Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_14.3262.285ON70670637060.0
Skud_14.3082.285ON70670635520.0
Smik_14.3102.285ON70670635410.0
YNL021W (HDA1)2.285ON70670634840.0
ZYRO0A01870g2.285ON70769829550.0
CAGL0J03454g2.285ON69366829270.0
NCAS0G038002.285ON72671029220.0
TDEL0G021602.285ON71471029180.0
NDAI0G006502.285ON68966729040.0
SAKL0E07700g2.285ON71269428530.0
KNAG0H020102.285ON69368228300.0
KAFR0H033202.285ON70268528060.0
KLTH0G10340g2.285ON70870727800.0
Kwal_27.115372.285ON70868527570.0
Ecym_33242.285ON70668727150.0
KLLA0E08383g2.285ON70471026770.0
Kpol_1039.322.285ON65965526310.0
ADL216C2.285ON70567426150.0
TPHA0C033902.285ON70166825990.0
TBLA0B069502.285ON79548620200.0
Kpol_1003.372.285ON57829813870.0
NDAI0B027108.153ON4533233464e-34
TDEL0B045808.153ON4463263438e-34
AFR172C8.153ON4493273412e-33
TPHA0H003208.153ON4503273412e-33
NCAS0B054808.153ON4513553384e-33
TBLA0D021408.153ON4563363375e-33
SAKL0H25124g8.153ON4483323375e-33
KLTH0E06446g8.153ON4493243366e-33
KNAG0G013508.153ON4513263367e-33
Kpol_246.58.153ON4533263367e-33
Skud_7.798.153ON4523233296e-32
CAGL0A03322g8.153ON4503333296e-32
Ecym_23468.153ON4853303307e-32
YGL194C (HOS2)8.153ON4523243261e-31
KAFR0C029208.153ON4533273252e-31
Smik_7.798.153ON4523233233e-31
Kwal_55.207908.153ON4493263234e-31
Suva_7.718.153ON4523233234e-31
ZYRO0G19316g8.153ON4483293216e-31
KLLA0F09119g8.153ON4523263209e-31
Kpol_1038.113.8ON4333243153e-30
NCAS0C043203.8ON4343243111e-29
TBLA0I005603.8ON4333243111e-29
Suva_14.113.8ON4333243111e-29
Kwal_55.221423.8ON4323243101e-29
Ecym_20103.8ON4333243092e-29
ZYRO0C03498g3.8ON4333243092e-29
KLLA0E01981g3.8ON4323243092e-29
AGR395W3.8ON4333243092e-29
KLTH0F19668g3.8ON4323243082e-29
Skud_14.113.8ON4333243082e-29
SAKL0C13706g3.8ON4333243083e-29
NDAI0G037403.8ON4333243073e-29
KNAG0A011603.8ON4333243073e-29
CAGL0B01441g3.8ON4333243056e-29
KAFR0A086303.8ON4333243049e-29
Smik_14.23.8ON4333243022e-28
YNL330C (RPD3)3.8ON4333243012e-28
TPHA0A003003.8ON4333243002e-28
TDEL0A002703.8ON4333242969e-28
NDAI0A051203.362ON5082421956e-15
Suva_16.3963.362ON4771771948e-15
TBLA0B023903.362ON5791761959e-15
Skud_16.3533.362ON4711771902e-14
TDEL0C050403.362ON4542081884e-14
CAGL0D01430g3.362ON4452771866e-14
KLTH0F10582g3.362ON4742221851e-13
YPR068C (HOS1)3.362ON4701771841e-13
Smik_16.3093.362ON4701771832e-13
SAKL0B07854g3.362ON4891771796e-13
NCAS0A111803.362ON4902031788e-13
Kwal_23.37243.362ON4732221771e-12
KAFR0H008903.362ON4742151761e-12
Ecym_82908.607ON7093301762e-12
ZYRO0C16390g3.362ON4361791733e-12
Kpol_376.153.362ON5181771725e-12
KLLA0B09394g3.362ON4411871681e-11
ADL339W3.362ON4372061671e-11
SAKL0H08338g8.607ON6903291663e-11
KNAG0H006303.362ON4561821626e-11
ADL265W8.607ON6942471611e-10
TDEL0A055208.607ON6743241592e-10
KLLA0F00858g8.607ON7152621574e-10
Ecym_34653.362ON4451831545e-10
TPHA0A011208.607ON6982531502e-09
TBLA0E040808.607ON6942411503e-09
TPHA0M015903.362ON4942931441e-08
Smik_6.3158.607ON6973181441e-08
Kpol_479.68.607ON6882541432e-08
NCAS0C017608.607ON7001371413e-08
KNAG0J013008.607ON6771141404e-08
KAFR0H027908.607ON7171161405e-08
Suva_16.1948.607ON6991171396e-08
KLTH0D09592g8.607ON705651388e-08
YPL116W (HOS3)8.607ON6971351361e-07
Kwal_26.85058.607ON708581342e-07
NDAI0E024808.607ON684981333e-07
Skud_16.1648.607ON697581333e-07
CAGL0J06974g8.607ON678571281e-06
ZYRO0F10780g8.607ON6681381281e-06
CAGL0D04136g5.299ON21538741.7
ZYRO0B01122g2.494ON448103724.9
Kwal_55.206504.25ON204110697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_14.326
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1432   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1372   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1368   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1346   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1142   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1132   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1130   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1128   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1123   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1103   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1094   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1085   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1075   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1066   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1050   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1035   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1018   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1011   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...  1005   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   782   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   538   0.0  
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    137   4e-34
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   136   8e-34
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   135   2e-33
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   135   2e-33
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   134   4e-33
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   134   5e-33
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   134   5e-33
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   134   6e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   134   7e-33
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   134   7e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   131   6e-32
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   131   6e-32
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   131   7e-32
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   130   1e-31
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   129   2e-31
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   129   3e-31
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   129   4e-31
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   129   4e-31
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   128   6e-31
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   127   9e-31
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   125   3e-30
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      124   1e-29
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   124   1e-29
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   124   1e-29
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   124   1e-29
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   123   2e-29
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   123   2e-29
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   123   2e-29
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   123   2e-29
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   123   2e-29
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   123   2e-29
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   123   3e-29
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   122   3e-29
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   122   3e-29
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   122   6e-29
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   121   9e-29
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   120   2e-28
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   120   2e-28
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   120   2e-28
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   118   9e-28
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    80   6e-15
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    79   8e-15
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    80   9e-15
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    78   2e-14
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    77   4e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    76   6e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    76   1e-13
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    75   1e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    75   2e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    74   6e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    73   8e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    73   1e-12
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    72   1e-12
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    72   2e-12
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    71   3e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    71   5e-12
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    69   1e-11
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    69   1e-11
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    69   3e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    67   6e-11
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    67   1e-10
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    66   2e-10
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    65   4e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    64   5e-10
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    62   2e-09
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    62   3e-09
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    60   1e-08
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    60   1e-08
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    60   2e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    59   3e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    59   4e-08
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    59   5e-08
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    58   6e-08
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    58   8e-08
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    57   1e-07
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    56   2e-07
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    56   3e-07
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    56   3e-07
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    54   1e-06
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    54   1e-06
CAGL0D04136g Chr4 (409387..409397,409461..410097) [648 bp, 215 a...    33   1.7  
ZYRO0B01122g Chr2 (93637..94983) [1347 bp, 448 aa] {ON} similar ...    32   4.9  
Kwal_55.20650 s55 (505162..505776) [615 bp, 204 aa] {ON} YLL033W...    31   7.6  

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1432 bits (3706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/706 (97%), Positives = 690/706 (97%)

Query: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGL 60
           MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGL
Sbjct: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKV 420

Query: 421 VRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPL 480
           VRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPL
Sbjct: 421 VRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPL 480

Query: 481 INMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKW 540
           INMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKW
Sbjct: 481 INMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKW 540

Query: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYS 600
           GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYS
Sbjct: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1372 bits (3552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/706 (92%), Positives = 675/706 (95%)

