRLNNSRSIIRLFFTFQDEASL-------YFLLEYAPNGDFLSVM--KKYGSLNEECA 271

Query: 135 LQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQEL 194
                Q+   +  MH     +IHRDIK EN+L+    + K+ DFG+   +        + 
Sbjct: 272 CYYGAQILDAIGFMHTRG--IIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKT 329

Query: 195 SYVEQDVLKNT-----TAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKG 249
           SY   ++L  +     TA+Y SPE+++       D + DIWA G  LY++     PF+  
Sbjct: 330 SY---ELLTRSKSFVGTAEYVSPELLNDNYS---DSRCDIWAFGCILYQMIAGKPPFKAT 383

Query: 250 GE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
            E      ++  Q+ F     +   +R+LI ++L++ P QR  + Q+
Sbjct: 384 NEYLTFQKVMKVQYAFT--AGFPTIIRDLIKRILLKVPEQRLTIGQI 428

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 90/202 (44%), Gaps = 19/202 (9%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++LMEY   G +   +  RL    ++      + Q+   +  MH  +  +IHRDIK EN
Sbjct: 177 VYLLMEYLVNGEMYKLL--RLHGPFNDILASDYIYQIANALDYMH--KKNIIHRDIKPEN 232

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPID 224
           +LI   N  KL DFG    +I PP N ++            T  Y SPEMV+       D
Sbjct: 233 ILIGFNNVIKLTDFG--WSIINPPENRRKTVC--------GTIDYLSPEMVE---SREYD 279

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGEPAILN--GQFEFLPYPNYSEQLRNLICKLLVQN 282
              D WALG+  ++L     PFE+  +          +     N S+  ++LI KLL  +
Sbjct: 280 HTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYD 339

Query: 283 PSQRPNVFQLLKQITNMQNAPY 304
           P  R  +  +      ++N P+
Sbjct: 340 PKDRMRLGDVKMHPWILRNKPF 361

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 98/213 (46%), Gaps = 38/213 (17%)

Query: 97  TLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQ 152
           T + GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +
Sbjct: 101 TRYYGSYLKNTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKFIH--K 155

Query: 153 PPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSP 212
             +IHRDIK  NVLI+ +   KLCDFG    + +     Q ++          T  + +P
Sbjct: 156 DNIIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRTLRRQTMA---------GTPYWMAP 206

Query: 213 EMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPAILNGQFEF 261
           E+  I  G+  D K DIW+LGI  Y++     P+               +P  L G+   
Sbjct: 207 EV--IMEGVYYDTKVDIWSLGITAYEISTGNPPYCDVEALRAMQLITKSKPPRLEGR--- 261

Query: 262 LPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
               NY+  ++  I   L ++P++R +  +LLK
Sbjct: 262 ----NYTPLIKEFIALCLDEDPNERLSADELLK 290

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 97/200 (48%), Gaps = 32/200 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   ++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GPLPEREAIKCFKQIIIAISYCHALG--IVHRDLKPEN 157

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTA----QYRSPEMVDIFRG 220
           +L+      K+ DFG              ++ ++ D     T+     Y +PE+V    G
Sbjct: 158 LLLDNSYNIKIADFG--------------MAALQTDAGMLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----NGQFEFLPYPNYSEQLRN 273
           LP +   SD+W+ G+ L+ L     PF  E G    +L     GQFE       S   ++
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260

Query: 274 LICKLLVQNPSQRPNVFQLL 293
           LI ++LV +P+QR  +  +L
Sbjct: 261 LIRRILVVDPTQRIKIRDIL 280

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 97/215 (45%), Gaps = 43/215 (20%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
            V++LMEY   G L  + + R+    ++      + Q+   +  MH     ++HRDIK E
Sbjct: 212 RVYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPE 267

Query: 164 NVLISAKNEYKLCDFG------------SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRS 211
           N+LI  +N  KL DFG            ++CG                      T  Y S
Sbjct: 268 NILIGFQNTLKLTDFGWSVISTTGAKRKTLCG----------------------TLDYLS 305

Query: 212 PEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEF-LPYPN-YSE 269
           PE+V  +R    DEK D+WALG+  Y+L   T PFE+  +           L +P+  S 
Sbjct: 306 PELVK-YREY--DEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPDQMSI 362

Query: 270 QLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPY 304
             R+LI +LL  +PS R ++  +L     ++N P+
Sbjct: 363 DARDLIGRLLENDPSTRISLKDVLSHPWIVKNKPF 397

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 120/275 (43%), Gaps = 36/275 (13%)

Query: 27  YLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVV 86
           +L  GGFA+ +              VA   ++ +  + + N L +E+   K +R+   +V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRHQN-IV 158

Query: 87  SYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+     Q+   + 
Sbjct: 159 HFIDCFE-------DDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTT 206
            MH+    +IHRD+K+ N+        K+ DFG +  +I    N  E  Y         T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYT-----ICGT 258

Query: 207 AQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPN 266
             Y +PE++   + +    + DIW+LG+ ++ +     PF+      I    ++ + + N
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTI----YDRIKHCN 314

Query: 267 Y--------SEQLRNLICKLLVQNPSQRPNVFQLL 293
           Y        S+ ++ LI  +L  NP +RP + ++L
Sbjct: 315 YSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 112/239 (46%), Gaps = 47/239 (19%)

Query: 73  VDAMKLLRNNRY--VVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLH 130
           ++ + +++ +R+  +V++IDS+     L +G  +++V+MEY E G L D +   +   L 
Sbjct: 654 INEILVMKGSRHPNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 131 ESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRN 190
           E +I  +  +   G+  +H+    ++HRDIK +N+L+S   + KL DFG  C  I     
Sbjct: 704 EGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSISGDIKLTDFG-FCAQI----- 755

Query: 191 PQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
             E++     ++   T  + +PE+V      P   K DIW+LGI + ++          G
Sbjct: 756 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIE--------G 801

Query: 251 EPAIL-------------NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
           EP  L             NG  E     N S  LRN +   L  +P QR +   LL  +
Sbjct: 802 EPPYLNETPLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPEQRASATDLLNDV 860

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 120/292 (41%), Gaps = 45/292 (15%)

Query: 23  EIIKYLTSGGFAQVYSALISPPDPHTNSNVAC-LKRVIVPDKTSLNT---LRAEVDAMKL 78
           E+ K L  G F +VY         H  S   C LK +   +    N     R EV+    
Sbjct: 109 EMGKILGKGKFGKVYCV------RHIPSGFICALKAMEKKEIIQYNIEKQFRREVEIQSS 162

Query: 79  LRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIM 138
           LR+      Y   H  K         V+++MEY   G L   +  R  N   +      +
Sbjct: 163 LRHPNLTQLYGYFHDEK--------RVYLVMEYLVNGELYKHLKGR--NHFSDEVASYYV 212

Query: 139 CQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVE 198
            Q+   +  MH  +  ++HRDIK EN++I   N  KL DFG               S + 
Sbjct: 213 YQMAGALDYMH--ERNILHRDIKPENIIIGFNNVIKLTDFG--------------WSVIN 256

Query: 199 QDVLKNTT----AQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAI 254
               K  T      Y SPE++   +    DEK D+WALG+  Y+L   + PFE+  +   
Sbjct: 257 SKGFKRKTLCGTVDYLSPELI---KSREYDEKVDVWALGVLTYELLVGSPPFEEESKELT 313

Query: 255 LNGQFEF-LPYPNYSE-QLRNLICKLLVQNPSQRPNVFQLLKQITNMQNAPY 304
                +  L +P++ +   R+LI +LL  +P+ R  +  +      ++N PY
Sbjct: 314 YKRILKRNLVFPDHIDPDARHLISRLLEYDPANRIALKDVRGHSWILKNQPY 365

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 96/198 (48%), Gaps = 21/198 (10%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E        Q+   V ++H++   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELS-----YVEQDVLKNTTAQYRSPEMV-DIF 218
           +L+    + KL DFG+   +   P N  +       Y +       TA+Y SPE++ D +
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVG-TAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNL 274
                D + DIWA G  LY++     PF+   E      ++  Q+ F     + + +++L
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFT--AGFPQIVKDL 367

Query: 275 ICKLLVQNPSQRPNVFQL 292
           + KLLV++P+ R  + Q+
Sbjct: 368 VKKLLVRDPNDRLAIEQI 385

>KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 483

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 126/298 (42%), Gaps = 51/298 (17%)