Query: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGL 60
           MDSA VKNEVLE PD DLK  LE  KE+QNSLSTTS+NKRQVIVPACTPK+HY+PL+TGL
Sbjct: 1   MDSARVKNEVLENPDHDLKRTLENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDD+GDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLY+SLHRFE+GKYYPGTIQGQYDQTGEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHV+PSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIA SALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKV 420

Query: 421 VRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPL 480
           +RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQL YLS+EF+FVTLPL
Sbjct: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPL 480

Query: 481 INMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKW 540
           INM LPDN  LCTPNV ES+ LLVVVHDTSDVWAKRNVISGTIDLSSSV+IDNC+DFIKW
Sbjct: 481 INMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKW 540

Query: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYS 600
           GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFP VAKIA+IGIGDS+S
Sbjct: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL+EWYFKNSL+F+NNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGLSNT+EERFEEATDFILDSFEEWSD+E
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1368 bits (3541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/706 (92%), Positives = 672/706 (95%)

Query: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGL 60
           MDS  VK E  E PD +LK +LE  KE+QNSLSTTS NKRQVIVPACTPK+HY+PL+TGL
Sbjct: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLY+SLHRFE+GKYYPGTIQGQYDQ GEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIA SALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKV 420

Query: 421 VRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPL 480
           +RLQSKYWNCFRRRHANSGCNFNEPINDSI+SKNFPLQKAIRQQQ HYLSDEFN VTLPL
Sbjct: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480

Query: 481 INMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKW 540
           INM+LPDN VLCTPNV ES+TLLVVVHDTSD+WAKRNVISGTIDLSSSV+IDNCLDFIKW
Sbjct: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540

Query: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYS 600
           GLDRKYGIIDVNIPL+LFE DNYSGMITSQEVLIYLWDNYIKYFPAVAKIA++GIGDSYS
Sbjct: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL+EWYFKNSL+F+NNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGL+NT+EERFEEATDFILDSFEEWSDEE
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1346 bits (3484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/706 (91%), Positives = 674/706 (95%)

Query: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGL 60
           MDS  VK EVLE PD DLK KLE  KEE+NSLSTTSK+KRQVIVP C PK+HY+PL+TGL
Sbjct: 1   MDSVMVKKEVLENPDHDLKRKLEENKEEENSLSTTSKSKRQVIVPVCMPKIHYSPLKTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSRE+LLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLY+SLHRFE+GKYYPGTIQGQYDQTGEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIA SALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKV 420

Query: 421 VRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPL 480
           +RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQ HYLSDEFNFVTLPL
Sbjct: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPL 480

Query: 481 INMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKW 540
           ++M+LPDN VLCTPN+SES+T+++VVHDTSD+WAKRNVISGTIDLSSSV+IDN LDFIKW
Sbjct: 481 VSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKW 540

Query: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYS 600
           GLDRKYGIIDVNIPLTLFE DNYSGMITSQEVLIYLWDNYIKYFP+VAKIA+IGIGDSYS
Sbjct: 541 GLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL+EWYFKNSL+F+NNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGL+N +EERFEEATDFILDSFEEWSDEE
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/698 (75%), Positives = 616/698 (88%), Gaps = 7/698 (1%)

Query: 15  DQDLKHKLE----GMKEEQNSLSTTS--KNKRQVIVPACTPKLHYTPLRTGLCYDVRMRY 68
           D+  K KLE    G  E++ ++++ S  + KRQ+IVPAC PK+HYTPL+TGLCYDVRMRY
Sbjct: 11  DEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMRY 70

Query: 69  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATS 128
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG DD+G+LMLKIPVR AT 
Sbjct: 71  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVREATV 130

Query: 129 EEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAV 188
           EE+L+VHTKEHLEFIE T +M+RE+LLKETE GDSVYFN+DSY++A+LPCGGAIEACKAV
Sbjct: 131 EELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEACKAV 190

Query: 189 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHH 248
           VEGRVKN+LAV+RPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVRRI+ILDWDIHH
Sbjct: 191 VEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDWDIHH 250

Query: 249 GNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGD 308
           GNGTQK+FY DD+VLYISLHRFE+GKYYPGTI GQYDQTGEGKGEGFNCNITWPVGGVGD
Sbjct: 251 GNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGD 310

Query: 309 AEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARG 368
           AEYM AFEQ+VMPM RE++PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARG
Sbjct: 311 AEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARG 370

Query: 369 NLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVVRLQSKYW 428
           NLCV LEGGYNLDAIA SALSVAK+LIG                 IEMIDKV+ +QSKYW
Sbjct: 371 NLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSKYW 430

Query: 429 NCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDN 488
            CFRR   NSGCNF EP+ +S+I+KNFPLQKAIRQ+Q H L  E+ FVTLP+  +ELP++
Sbjct: 431 KCFRRL-GNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELPED 489

Query: 489 IVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGI 548
            VLC+P+V + ST+++ VHDT ++WAKR+VI+G ID S+S+ +D+ LDFIKW L RKYG+
Sbjct: 490 TVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKYGV 549

Query: 549 IDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGH 608
           IDVNIP +LFE DNYS MITSQEVLIYLWDN++KYFP+++K+A++G+GD+YSGIVHLLGH
Sbjct: 550 IDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLLGH 609

Query: 609 RDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKENESRKPRKK 668
           RDTR+V K VINF+G KQLKPLVPLVDE+L +WYFKNSLVF++ ++ CW +NE++KPR+K
Sbjct: 610 RDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKKPRRK 669

Query: 669 FGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           FGRVLRC++DG++N +EERF+EATDFILDSFEEWSD E
Sbjct: 670 FGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1132 bits (2927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/668 (77%), Positives = 601/668 (89%)

Query: 39  KRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98
           KR VIVP    ++HYTPL+TG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 26  KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 85

Query: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158
           ENGLINDPTLSGV+D+GDLMLKIP+RAAT+EEILEVH+KEHLEFIE TEKM+RE+LLKET
Sbjct: 86  ENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET 145

Query: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218
           EKGDSVYFNNDSYA++RLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEP+AAGGFCLF
Sbjct: 146 EKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLF 205

Query: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPG 278
           SNVAVAAKNILKNYPESVRRI+ILDWD+HHGNGTQK+FY DD+VLYISLHRFE+GKYYPG
Sbjct: 206 SNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 265

Query: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338
           TIQGQYDQ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREF+PDLVIISSGFD
Sbjct: 266 TIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFD 325

Query: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXX 398
           AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAK+LIG  
Sbjct: 326 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEP 385

Query: 399 XXXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458
                          +E+IDKV+ LQSKYW CF +R+ N G      +   ++SK+FPLQ
Sbjct: 386 PDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQ 445

Query: 459 KAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNV 518
            AIRQ+Q H LS++F FVTLPL+NME+P + V+C+PN+   +T+LVVVHDT ++WAKRNV
Sbjct: 446 TAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNV 505

Query: 519 ISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWD 578
           I+GTID S+S+V+D+  +FIKWGL+RKYGI+D+NIP +LFE +NY+ ++TSQE+LIY+WD
Sbjct: 506 ITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWD 565

Query: 579 NYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638
           NY+K+FP++ K+A+IGIGD+ +GIVHLLGHRDTR+V K+V++F+G K LKPLVPLV+E+L
Sbjct: 566 NYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESL 625

Query: 639 TEWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDS 698
            +WYFKNSLVFT++SH CW +NE+RKPRKKFGRVLRCD +G++N +EER EE+TDFILDS
Sbjct: 626 GDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDS 685

Query: 699 FEEWSDEE 706
           FEEWSD E
Sbjct: 686 FEEWSDSE 693

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/710 (74%), Positives = 608/710 (85%), Gaps = 5/710 (0%)

Query: 2   DSATV---KNEVLETPDQDLKHKLEGMKEEQ--NSLSTTSKNKRQVIVPACTPKLHYTPL 56
           +SATV    N+     D   K  +  +KEE        T  ++R VIVP    +L YTPL
Sbjct: 17  ESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPL 76

Query: 57  RTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGD 116
           +TGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG++D+GD
Sbjct: 77  KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGD 136

Query: 117 LMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176
           LMLKIPVR AT EEILEVH+KEH +FIE T  M+RE+LLK TEKGDSVYFNNDS+ASA+L
Sbjct: 137 LMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKL 196

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236
           P GG+IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVA+AAKNILKNYPESV
Sbjct: 197 PVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESV 256

Query: 237 RRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFN 296
           RRIMILDWDIHHGNGTQK+FY DD+VLYISLHRFE+GKYYPGTI GQYDQTGEGKGEGFN
Sbjct: 257 RRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFN 316

Query: 297 CNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYG 356
           CNITWPVGGVGDAEY+WAFEQVVMPM REF+PDLVIISSGFDAADGD+IGQCHVTPSCYG
Sbjct: 317 CNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYG 376

Query: 357 HMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEM 416
           HMTHMLKSLA+GNLCVVLEGGYNLDAIA SALSVAK+LIG                 IE+
Sbjct: 377 HMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEI 436

Query: 417 IDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFV 476
           IDKV+RLQSKYW CF+RR+ N+GCNF + IN+S+ISKNFPLQ+AIR+QQL+ LS +F F 
Sbjct: 437 IDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFA 496

Query: 477 TLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLD 536
           TLPL+  ELP + VLC+PNV +S T+++  HDT ++WAKR+VI GTID SSS+++D+ LD
Sbjct: 497 TLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLD 556

Query: 537 FIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIG 596
           FIKW  ++KYG+ID+NIP  LFE +NYS ++TSQEVL Y+WDNY+KYFP V K+A+IGIG
Sbjct: 557 FIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIG 616

Query: 597 DSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQC 656
           D+YSGIVHLLGHRDTR+V K+VINF+  KQL+ LVPLVDE+L++WYFKNSLVF++ SH  
Sbjct: 617 DAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTY 676

Query: 657 WKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           W + E++KPRKK+GR+LRC+TDG++N VEERFEEATDFILDSFEEWSD E
Sbjct: 677 WGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/710 (72%), Positives = 610/710 (85%), Gaps = 4/710 (0%)

Query: 1   MDSATVK--NEVLETPDQDLKHKLEGMKEEQNSLSTTSKNK--RQVIVPACTPKLHYTPL 56
           MD   VK  N+      + ++ + +G+  +++ L+ T      ++VIVPAC P LHYTPL
Sbjct: 5   MDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPL 64

Query: 57  RTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGD 116
           +T LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+D++GD
Sbjct: 65  KTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGD 124

Query: 117 LMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176
           LMLKIPVR AT EEILEVH+KE+LEF+E + +M RE+LLKETEKGDSVYFNNDSY SA+L
Sbjct: 125 LMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKL 184

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236
            CGG I+ACKAVVEGRVKN+LAVVRPPGHHAEP+A GGFCLFSNVAVAA+NILK YPESV
Sbjct: 185 SCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESV 244

Query: 237 RRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFN 296
           RRI+ILDWDIHHGNGTQK+FY D +VLYISLHRFE+GKYYPGTI G+YDQTGEGKGEGFN
Sbjct: 245 RRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFN 304

Query: 297 CNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYG 356
           CNITWPVGGVGDAEYM AFEQ+VMPM REF+PDLVIISSGFDAADGDTIGQCHVTPSCYG
Sbjct: 305 CNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYG 364

Query: 357 HMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEM 416
            MTHMLKSLARGNLCV LEGGYNLDAIAISALSVAKVLIG                 IEM
Sbjct: 365 QMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEM 424

Query: 417 IDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFV 476
           ID V+  QSKYW CF+R+  N+GCNF+EP+ +++ISK+FPLQ AIRQ+Q   LS E+ FV
Sbjct: 425 IDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFV 484

Query: 477 TLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLD 536
           TLP+  +E+PD+ VLC+P V + ST++++VHDT ++WAKR+VI+G ID S+S+++D+ LD
Sbjct: 485 TLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLD 544

Query: 537 FIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIG 596
           F KW ++RKYG+IDVNIP +LFE DNYS MITSQEVL+Y+WDNYIKYFP++AK+A++G G
Sbjct: 545 FTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFG 604

Query: 597 DSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQC 656
           D+Y+GIVHLLGHRDTRA  K V++F+G KQLKPLVPLVDE+L++WYFKNSL+FT+ +H C
Sbjct: 605 DAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPC 664

Query: 657 WKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           W +NES+KPRKKFGRVLRCDTDGL++ +EERFEEATDFILD FEEWSD E
Sbjct: 665 WADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1123 bits (2904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/667 (77%), Positives = 591/667 (88%)

Query: 40  RQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 99
           RQ+IVP    ++HYTPL+TGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82

Query: 100 NGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETE 159
           NGLI DPTLSG+DD+GDLMLKIPVR ATSEEILEVH+KEHL+FIEST KM+REQLLK TE
Sbjct: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142

Query: 160 KGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFS 219
            GDSVYFN+DSYASA+LP GGAIEACKAVVEGRVKN+LAVVRPPGHHAEP+AAGGFCLFS
Sbjct: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202

Query: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGT 279
           NVA+AAKNILKNYPESVR+I+ILDWDIHHGNGTQK+FY DD++LY+SLHRF++GKYYPGT
Sbjct: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262

Query: 280 IQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDA 339
           I G+YDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+VMPMGREF+PDLVIIS+GFDA
Sbjct: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322

Query: 340 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXX 399
           ADGDTIGQCHVTPSCYGHMTHMLKSLARGN+ VVLEGGYNLD+IAISALSVAK+LIG   
Sbjct: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382

Query: 400 XXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQK 459
                        VIEMIDKV+R+QSKYW CF+ +  N+GC+F E IN+SI +KNFPLQ 
Sbjct: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442

Query: 460 AIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVI 519
           AIRQQQ+  LS EFNF  LP+   ELP++ +LC+ N+ ES+T+++ VHDT ++WAKR+ I
Sbjct: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502

Query: 520 SGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDN 579
            GTID SSS+++D+ LD IKW ++RKYG+ID+NIP  L E +NY  +IT+QEVLI LWDN
Sbjct: 503 QGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562

Query: 580 YIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLT 639
           Y+KYFP V KIA++GIGD+YSGIVHLLGHRDTR+V K VINF+G KQLKPLVPLVDE+L 
Sbjct: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622

Query: 640 EWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSF 699
           EWYFKNSLVF+N +H  W + E++KPRKK+GRVLRCDTDG+SN +EERFEEATDFILDSF
Sbjct: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682

Query: 700 EEWSDEE 706
           EEWSD E
Sbjct: 683 EEWSDSE 689

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/694 (72%), Positives = 593/694 (85%), Gaps = 3/694 (0%)

Query: 15  DQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFT 74
           +  LK K++ M++E  S    S     VIVP   P++HYT L+TGLCYDVRMRYHAKI+T
Sbjct: 20  EDSLKRKVDTMEDEVES-RKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYT 78

Query: 75  SYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEV 134
           SYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD++G+LMLKIPVR AT+EEIL+V
Sbjct: 79  SYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQV 138

Query: 135 HTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVK 194
           HTKEHL F+E T KM+REQLLKETE GDSVYFNNDS  SA+L CGGAIEACKAVVEGRVK
Sbjct: 139 HTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVK 198

Query: 195 NSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQK 254
           N+LAV+RPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVRRIMILDWDIHHGNGTQK
Sbjct: 199 NALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQK 258

Query: 255 SFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWA 314
           +FY D++VLY+SLHR+E+GKYYPGT+ G Y+QTGEGKGEGFNCNI WP GG+GDAEYMWA
Sbjct: 259 AFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWA 318