Query: 20  HQVEIIKYLTSGGFAQVYSALI-----SPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVD 74
            Q ++++ +  G F  VY A        P DP    NV    + I         L    +
Sbjct: 5   QQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCI--------NLEHSNE 56

Query: 75  AMKLLRNNRYVVSYIDSHAAKATLHNGSY----EVFVLMEYCERGGLIDFMNTRLQNRLH 130
            + LL    Y +S +  H    T + G++     ++++MEYC  G L++ +  R  +RL 
Sbjct: 57  PIDLLLKEIYFLSTL--HCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLL--RYYSRLT 112

Query: 131 ESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRN 190
           E     I+ QV   +  +H  +  LIHRD+K  N+L++   E +L D G V G ++    
Sbjct: 113 EQTTCFIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLG-VTGQLKFNST 169

Query: 191 PQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
                 +   V    T  + +PE   I +    D K DIW+LGI   +L          G
Sbjct: 170 RHGGKNLNTFV---GTPFWMAPE---IIKNQSYDGKCDIWSLGITTLELL--------NG 215

Query: 251 EPAI--LNGQFEFLPYP--NYSEQLRNL---------ICKLLVQNPSQRPNVFQLLKQ 295
           +P +  L+     +  P  N    LRN+         I   L Q+P+QRP   QLL+ 
Sbjct: 216 KPPMSHLDSMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQH 273

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 34/201 (16%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIE 163
           +++V+MEYC  G L   +      ++ E  +  I+  +   VA ++  +  +IHRDIK  
Sbjct: 94  KLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRNLL--VALLYIHKDNVIHRDIKAA 148

Query: 164 NVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPI 223
           NVLI+     KLCDFG    +       Q ++          T  + +PE+  I  G+  
Sbjct: 149 NVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAPEV--IMEGVYY 197

Query: 224 DEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPAILNGQFEFLPYPNYSEQLR 272
           + K+DIW+LGI  Y++     P+               +P  L G+       NYS  L+
Sbjct: 198 NTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR-------NYSPLLK 250

Query: 273 NLICKLLVQNPSQRPNVFQLL 293
             I   L ++P  RP   +LL
Sbjct: 251 EFIALCLDEDPEARPTAEELL 271

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 129/279 (46%), Gaps = 51/279 (18%)

Query: 31  GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYID 90
           G    VY+A     +  TN++VA +K++ +  +     +  E+  MK  ++ + +V++ID
Sbjct: 632 GASGGVYTAY----EVGTNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-QNIVNFID 685

Query: 91  SHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHA 150
           S+  K  L       +V+MEY E G L D +   +   L E++I  +  +  +G+  +H+
Sbjct: 686 SYVLKGDL-------WVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLHS 735

Query: 151 LQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYR 210
               +IHRDIK +N+L+S   E KL DFG  C  I       E++     ++   T  + 
Sbjct: 736 KG--VIHRDIKSDNILLSMNGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWM 784

Query: 211 SPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL-------------NG 257
           +PE+V      P   K DIW+LGI + ++          GEP  L             NG
Sbjct: 785 APEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GEPPYLNETPLRALYLIATNG 833

Query: 258 QFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
             +       S +L++ +   L  NP  R +  +LL+ +
Sbjct: 834 TPKLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 139/303 (45%), Gaps = 51/303 (16%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS 65
            G Y VG+  T+G  +   +K     G+++  S+ +  P       +  ++R  +P  + 
Sbjct: 37  FGPYIVGS--TLGEGEFGKVKM----GWSKTSSSSMDVPK---QVAIKLIRRDTIPKNSE 87

Query: 66  LNT-LRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTR 124
               +  E++A+K L N+  +V        +  L N  Y + +++EY   G    ++  +
Sbjct: 88  KEVKIYREINALKHL-NHPNIVRL------EEVLQNSKY-IGIVLEYASGGEFYKYIQKK 139

Query: 125 LQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGV 184
              RL ES   ++  Q+  GV  MH+    L+HRD+K+EN+L+       + DFG V   
Sbjct: 140 --RRLKESAACRLFAQLISGVYYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVNEF 195