Query: 315 FEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL 374
           F+QVVMPMGREF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGNLCVVL
Sbjct: 319 FQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL 378

Query: 375 EGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRR 434
           EGGYNLD+IA SAL VAK+LIG                 IE I+ V+R QSKYWNCF+  
Sbjct: 379 EGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKST 438

Query: 435 HANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTP 494
           H+N GCNF E + +S ISKNFPLQ+AIRQ+QL  LS++F FVTLPL+NME+P + V+C+P
Sbjct: 439 HSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSP 498

Query: 495 NVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIP 554
           N+ ++ T++V VHDT ++WA+RN I+GTID S+S+++D  LD IKW L RKY +IDVNIP
Sbjct: 499 NIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIP 558

Query: 555 LTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAV 614
            +LFE DNYS MITSQEVL+Y+WDNY+KYFP++AK+A+IG+GD+YSGIVHLLGHRDTR+V
Sbjct: 559 QSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSV 618

Query: 615 TKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKE--NESRKPRKKFGRV 672
            K  ++F+  K LK LVPLVDE+L  WYFKNSLVFT+ +H CW    NE++KPRK+FGRV
Sbjct: 619 VKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRV 678

Query: 673 LRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           L+CDT G++N VEERF+EATDFILDSFEEWSD E
Sbjct: 679 LKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/682 (73%), Positives = 583/682 (85%), Gaps = 2/682 (0%)

Query: 27  EEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPED 86
           + Q    +++ +KRQ+IV  C PKL YTPL+TGLCYDVRMRYHAKIFTSYFEYIDPHPED
Sbjct: 12  DSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 71

Query: 87  PRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIEST 146
           PRRIYRIYKILAENGLI DP LSG+DD+GDLMLKIPVR ATS+E+LEVH+KEHLEFIES 
Sbjct: 72  PRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESV 131

Query: 147 EKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHH 206
            KMS ++LLK TE GDSVYFNNDS +SA+L CGGAIEACKAVVEGRVKN+ AVVRPPGHH
Sbjct: 132 TKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHH 191

Query: 207 AEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYIS 266
           +EP++AGGFCLFSNVAVA+KNIL+NYPESVRRIMILDWDIHHGNGTQK+FY DD+VLYIS
Sbjct: 192 SEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYIS 251

Query: 267 LHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREF 326
           LHRFE+GKYYPGT QG YD+TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM REF
Sbjct: 252 LHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREF 311

Query: 327 KPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAIS 386
           +PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGGYNLDAIA S
Sbjct: 312 RPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARS 371

Query: 387 ALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPI 446
           ALSVAKVLIG                 IE+I+KV+RLQSKYW CF+RRH NSGC F + +
Sbjct: 372 ALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHM 431

Query: 447 NDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVV 506
            +SI + NFPLQ AIRQQQ   LS EF FV  PL  M+L D+ V+C+P V    T++++V
Sbjct: 432 TESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILV 491

Query: 507 HDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGM 566
            DT ++WAKR+VI GTID S+S++ D  L FIKW ++R YG+IDVNIP +LFE DNYS M
Sbjct: 492 RDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAM 551

Query: 567 ITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQ 626
           IT+QEV+ ++WDNYI++F + +KIA++G+GD+ SGIVHLLGHRDTR+  K+VINF+  K 
Sbjct: 552 ITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKT 611

Query: 627 LKPLVPLVDETLTEWYFKNSLVFTNNSHQCW--KENESRKPRKKFGRVLRCDTDGLSNTV 684
           LKPL+PLVDETL +WYFKNSLVF++ +H CW   ENE++KPRKKFGRVLRC++DGL+N +
Sbjct: 612 LKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNII 671

Query: 685 EERFEEATDFILDSFEEWSDEE 706
           EERFEEATDF+LDSFEEWS+ +
Sbjct: 672 EERFEEATDFMLDSFEEWSESD 693

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1085 bits (2806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/685 (72%), Positives = 587/685 (85%), Gaps = 4/685 (0%)

Query: 26  KEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPE 85
           +EE+N  S     KRQVIVP   P++HY PL+TGLCYDVRMRYHAKIFTSYFEYIDPHPE
Sbjct: 18  QEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPE 77

Query: 86  DPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIES 145
           DPRRIYRIYKILAENGLIND  LSGVDD+GD+MLKIPVR AT++EILEVH++EHLEF+ES
Sbjct: 78  DPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLES 137

Query: 146 TEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGH 205
           T  M+RE LLKETEKGDSVYFNNDSY SA+L CGGAIEACKAVVEG+VKN+LAVVRPPGH
Sbjct: 138 TTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGH 197

Query: 206 HAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYI 265
           H+EP+++GGFCLFSNVAVAAKNILKNYPESVR+IMILDWDIHHGNGTQK+FYQD++VLY+
Sbjct: 198 HSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYV 257

Query: 266 SLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGRE 325
           SLHRFE GKYYPGT+QGQYDQ GEGKGEGFNCNITWP GGVGDAEYMWAFEQ+VMPMGRE
Sbjct: 258 SLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGRE 317

Query: 326 FKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAI 385
           F+PDLVIISSGFDAADGD IGQCHVTPSCYGHMTHMLKSLARGNL VVLEGGYNLD+IAI
Sbjct: 318 FQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAI 377

Query: 386 SALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEP 445
           SALSVAK LIG                 +EMI KV+++QSKYW CF+RRH N   NF+E 
Sbjct: 378 SALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEV 437

Query: 446 INDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVV 505
            +D++ +K FPLQ AIRQQQ + L  E++FV  P  N++LPD+++LC+PN+  + T++++
Sbjct: 438 ASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIII 497

Query: 506 VHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLF----EAD 561
           VHDT  +W ++++IS T+D  SS++ID+ LDF+KW  +RKYGIIDVNIP +L       D
Sbjct: 498 VHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPD 557

Query: 562 NYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINF 621
           NYS +I +QE+L++LWDN+IK+   V KIA+IG+GDS SG+VHLLGHRDT+   K VINF
Sbjct: 558 NYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINF 617

Query: 622 LGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLS 681
           + DKQLKPLVPLVDE+L++WYFKNSLVF+N +H CW + E++KPRKK+GRVLRCDTDGL+
Sbjct: 618 MADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLN 677

Query: 682 NTVEERFEEATDFILDSFEEWSDEE 706
           +T+EERF+EATDFILDSFEEWSD E
Sbjct: 678 STIEERFDEATDFILDSFEEWSDSE 702

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/707 (69%), Positives = 583/707 (82%), Gaps = 3/707 (0%)

Query: 2   DSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLC 61
           +SA VK E        LK   E       + +  S  KR  IVPAC PKLHYTPL+TGLC
Sbjct: 3   ESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLC 62

Query: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD +GDLMLKI
Sbjct: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122

Query: 122 PVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGA 181
           PVR AT EEIL+VHTKEHLEFI  T  M+R+QLLKETEKGDSVYFNNDSY SA+L CGGA
Sbjct: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182

Query: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMI 241
           IEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR+IM+
Sbjct: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242

Query: 242 LDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITW 301
           LDWD+HHGNGTQK+FY DD+VLYISLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI W
Sbjct: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302

Query: 302 PVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHM 361
           P  GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHM
Sbjct: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362

Query: 362 LKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVV 421
           LKSLARGNLC VLEGGY+LD+IA SAL+VAKVLIG                V E+ID V+
Sbjct: 363 LKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAV-EVIDSVI 421

Query: 422 RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLI 481
           + QSKYW CF+  H N GC+F E   D+ I+KNFPLQ AIRQQQ+  L++EF FVTLPL 
Sbjct: 422 KTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLF 481

Query: 482 NMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWG 541
             ELPD+  +C+PN+ ++S ++V VHDT  +WA+R+  +GTID S+S+++D  LD IKW 
Sbjct: 482 KKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541

Query: 542 LDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSG 601
             R YG+ID+NIP +L E DNYS +IT+QEVL+++WDNY+KYFP++ ++A++ IGD++SG
Sbjct: 542 SSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSG 601

Query: 602 IVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKE-- 659
           +VHLLGHRDTR+V K+ ++F+  + L+PL+PLVDETL +WYFKNSLVF +  H CW    
Sbjct: 602 VVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDG 661

Query: 660 NESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           NE++KPRKKFGRVL+CD+DG++N +EERFEEATDFILD+FEEWSD E
Sbjct: 662 NENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1066 bits (2757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/685 (71%), Positives = 580/685 (84%), Gaps = 4/685 (0%)

Query: 24  GMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPH 83
            + EE+N  S T K KR VIVPAC  KLHYTPL+TGLCYDVRMRYHAKIFTSYFEYIDPH
Sbjct: 26  ALLEEENGGSET-KVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPH 84

Query: 84  PEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFI 143
           PEDPRRIYRIYKILAENGLI DPTLSGVDD+GDLMLKIP R AT EEIL+VHT EHLEF+
Sbjct: 85  PEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFL 144

Query: 144 ESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPP 203
             T  M+REQLLKETEKGDSVYFNNDSY SA+L CGGAIEAC+AVVEGRVKN+LAVVRPP
Sbjct: 145 SKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPP 204

Query: 204 GHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVL 263
           GHHAEP  AGGFCLFSNVAVAA+NILKNYPESV++IMILDWD+HHGNGTQK+FY DD+VL
Sbjct: 205 GHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVL 264

Query: 264 YISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMG 323
           Y+SLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQVV+PMG
Sbjct: 265 YVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMG 324

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAI 383
           REF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLKSLARGN+C VLEGGY+LD+I
Sbjct: 325 REFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSI 384

Query: 384 AISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRRHANSGCNFN 443
           A SAL VAKVLIG                V E+ID V+++QS+YW CF+  HAN GC+F 
Sbjct: 385 AKSALGVAKVLIGEPPDELPVVKQPKPEAV-EVIDAVIKMQSRYWQCFKSTHANDGCSFK 443

Query: 444 EPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLL 503
           EP+ ++++++NFPLQ AIRQQQ+  L+ E+NFVTLPLI  ELPD+  LC+PN+ +S +++
Sbjct: 444 EPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSII 503

Query: 504 VVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNY 563
           V VHDT ++WA+R+  +GTID S+S+++D  LD IKW   R YG+ID+NIP +L E DNY
Sbjct: 504 VCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNY 563

Query: 564 SGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLG 623
           S ++T+QEVL+Y+WD+Y+KYF +++K+A++ IGD+YSG+VHLLGHRDTR V K  I+F+ 
Sbjct: 564 SAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFID 623

Query: 624 DKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN--ESRKPRKKFGRVLRCDTDGLS 681
            + L+PLVPLVDE+L +WYFKNSLVF +  H CW  +  E++KPRKKFGRVL+C++DGL+
Sbjct: 624 QRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLN 683

Query: 682 NTVEERFEEATDFILDSFEEWSDEE 706
           N +EERFEEATDFILD+FEEWSD E
Sbjct: 684 NILEERFEEATDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/687 (68%), Positives = 578/687 (84%), Gaps = 3/687 (0%)

Query: 22  LEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYID 81
           +E MK   + L T ++ KR +IVP   PK+HY PL+TGLCYDVRMRYHAKIFTSYFEYID
Sbjct: 21  VENMKTAVSKL-TVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYID 79

Query: 82  PHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLE 141
           PHPEDPRRIYRIYKILAENGLI DPTLSGVDD+G+LMLKIP+R AT +EIL VH+KEH+E
Sbjct: 80  PHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVE 139

Query: 142 FIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVR 201
           F+++T  MSREQLLKETE GDSVY+NNDS  SA+L CGGAIEACKAVVEGRVKN+LAVVR
Sbjct: 140 FLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVR 199

Query: 202 PPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQ 261
           PPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR++MILDWDIHHGNGTQ++FY D++
Sbjct: 200 PPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNR 259

Query: 262 VLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMP 321
           VLY+SLHR+E+G+YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDAEYMWAFEQ+V+P
Sbjct: 260 VLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIP 319

Query: 322 MGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLD 381
           MGREF+PDLVIISSGFDAADGDTIGQCHV+P+CYGHMTHMLKSLA+GN+CVVLEGGYNLD
Sbjct: 320 MGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLD 379

Query: 382 AIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRRHANSGCN 441
           +IA SAL V KVLIG                 I  I+ V+R Q+KYW+CF+ +H N G N
Sbjct: 380 SIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVN 439

Query: 442 FNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESST 501
           + EP+++S+  KNFPLQ A+RQ+Q   LS E+ FVTLPL++MEL  + ++C+PN+ E+ T
Sbjct: 440 WKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDT 499

Query: 502 LLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEAD 561
           L++ VHDT +VWAKRN ++G ID S+S+++D  L    W L R YGIID+NIP +LFE D
Sbjct: 500 LIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELD 559

Query: 562 NYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINF 621
           NYS ++TSQEVL YLWD+Y+K+F  + ++A++GIGD+YSG VHLLGHRDTR++ K  I+F
Sbjct: 560 NYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISF 619

Query: 622 LGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCW--KENESRKPRKKFGRVLRCDTDG 679
              KQL+PLVPLVDE++++WYFKNSL+FT+  H CW  + N+S+KPRKKFGRVL+C++DG
Sbjct: 620 TDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDG 679

Query: 680 LSNTVEERFEEATDFILDSFEEWSDEE 706
           ++N +EERFEEATDFILDSFEEWSD E
Sbjct: 680 MNNILEERFEEATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/710 (67%), Positives = 578/710 (81%), Gaps = 10/710 (1%)

Query: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKN--KRQVIVPACTPKLHYTPLRT 58
           M+S     E LE P       ++ +K E  + +  SK+  +R VIVP   PK+ Y+ L+T
Sbjct: 1   MESKKPAEEPLERP------SIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKT 54

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG D +GDLM
Sbjct: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPC 178
           +K+PVR A  EEIL+VH+++HL+FI  TE++ RE LLKETE GDSVYFNNDSY SA+L C
Sbjct: 115 VKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSC 174

Query: 179 GGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
           GGAIEACKAVVEGRVKNS+AVVRPPGHHAEP+ AGGFCLFSNVAVAA N+LK+YPESVR+
Sbjct: 175 GGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234

Query: 239 IMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCN 298
           IMI+DWDIHHGNGTQK+FY DD+VLY+SLHR+++GKYYPGTI G YDQTGEGKGEGFNCN
Sbjct: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294

Query: 299 ITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHM 358
           ITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+ISSGFDAADGDTIGQCHVTP+CYGHM
Sbjct: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354

Query: 359 THMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMID 418
           THML SLA+GNLCVVLEGGYNLD+IA SAL V KVL+G                  +MI+
Sbjct: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIE 414

Query: 419 KVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTL 478
            V+R QSKYW+CF+ RH N G NF + I  ++ ++NFPLQ AIR+ Q+  LS +FNFV L
Sbjct: 415 TVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQL 474

Query: 479 PLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFI 538
           P++++ LP N +LCT  + +S TL+V+VHDT ++W++R+  +G ID SSS+++DN L  I
Sbjct: 475 PILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMI 534

Query: 539 KWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDS 598
            W +DR+YGIID+NIP TLFE  NY G+ +SQE+LIYLWDNY+K+F  + K+A+IGIGD+
Sbjct: 535 NWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDA 594

Query: 599 YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCW- 657
           Y GIVHLLGHRDTR+V K  I+FL  K LK +VPL+DETL +WYFKNSLVFT+++H CW 
Sbjct: 595 YGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWG 654

Query: 658 -KENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
              NE++K RKK+GRVL+ D DG++N  +ERFEEATDFILDSFEEWS+ E
Sbjct: 655 STANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1018 bits (2631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/655 (69%), Positives = 556/655 (84%)