Query: 185 IRPPRNPQELSYVEQDVLKNTTAQ--YRSPEMVDIFRGLPID-EKSDIWALGIFLYKLCY 241
           +            E +++K +     Y +PE+V   R  P +  K+DIW+ G+ +Y +  
Sbjct: 196 L-----------PENELMKTSCGSPCYAAPELVVTAR--PYEARKADIWSCGVIMYAMLA 242

Query: 242 YTTPFEKGGEPAILNGQ-----FEF-----LPYPNYSEQL-RNLICKLLVQNPSQRPNVF 290
              P++   +P   +G      + +     L +P+Y   + R+L+  +LV +P +R  + 
Sbjct: 243 GYLPWDD--DPENPDGDDIGKLYRYITRTPLKFPDYIAPVPRDLLRAILVADPKKRITIA 300

Query: 291 QLL 293
           Q L
Sbjct: 301 QTL 303

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 83/181 (45%), Gaps = 21/181 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            + E G +  F    L+  + E E   I  QV  G+  +H     ++HRDIK EN+++  K
Sbjct: 1102 HGETGSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNK 1159

Query: 171  NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSD 228
               KL DFGS   V   P           DV   T   Y +PE++  D + G P     D
Sbjct: 1160 GFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVLGGDPYEGKP----QD 1204

Query: 229  IWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPN 288
            IWA+G+ LY + +   PF    E  IL+G          SE+   LI ++L ++  +RP 
Sbjct: 1205 IWAIGVLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPT 1262

Query: 289  V 289
            +
Sbjct: 1263 I 1263

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 97/209 (46%), Gaps = 38/209 (18%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLI 156
           GSY     ++++M+YC  G +   +      ++ E  I  IM ++   +  +H  +  +I
Sbjct: 110 GSYLKDTNLWIIMDYCAGGSIRTLLR---PGKIDEKYIGIIMREILIALQYIH--KDNVI 164

Query: 157 HRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVD 216
           HRDIK  NVL++ + + KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 165 HRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKLRRQTMA---------GTPYWMAPEV-- 213

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILNGQFEFLPYP 265
           I  G   D K+DIW+LGI  Y++     P+ +             +PA L G+       
Sbjct: 214 IMEGAYYDTKADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGR------- 266

Query: 266 NYSEQLRNLICKLLVQNPSQRPNVFQLLK 294
           +YS  L+  I   L ++P +R +  +L K
Sbjct: 267 SYSTSLKEFIALCLDEDPKERLSAEELQK 295

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 110/240 (45%), Gaps = 45/240 (18%)

Query: 72  EVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E++A+KLL +   V         +  L N  Y + +++E+   G    ++  + + RL E
Sbjct: 103 EINALKLLTHPNIV-------RLEEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 SEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNP 191
               Q+  Q+  GV  MH+    L+HRD+K+EN+L+       + DFG V          
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFVNEF------- 203

Query: 192 QELSYVEQDVLKNTTAQ--YRSPEMV---DIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
               +   +++K +     Y +PE+V   + +R      K DIW+ GI LY +     P+
Sbjct: 204 ----FGSNELMKRSCGSPCYAAPELVLSTEPYRA----RKVDIWSCGIILYAMLAGYLPW 255

Query: 247 EKGGEPAILNGQ-----FEF-----LPYPNYSEQL-RNLICKLLVQNPSQRPNVFQLLKQ 295
           +   +    NG      +++     L +P Y   L R+LI K+L  NPS+R ++  + K 
Sbjct: 256 DDDSQNP--NGDDIGKLYQYITKTALKFPAYISPLARDLIRKILTANPSRRISISYICKH 313

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 99/206 (48%), Gaps = 41/206 (19%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQ-NRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKI 162
           +V++ +EYC    L D +   LQ  R+   E +Q+  Q+   V   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISAKNEYKLCDFGSV--CGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDI--F 218
           EN+L+      KL DFG    C           +  V  + +  TT  Y +PE+ +   +
Sbjct: 166 ENILLDKDGNAKLTDFGFTREC-----------MEKVNLETICGTTV-YMAPELTERKPY 213

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP----AILNGQFEFLPYPNYSEQL--- 271
            G  I    DIW+LG+ LY +   + PF++  E      I+N +      P Y+ +    
Sbjct: 214 DGFKI----DIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEE------PEYNSKFMTA 263