Query: 51  LHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 110
           L YTPL+TGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 111 VDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDS 170
           +DD+GDLM KIPVR ATSEEILEVH KE LE++E T+ ++R++LL +TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILK 230
           Y SA+L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVAVA KNILK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 231 NYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEG 290
           NYP+ V+++MI+DWDIHHGNGTQK+FY DD+VLY+SLHRFE+GKYYPGTI GQYDQ GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 291 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHV 350
           KGEGFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 351 TPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXX 410
           TPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIA SAL+VAKVLIG              
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 411 XXVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLS 470
              IEMID+V+ L+SKYW CF+R+  NS C +  PI++S  +K FP+Q AIR QQ+ YL+
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 471 DEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVV 530
           +++N V LPL+N  LP++ V+C+ ++ +S+  ++ VHDT ++W+KR+ I+G ID S+S+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 531 IDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKI 590
           +D  L F  W LDR YGIIDVNIP TL+E DNYS  +T+QEVLI LWDN +KYFP V KI
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544

Query: 591 AYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFT 650
           AYIG+G++YSG+VHLLGHRDTR+V K+VI F+G K LK LVPLV+E+L +WYFK SL+F 
Sbjct: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604

Query: 651 NNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDE 705
           + +H CW EN+S+KPRK++GRVLRCD+DG+ + +EERFEEATDFI+DS +EW++E
Sbjct: 605 DKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/674 (69%), Positives = 554/674 (82%), Gaps = 5/674 (0%)

Query: 38  NKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKIL 97
            KR VIVP   PK+ Y PL+TGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKIL
Sbjct: 32  QKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKIL 91

Query: 98  AENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKE 157
           AENGLI DPTLSG+D++G+LM KIPVR AT EEIL VH+KEH+EF+++T  M REQLLKE
Sbjct: 92  AENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKE 151

Query: 158 TEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCL 217
           TE GDSVY+NNDS  SARL CGGAIEACKAVVEGRVKN++AVVRPPGHHAEP  AGGFCL
Sbjct: 152 TEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCL 211

Query: 218 FSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYP 277
           FSNVAVAA+NILKNYPESVRR+MILDWDIHHGNGTQK+FY D++VLY+SLHR+E+GKYYP
Sbjct: 212 FSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYP 271

Query: 278 GTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGF 337
           GT  G YDQ G+GKGEGFNCNI W   GVGDAEYMWAFEQVV+PMGREF+PDLVIISSGF
Sbjct: 272 GTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGF 331

Query: 338 DAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGX 397
           DAADGDTIGQCHV+P+CYGH+THMLKSLARGN+CVVLEGGYNLD+IA SAL VAKVLIG 
Sbjct: 332 DAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGE 391

Query: 398 XXXXXXXXXXXXXXXVIEMID-KVVRLQSKYWNCFRRRHANSGCNFNE-PINDSIISKNF 455
                           I  ID  +V+ QSKYWNCF+ RH N G N+ E  +NDS+ SKNF
Sbjct: 392 PPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNF 451

Query: 456 PLQKAIR-QQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWA 514
           PLQK      Q   L+ E+ FVTLPL+NMELP + ++C+PN+  +  +++ VHDT ++WA
Sbjct: 452 PLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWA 511

Query: 515 KRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLI 574
           +R+ ++G ID S+S+++D  +  I W L R YG+ID+NIP +LFE DNYS +++SQEV+ 
Sbjct: 512 QRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVT 571

Query: 575 YLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLV 634
           YLWD+Y+K FP +A++A++GIGD+YSG VHLLGHRDTR+V K  I F   KQL+PLVPLV
Sbjct: 572 YLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLV 631

Query: 635 DETLTEWYFKNSLVFTNNSHQCWKE--NESRKPRKKFGRVLRCDTDGLSNTVEERFEEAT 692
           DE+L +WYFKNSLVFT+  H CW    N+S+KPRKKFGRVLR   DG++N VEER EEAT
Sbjct: 632 DESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEAT 691

Query: 693 DFILDSFEEWSDEE 706
           DFILDSFEEWS+ E
Sbjct: 692 DFILDSFEEWSESE 705

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/668 (69%), Positives = 558/668 (83%), Gaps = 2/668 (0%)

Query: 39  KRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98
           KR VIVP   P LHYTPL+TG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93

Query: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158
           ENGLINDP+L+GV D+GDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153

Query: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218
           EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213

Query: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPG 278
           SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLYISLHRFE+GK+YPG
Sbjct: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273

Query: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338
             +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333

Query: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGXX 398
           AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIG  
Sbjct: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393

Query: 399 XXXXXXXXXXXXXXVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458
                         V+EMI+KV+R+QSKYW CFRR+  N G  +   I +S I K FPLQ
Sbjct: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452

Query: 459 KAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNV 518
            AIR  QL +  D+F  ++L L N+ LP N ++C+ N  ++ +L V++HDT +VW  R++
Sbjct: 453 DAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDI 512

Query: 519 ISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWD 578
           I+G ID S+S++ D+ L FI W ++R+  +ID+NIP + FEADNYS  + SQ+V+I LWD
Sbjct: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572

Query: 579 NYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638
           N+ KY  ++ K+ +IGIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632

Query: 639 TEWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDS 698
            +WYFKNSLVFT++ H CW EN+ +KPRKK+GRVLRCDTDG+ N +EERFEEATDFILD+
Sbjct: 633 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691

Query: 699 FEEWSDEE 706
           F+EWSD E
Sbjct: 692 FDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/486 (75%), Positives = 406/486 (83%), Gaps = 15/486 (3%)

Query: 24  GMKEEQNSLSTTSKN--------------KRQVIVPACTPKLHYTPLRTGLCYDVRMRYH 69
           G+K     L T +KN              K+Q+IVP   PK+HY PL+TGLCYDVRMRYH
Sbjct: 11  GLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYH 70

Query: 70  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSE 129
           AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD++GDLMLK+P+R AT  
Sbjct: 71  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMN 130

Query: 130 EILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVV 189
           EILEVH+ EH +++E T   +REQLLKETE GDSVYFNNDS+ SA+L CGGAIEACKAVV
Sbjct: 131 EILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVV 190

Query: 190 EGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHG 249
           EGRVKN++AVVRPPGHH+EP++AGGFCLFSNVAVA KNILKNYPESVR+++ILDWDIHHG
Sbjct: 191 EGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHG 250

Query: 250 NGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDA 309
           NGTQK+FY DD VLYISLHRFE+GKYYPGTIQGQYDQTGEGKGEGFNCNITWP+G VGDA
Sbjct: 251 NGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDA 310

Query: 310 EYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGN 369
           EYMWAFEQVVMPM REF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGN
Sbjct: 311 EYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGN 370

Query: 370 LCVVLEGGYNLDAIAISALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVVRLQSKYWN 429
           LCVVLEGGYNLDAIA SALSV+K+LIG                VIEMIDK++RLQSKYW 
Sbjct: 371 LCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDKIIRLQSKYWK 430

Query: 430 CFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNI 489
           CFRRRH N GCNF E INDS+ISKNFPLQ AIR  Q   L DE NF+TLP+ N +  +N+
Sbjct: 431 CFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNFQ-KNNM 489

Query: 490 VLCTPN 495
              T N
Sbjct: 490 STSTTN 495

 Score =  332 bits (850), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/222 (65%), Positives = 186/222 (83%)

Query: 485 LPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDR 544
           L +N +LC+P +  S TL+V+VHD+ D+W KR+V +G +DLSS+++ID+ LDFIKW LDR
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 545 KYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVH 604
            YG+ID+NIP TLFE DNYS ++ +QE L+  WDNY+KYFP + KI +IG GD+++GIVH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 605 LLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKENESRK 664
           LLGHRDTR+V K+VINFLG K LK LVPLVDETL++WYFKNSLVFT+ +H  W +NE++K
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753

Query: 665 PRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           PRKKFGRVLR   DG++N +EERF+EATDFILDSFEEWSDEE
Sbjct: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/298 (81%), Positives = 272/298 (91%)

Query: 39  KRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98
           KRQVIVP   PKLHYTPL+TGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111

Query: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158
           ENGLI D  LSG+DD+GD+MLKIPVR AT EEIL VHT+EHL+FIE+ E  SRE+L+K T
Sbjct: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171

Query: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218
           EK DSVY+NNDSY SA+L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEPQAAGGFCLF
Sbjct: 172 EKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231

Query: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPG 278
           SNV+VAA++IL+ YPESVR+I+ILDWDIHHGNGTQK+FY+D+ VLYISLHR+E   +YPG
Sbjct: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291

Query: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSG 336
           TI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  270 bits (690), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 169/224 (75%)

Query: 483 MELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGL 542
           M+  + +VL +  + ++ TL+++VHDT ++W  R++I+G +D S+SV+ID  + FIKW  
Sbjct: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412

Query: 543 DRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGI 602
           DR Y I+D+NIP +  E + +S    + E+++ LWDN+++Y   + KI +IGIG+SY GI
Sbjct: 413 DRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGI 472

Query: 603 VHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKENES 662
           VHL+G RD R ++K VINF+G+  LK L    DET+ +WYFKNSLVFTN+SH CWKE+E 
Sbjct: 473 VHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEE 532

Query: 663 RKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706
           ++PRKKFGRVL+ D+DG+ + + ERF+EATDFILD+FEEWSDEE
Sbjct: 533 KRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  137 bits (346), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 93/323 (28%), Positives = 167/323 (51%), Gaps = 30/323 (9%)

Query: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121
           Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL +     
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE----- 76

Query: 122 PVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176
             R AT+EE+++ H++++L+F+     E+  KM R  L K     D   F N  Y  + L
Sbjct: 77  -TRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LYDYSTL 134

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGF 295
             R++ +D D+HHG+G Q++FY  D+V  IS H+F  G+++PGT  G YD+TG  KG+ F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHF 245

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ ++ P+   +KP +++   G D+   D +G  ++    +
Sbjct: 246 AMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGH 304

Query: 356 GHMTHMLKSLARGNLCVVLEGGY 378
           G     +KS     + VV  GGY
Sbjct: 305 GECVKFIKSFGIP-MLVVGGGGY 326

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  136 bits (343), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 166/326 (50%), Gaps = 30/326 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      +++L  + L++   L  + DL +  
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKP------FRLLLTDHLVSSYGLHKIMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R ATSEEI E HT+++++F+     E+  KM R  L K     D   F N  +  
Sbjct: 73  ----TRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LFNY 127

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
            +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 128 CKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G +D+ G   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANG 238

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D IG  ++T 
Sbjct: 239 KHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTI 297

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGY 378
             +G     ++S     L VV  GGY
Sbjct: 298 KGHGECVKFIRSFGIPML-VVGGGGY 322

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 167/327 (51%), Gaps = 32/327 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V DL +  
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKP------FRLMLTDHLVSRYGLHKVMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                RAAT EE+L  H +++++F+     E+  K+ R  L K    GD        +  
Sbjct: 73  ----TRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEK-FNIGDDCPIFQGLFEY 127

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 128 SMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G  D+ G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 238

Query: 293 EGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT 351
           + F+ N+  P+  G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G  ++ 
Sbjct: 239 KHFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLN 296

Query: 352 PSCYGHMTHMLKSLARGNLCVVLEGGY 378
              +G     +KS     LCV   GGY
Sbjct: 297 IRAHGECVKFVKSFGIPMLCVG-GGGY 322

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/327 (28%), Positives = 162/327 (49%), Gaps = 32/327 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P R      +++  GL N            +M
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGLHN------------IM 69

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R AT EE+L+ H+++++EF+     ++  KM R    K     D   F N  Y  
Sbjct: 70  DLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQN-IYEY 128

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
            +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 129 CKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYH 186

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G YD+ G  +G
Sbjct: 187 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAEG 239

Query: 293 EGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT 351
           + F  N+  P+  G+ D  Y+  F+ V+ P+   FKP  +I   G D+   D +G  ++ 
Sbjct: 240 KHFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLN 297

Query: 352 PSCYGHMTHMLKSLARGNLCVVLEGGY 378
              +G     ++S     + VV  GGY
Sbjct: 298 IKAHGECVKFIRSFGIP-MVVVGGGGY 323

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 98/355 (27%), Positives = 176/355 (49%), Gaps = 39/355 (10%)

Query: 30  NSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRR 89
           ++ +  SK K++       P+  Y     G  Y  R+ YH     S + Y   HP  P  
Sbjct: 3   STFAYDSKTKKE------QPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKP-- 51

Query: 90  IYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFI-----E 144
               ++++  + L++   L  + DL +       R AT EE+ + H+++++EF+     E
Sbjct: 52  ----FRLMLTDHLVSSYGLHKIMDLYE------TREATREEMSQFHSQDYIEFLSKVTPE 101

Query: 145 STEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG 204
           +  KM R  L K     D   F N  Y  + L  G +++A + ++    ++ +A+    G
Sbjct: 102 NLSKMPRGTLEKFNIGDDCPIFQN-IYDYSTLYTGASLDASRKLIND--QSDIAINWSGG 158

Query: 205 -HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVL 263
            HHA+     GFC  +++ ++  N+L+ +P    R++ +D D+HHG+G Q++FY  D+V 
Sbjct: 159 LHHAKKNNPSGFCYVNDIVLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVF 214

Query: 264 YISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMG 323
            IS H+F  G+++PGT  G +D+ G  KG+ F  N+     G+ D  Y+  F+ ++ P+ 
Sbjct: 215 TISFHKFN-GEFFPGT--GDFDEIGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLI 270

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 378
             +KP ++I   G D+   D +G  ++    +G     +KS     + VV  GGY
Sbjct: 271 TAYKPTVIIQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGY 324

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  134 bits (337), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 95/336 (28%), Positives = 168/336 (50%), Gaps = 33/336 (9%)

Query: 49  PKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTL 108
           P+ +Y     G  Y  R+ YH     S + +   HP  P R+           ++ D  +
Sbjct: 16  PQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLV 61

Query: 109 SGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDS 163
           SG   L  +M     R A+ +E+LE HT +++ F+     ++  KM R  L K     D 
Sbjct: 62  SGYG-LHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDC 120

Query: 164 VYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVA 222
             F+N  Y  + L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ 
Sbjct: 121 PIFHN-LYEYSSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIV 177

Query: 223 VAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQG 282
           ++  N+L+ +P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G
Sbjct: 178 LSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--G 230

Query: 283 QYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADG 342
            YD+TG   G+ F  N+     G+ D  Y+  F+ ++ P+   + P ++I   G D+   
Sbjct: 231 NYDETGCSNGKHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGH 289

Query: 343 DTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 378
           D +G  ++    +G     +KS     L VV  GGY
Sbjct: 290 DRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGY 324

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  134 bits (337), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 92/332 (27%), Positives = 166/332 (50%), Gaps = 30/332 (9%)

Query: 53  YTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 112
           Y P   G  Y   + YH     S + Y   HP  P      ++++  + L++   L  + 
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKP------FRLMLTDHLVSSYGLHKIM 67

Query: 113 DLGDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFN 167
           DL +       R AT +E+LE H+ +++EF+     ++  KM R  L K     D   F 
Sbjct: 68  DLYE------TREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIFQ 121

Query: 168 NDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAK 226
              +  + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  
Sbjct: 122 G-IFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAIL 178

Query: 227 NILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQ 286
           N+L+ +P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G +D+
Sbjct: 179 NLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDE 231

Query: 287 TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIG 346
            G  +G+ F  N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G
Sbjct: 232 IGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLG 290

Query: 347 QCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 378
             ++    +G     +KS     L VV  GGY
Sbjct: 291 CFNLNIRAHGECVKFVKSFGIPML-VVGGGGY 321