Query: 272 --RNLICKLLVQNPSQRPNVFQLLKQ 295
              +L+ KLL ++ + RP+V ++L+ 
Sbjct: 264 EGEDLVRKLLQKDSNLRPSVREILQH 289

>Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 143/350 (40%), Gaps = 62/350 (17%)

Query: 2   NQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LISPPDPHTNSNVACLKRVIV 60
           N+    + N    ++ G++  E  K +  G FA VY   LIS    H    +  + R  +
Sbjct: 6   NKYNTTSVNHNLMISAGNYTAE--KEIGKGSFATVYRGHLISDKSQHIA--IKEVSRAKL 61

Query: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120
            +K  L  L  E+  +K +++  ++V  ID           S + +++MEYC  G L   
Sbjct: 62  KNKKLLENLEIEIAILKKIKH-PHIVGLIDCERT-------STDFYLIMEYCALGDLTFL 113

Query: 121 MNTRLQ----------------------NRLHESEILQIMCQVTQGVAAMHALQPPLIHR 158
           +  R +                      N LH + +L  + Q+   +  + +    L+HR
Sbjct: 114 LKRRKELMENHPLLRTVFEKYPPPSESHNGLHRAFVLSYLQQLASALKFLRS--KNLVHR 171

Query: 159 DIKIENVLISA-----KNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQ----- 208
           DIK +N+L+S       +     + G V     P     +  +     L NT+       
Sbjct: 172 DIKPQNLLLSTPLIGYHDSKTFHELGFVGIYNLPILKIADFGFAR--FLPNTSLAETLCG 229

Query: 209 ---YRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL------NGQF 259
              Y +PE+++  +    + K+D+W++G  ++++C  T PF       +       N   
Sbjct: 230 SPLYMAPEILNYQK---YNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDAI 286

Query: 260 EFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL-KQITNMQNAPYPIRD 308
            F  Y N   +L+ LIC LL  +P++R    +    ++ N   +PY + D
Sbjct: 287 TFPSYCNIEPELKKLICSLLTFDPAKRIGFEEFFNNKVVNEDLSPYELGD 336

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 102/224 (45%), Gaps = 35/224 (15%)

Query: 31   GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTS--------LNTLRAEVDAMKLLRNN 82
            G F  VY AL       T   +  +K+V VP+ +S        +  L++EV  +K L N+
Sbjct: 1047 GSFGAVYLALNV-----TTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   RYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVT 142
              +V Y+          NG Y +F  +EY   G +   +  R+  R  +  I  +  QV 
Sbjct: 1101 VNIVQYLGFEE-----KNGIYSLF--LEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVL 202
            +G+A +H+    ++HRD+K +N+L+      K+ DF    G+ R   N     Y   D+ 
Sbjct: 1152 EGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSDMT 1201

Query: 203  KNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
               T  + +PEMVD   G     K DIW+LG  + ++     P+
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPW 1243

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 104/229 (45%), Gaps = 53/229 (23%)

Query: 85  VVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQG 144
           +V++IDS+     L +G  +++V+MEY E G L D +   +   L E +I  +  +   G
Sbjct: 684 IVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSG 733

Query: 145 VAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKN 204
           +  +H+    ++HRDIK +N+L+S     KL DFG  C            + V +  LK 
Sbjct: 734 LQFLHSKG--VLHRDIKSDNILLSINGNIKLTDFG-FC------------AQVNETTLKR 778

Query: 205 TTA----QYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----- 255
           TT      + +PE+V      P   K DIW+LGI + ++          GEP  L     
Sbjct: 779 TTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GEPPYLNETPL 827

Query: 256 --------NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296
                   NG  E       S+ L++ +   L  NP QR +  +LL+ +
Sbjct: 828 RALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W
           (REAL)
          Length = 900

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 76/349 (21%), Positives = 143/349 (40%), Gaps = 60/349 (17%)

Query: 2   NQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVP 61
           N+ Q  + N     + G++  E  K +  G FA VY   ++  D   +  +  + R  + 
Sbjct: 12  NRDQTTSVNHNLMTSAGNYTAE--KEIGKGSFATVYRGHLTS-DKSQHIAIKEVSRAKLK 68

Query: 62  DKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFM 121
           +K  L  L  E+  +K +++  ++V  ID           S + +++MEYC  G L   +
Sbjct: 69  NKKLLENLEIEIAILKKIKH-PHIVGLIDCERT-------STDFYLIMEYCALGDLTFLL 120

Query: 122 NTRLQ----------------------NRLHESEILQIMCQVTQGVAAMHALQPPLIHRD 159
             R +                      N LH + +L  + Q+   +  + +    L+HRD
Sbjct: 121 KRRKELMENHPLLKTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRS--KNLVHRD 178

Query: 160 IKIENVLISA-----KNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQ------ 208
           IK +N+L+S       +     + G V     P     +  +     L NT+        
Sbjct: 179 IKPQNLLLSTPLIGYHDSKTFHELGFVGIYNLPILKIADFGFAR--FLPNTSLAETLCGS 236

Query: 209 --YRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL------NGQFE 260
             Y +PE+++  +    + K+D+W++G  ++++C  T PF       +       N    
Sbjct: 237 PLYMAPEILNYQK---YNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVIT 293

Query: 261 FLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL-KQITNMQNAPYPIRD 308
           F  Y N   +L+ LIC LL  +P++R    +    ++ N   +PY + D
Sbjct: 294 FPSYCNIEPELKELICSLLTFDPAKRIGFEEFFANKVVNEDLSPYELED 342

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 99/203 (48%), Gaps = 28/203 (13%)

Query: 98  LHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIH 157
           L N  Y + +++EY   G    ++  + + RL ES   ++  Q+  GV  MH+    L+H
Sbjct: 122 LQNSKY-IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LVH 176

Query: 158 RDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQ--YRSPEMV 215
           RD+K+EN+L+       + DFG V   +  P N         + +K +     Y +PE+V
Sbjct: 177 RDLKLENLLLDKNENLVITDFGFVNEFL--PDN---------EYMKTSCGSPCYAAPELV 225

Query: 216 DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG---EPAILNGQFEF-----LPYPNY 267
              R   +  K+D+W+ GI LY +     P++      E   +   +++     L +P Y
Sbjct: 226 ISTRPY-VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEY 284

Query: 268 SEQL-RNLICKLLVQNPSQRPNV 289
              + R+L+ K+LV +P++R N+
Sbjct: 285 ITPIPRDLLRKILVPDPNKRVNM 307

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 95/195 (48%), Gaps = 25/195 (12%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++++EYC    L + +    + RL   E  ++  Q+   V   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVD--IFRGLP 222
           VL+      KL DFG            +E++   Q      T  Y +PE+++   + G  
Sbjct: 159 VLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTVYMAPELIERKCYDGFK 208

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGEP----AILNGQFEFLPYPNYSEQLRNLICKL 278
           +    DIW+LGI LY +     PF++  +      I+N + +F      S+   +LI  +
Sbjct: 209 V----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQGM 263

Query: 279 LVQNPSQRPNVFQLL 293
           L +NP++R ++ Q+L
Sbjct: 264 LRKNPNERISLAQVL 278

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 106/235 (45%), Gaps = 55/235 (23%)

Query: 78  LLRNNRY--VVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEIL 135
           ++R +++  +V++IDS+ AK  L       +++MEY E G L D +   L   L E +I 
Sbjct: 668 VMRESKHSNIVNFIDSYLAKGDL-------WIVMEYMEGGSLTDVVTHCL---LSEGQIG 717

Query: 136 QIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELS 195
            +  +  +G+  +H+    ++HRDIK +N+L+S K   KL DFG  C  I          
Sbjct: 718 AVCRETLKGLQFLHSKG--VLHRDIKSDNILLSLKGNIKLTDFG-FCAQIN--------- 765

Query: 196 YVEQDVLKNTTA----QYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE 251
              ++ LK TT      + +PE+V      P   K DIW+LGI + ++          GE
Sbjct: 766 ---ENNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GE 811

Query: 252 PAIL-------------NGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
           P  L             NG  +       S+ L   +   L  +PS+R    +LL
Sbjct: 812 PPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELL 866

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 136/309 (44%), Gaps = 72/309 (23%)

Query: 7   GTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVP--DKT 64
           G +     + VG+++  I+K +  G F +VY AL  P            ++V++   DK 
Sbjct: 28  GQFMSDELIEVGNYR--ILKQIGEGSFGKVYLALHRP----------THRKVVLKTSDKN 75

Query: 65  SLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTR 124
             N +R      ++  + ++   YI        +     +V++ +EYC    L D +   
Sbjct: 76  DPNIVR------EVFYHRQFDYPYI---TKVYEIIVTETKVWMALEYCPGKELYDHL--L 124

Query: 125 LQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG----- 179
              R+  +E  ++  Q+   V   H+L    +HRD+K+EN+L+      KL DFG     
Sbjct: 125 FSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFGFTREC 182

Query: 180 -------SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVD--IFRGLPIDEKSDIW 230
                  +VCG                      T  Y +PE+++   + G  ID    IW
Sbjct: 183 MTRSTLETVCG----------------------TTVYMAPELIERKSYDGFKID----IW 216

Query: 231 ALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQR 286
           ALG+ LY + Y   PF++  E      I+N   +F    + S  +++LI KLL ++P++R
Sbjct: 217 ALGVILYTMIYGAMPFDEDDEVKTKWKIVNEDPDFTNNIS-SNDVKDLIKKLLKKDPTER 275

Query: 287 PNVFQLLKQ 295
           P + ++LK 
Sbjct: 276 PTIREILKH 284

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 122/279 (43%), Gaps = 43/279 (15%)

Query: 31   GGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLN--------TLRAEVDAMKLLRNN 82
            G F  VY  L       T   +  +K+V VP  +S N         LR+EV  +K L ++
Sbjct: 1187 GSFGAVYLCLNV-----TTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DH 1240

Query: 83   RYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVT 142
              +V Y+          N  Y +F  +EY   G +   +  R+  R  ES I  +  QV 
Sbjct: 1241 LNIVQYLGFENK-----NNIYSLF--LEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVL 1291

Query: 143  QGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVL 202
            +G+A +H+    ++HRD+K +N+L+      K+ DFG         R  +++ Y   D+ 
Sbjct: 1292 KGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDFGIS-------RKSKDI-YSNSDMT 1341

Query: 203  KNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILN--GQFE 260
               T  + +PEMVD  +G     K DIW+LG  + ++     P+      A +   G+ +
Sbjct: 1342 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1399

Query: 261  FLP------YPNYSEQLRNLICKLLVQNPSQRPNVFQLL 293
              P       P  S+  R+ +      NP +RP   +LL
Sbjct: 1400 SAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 139/333 (41%), Gaps = 54/333 (16%)

Query: 26  KYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYV 85
           ++L  GGFA+ +              VA   ++ +  + +   L +E+   K + +   +
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN-I 140

Query: 86  VSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGV 145
           V +ID              V++L+E C  G L++ +  R    + E E+   M Q+  G+
Sbjct: 141 VQFIDCFEDNVN-------VYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT 205
             MH+ +  +IHRD+K+ N+        K+ DFG +  V+   R        E+      
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDR--------ERKFTICG 240

Query: 206 TAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYP 265
           T  Y +PE++ + +      + DIW++G+ LY L     PF+       +N  +E +   
Sbjct: 241 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKD----VNTIYERIKQR 295

Query: 266 NY--------SEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQN-APYPIRDVQTVQRPS 316
           N+        S+  + LI  +L  NP +RP++ +++  +       PY +  V T     
Sbjct: 296 NFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRGTFPPYTLNSVMTTVPDY 355

Query: 317 NHL----------------NLMELHQNSATQNI 333
           +H+                 L+ +HQN    NI
Sbjct: 356 SHITPQESFMNFQNCLEASGLLSVHQNHMVANI 388

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 141/317 (44%), Gaps = 57/317 (17%)

Query: 3   QPQIGTYNVGTQLTVGSHQVEIIKYL---------TSGGFAQVYSALISPPDPHTNSNVA 53
           QP+ G Y +G  L  G      + Y+         +SG     YS +     P   +   
Sbjct: 53  QPRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHM-----PKQVAIKL 107

Query: 54  CLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCE 113
             +  +   K S   L  E++A+K+L +   V         +  L N  Y + +++EY  
Sbjct: 108 IRRDTLSASKESEIKLYREINALKMLTHPNIV-------KLEEVLQNSKY-IGIVLEYAS 159

Query: 114 RGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEY 173
            G    ++  + + RL ES+   I  Q+  GV+ +H+    L+HRD+K+EN+L+      
Sbjct: 160 GGEFYKYI--KFKKRLKESKACTIFAQLISGVSYIHS--KGLVHRDLKLENLLLDKAGNL 215

Query: 174 KLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT---TAQYRSPEMVDIFRGLPID-EKSDI 229
            + DFG V  V +             + L +T   +  Y +PE+V      P +  K+DI
Sbjct: 216 LITDFGFVNEVTK------------TNKLMHTPCGSPCYAAPELVTSVE--PYNARKADI 261

Query: 230 WALGIFLYKLCYYTTPFEKGGEPAILNGQ-----FEF-----LPYPNYSEQL-RNLICKL 278
           W+ G+ LY +     P++   +P  +NG      +++     L +P Y   + R+L+ ++
Sbjct: 262 WSCGVILYAMLAGYLPWD--DDPKNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRM 319

Query: 279 LVQNPSQRPNVFQLLKQ 295
           L  +P++R ++  +L+ 
Sbjct: 320 LEIDPAKRMSMKHILQH 336

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 85/184 (46%), Gaps = 21/184 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAK 170
            + E G +  F     +  + E E   +  QV   +  +H     ++HRDIK ENV++ + 
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSH 986

Query: 171  NEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMV--DIFRGLPIDEKSD 228
               KL DFGS   +   P           DV    T  Y +PE++    ++G P     D
Sbjct: 987  GFVKLIDFGSAAYIKSGPF----------DVFVG-TMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGIFLYKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPN 288
            IWALG+ LY + Y   P+    E  IL G+  F    + SE+  +LI ++L +   +RP 
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPT 1089

Query: 289  VFQL 292
            + ++
Sbjct: 1090 IDEI 1093

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 93/202 (46%), Gaps = 21/202 (10%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E        Q+   V ++HA+   +IHRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 165 VLISAKNEYKLCDFGSVCGVIRPPRN-----PQELSYVEQDVLKNTTAQYRSPEMV-DIF 218
           +L+    + KL DFG+   +   P N     P    Y         TA+Y SPE++ D +
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVG-TAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNGQFEFLPYPNYSEQLRNL 274
                D + DIWA G  LY++     PF+   E      ++  Q+ F     +    ++L
Sbjct: 314 ----TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFT--AGFPLIAKDL 367

Query: 275 ICKLLVQNPSQRPNVFQLLKQI 296
           + KLLV+ P+ R  V Q+   +
Sbjct: 368 VKKLLVREPNDRLTVEQIKAHV 389

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 125/275 (45%), Gaps = 31/275 (11%)

Query: 28  LTSGGFAQVYSALISPPDPHTNSNVACLKRVIVPDKTSLNTLRAEVDAMKLLRNNRYVVS 87
           L  G ++QV+ A  S  D      V  L +  +  +  +  +  E  A++ L++   V++
Sbjct: 124 LGDGSYSQVFLA-TSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSVTGVIN 182

Query: 88  YIDSHAAKATLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHESEILQIMCQVTQGVAA 147
              +   +A L       + L+EY   G  +  +  +    L+E   +    Q+   + +
Sbjct: 183 LSFTFQDEANL-------YFLLEYAPNGDFLSLI--KKFGTLNEECTIYYSAQIIDAIGS 233

Query: 148 MHALQPPLIHRDIKIENVLISAKNEYKLCDFGSVCGVIRPPRNPQELSYVEQDVLKNT-- 205
           MH+    +IHRDIK EN+L+    + KL DFG+   + +      +  Y   ++L  +  
Sbjct: 234 MHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHY---NLLTRSSS 288

Query: 206 ---TAQYRSPEMV-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILNG 257
              TA+Y SPE++ D +     D K DIWA G  +Y++     PF+   E      ++  
Sbjct: 289 FVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKV 344

Query: 258 QFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQL 292
           QF F     +   +R+L+  +LV+ P +R  + Q+
Sbjct: 345 QFAFT--AGFPTIIRDLVKNILVKQPEKRLTIPQI 377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,005,610
Number of extensions: 2746914
Number of successful extensions: 12948
Number of sequences better than 10.0: 1971
Number of HSP's gapped: 11676
Number of HSP's successfully gapped: 2036
Length of query: 632
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 516
Effective length of database: 40,180,143
Effective search space: 20732953788
Effective search space used: 20732953788
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)