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  134 bits (336), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 91/324 (28%), Positives = 164/324 (50%), Gaps = 29/324 (8%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y+  + YH     S F Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET-EK---GDSVYFNNDSYASA 174
                R AT EE+ E H  +++EF+      +  +L + T EK   GD        Y  +
Sbjct: 73  ----TRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 175 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYP 233
            L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 234 ESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGE 293
               R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G  D+TG  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 294 GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPS 353
            F  N+     G+ D  Y+  F+ ++ P+   FKP ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 354 CYGHMTHMLKSLARGNLCVVLEGG 377
            +G     +KS   G   +VL GG
Sbjct: 299 AHGECVRFVKSF--GIPMLVLGGG 320

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  134 bits (336), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 95/326 (29%), Positives = 163/326 (50%), Gaps = 30/326 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   +  +M
Sbjct: 22  GAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MHKVM 69

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIESTE-----KMSREQLLKETEKGDSVYFNNDSYAS 173
                RAAT++E+ E HT++++ F++        K+ R  L K     D   F N  Y  
Sbjct: 70  DLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQN-LYDY 128

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           A L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +
Sbjct: 129 ATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLRYH 186

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  IS H++  G ++PGT  G  D+TG   G
Sbjct: 187 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCDAG 239

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           E F  N+     G+ D  Y+  F+ V+ P+   + P ++I   G D+   D +G  ++  
Sbjct: 240 ERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNLNI 298

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGY 378
             +G     +KS     L VV  GGY
Sbjct: 299 KAHGECVKFVKSFGIPML-VVGGGGY 323

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  134 bits (336), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 165/326 (50%), Gaps = 30/326 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 76

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R+AT +E+L+ H+ +++ F+     E+  KM R  L K     D   F N  Y  
Sbjct: 77  ----TRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQN-LYDY 131

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 132 SALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYH 189

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  IS H++  G+++PGT  G YD+ G  +G
Sbjct: 190 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQG 242

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G  ++  
Sbjct: 243 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNI 301

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGY 378
             +G     ++S     L VV  GGY
Sbjct: 302 KAHGECVKFIRSFGIPML-VVGGGGY 326

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 163/323 (50%), Gaps = 28/323 (8%)

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + DL +    
Sbjct: 23  AYSPRVSYHFNPKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK----GDSVYFNNDSYASARL 176
              R+AT +E+LE H+++++ F+      +  +L + T +    GD      + Y    L
Sbjct: 73  --TRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGF 295
             RI+ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ +V P+   FKP L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 356 GHMTHMLKSLARGNLCVVLEGGY 378
           G     +KS     L VV  GGY
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGY 322

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 94/333 (28%), Positives = 168/333 (50%), Gaps = 31/333 (9%)

Query: 53  YTPL-RTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGV 111
           + PL   G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG 
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY 62

Query: 112 DDLGDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYF 166
             L  +M     R AT+EE+ E H+++++ F+     E+  K+ R  L K     D   F
Sbjct: 63  G-LHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 167 NNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAA 225
            N  +  + L  G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ +A 
Sbjct: 122 PN-IFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAI 178

Query: 226 KNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYD 285
            N+L+ +P    R++ +D D+HHG+G Q++FY  D+V  IS H++  G+++PGT  G+ D
Sbjct: 179 LNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKND 231

Query: 286 QTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTI 345
           +TG   G+ F  N+     G+ D  Y+  F+ ++ P+   FKP +++   G D+   D +
Sbjct: 232 ETGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRL 290

Query: 346 GQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 378
           G  ++    +G     ++S     + VV  GGY
Sbjct: 291 GCFNLNIKAHGECVKFVRSFGIP-MLVVGGGGY 322

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  131 bits (330), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 91/330 (27%), Positives = 164/330 (49%), Gaps = 30/330 (9%)

Query: 55  PLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDL 114
           P   G  Y  ++ YH     S + Y   HP  P      ++++  + L++   L  + DL
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLVSCYGLHKIMDL 106

Query: 115 GDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNND 169
            +       R AT EE+LE H  +++EF+     E+  K+ R  L K    GD       
Sbjct: 107 YE------TREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEK-FNIGDDCPIFQG 159

Query: 170 SYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNI 228
            +  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++
Sbjct: 160 MFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISL 217

Query: 229 LKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTG 288
           L+ +P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G  D+ G
Sbjct: 218 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIG 270

Query: 289 EGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQC 348
             KG+ F+ N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G  
Sbjct: 271 CSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCF 329

Query: 349 HVTPSCYGHMTHMLKSLARGNLCVVLEGGY 378
           ++    +G     +KS     LCV   GGY
Sbjct: 330 NLNIKAHGECVKFVKSFGIPILCVG-GGGY 358

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 163/324 (50%), Gaps = 30/324 (9%)

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + DL +    
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 121 IPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYASAR 175
              R+AT +E+L+ H+++++ F+     E+  K+ R  L       D   F N  Y    
Sbjct: 73  --TRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQN-LYDYTT 129

Query: 176 LPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPE 234
           L  G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P 
Sbjct: 130 LYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP- 186

Query: 235 SVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEG 294
              RI+ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ 
Sbjct: 187 ---RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKH 240

Query: 295 FNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSC 354
           F  N+     G+ D  Y+  F+ +V P+   FKP L++   G D+   D +G  ++    
Sbjct: 241 FALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 355 YGHMTHMLKSLARGNLCVVLEGGY 378
           +G     +KS     L VV  GGY
Sbjct: 300 HGECVKFVKSFGLPML-VVGGGGY 322

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/327 (27%), Positives = 165/327 (50%), Gaps = 32/327 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 74

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIE-----STEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R AT EE+ + H+ ++L+F+E     +  K+ R  L K     D   F N  Y  
Sbjct: 75  ----TREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  IS H++  G+++PGT  G YD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 293 EGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT 351
           + F  N+  P+  G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  ++ 
Sbjct: 241 KHFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLN 298

Query: 352 PSCYGHMTHMLKSLARGNLCVVLEGGY 378
              +G     + S     + VV  GGY
Sbjct: 299 IKAHGECVKFVSSFGIP-MLVVGGGGY 324

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 87/323 (26%), Positives = 163/323 (50%), Gaps = 28/323 (8%)

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + DL +    
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK----GDSVYFNNDSYASARL 176
              R+AT +E+L+ H+++++ F+      +  +L + T +    GD      + Y    L
Sbjct: 73  --TRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGF 295
             RI+ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ +V P+   FKP L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 356 GHMTHMLKSLARGNLCVVLEGGY 378
           G     +KS     L VV  GGY
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGY 322

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  129 bits (323), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 163/326 (50%), Gaps = 30/326 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  +   + YH     S F Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R AT EE+ E H+++++EF+     ++  K+ R  L K     D   F    Y  
Sbjct: 73  ----TRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQG-LYQY 127

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 128 STLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYH 185

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G  D+ G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRG 238

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   FKP ++I   G D+   D +G  ++  
Sbjct: 239 KHFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNV 297

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGY 378
             +G     +KS     L VV  GGY
Sbjct: 298 KAHGECVKYVKSFGLPML-VVGGGGY 322

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  129 bits (323), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 89/323 (27%), Positives = 157/323 (48%), Gaps = 30/323 (9%)

Query: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121
           Y  R+ YH     S++ Y   HP  P R+     +++  GL              +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL------------HKIMDLY 71

Query: 122 PVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176
             R+AT +E+ E HT++++ F+     E+  K+ R  L       D   F N  Y    L
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQN-LYDYTTL 130

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G  ++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGF 295
             R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ +V P+   FKP +++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 356 GHMTHMLKSLARGNLCVVLEGGY 378
           G     +KS     L VV  GGY
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGY 322

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  128 bits (321), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 166/329 (50%), Gaps = 30/329 (9%)

Query: 56  LRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLG 115
            + G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL 
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKP------FRLMLTDHLVSSYGLHKIMDLY 70

Query: 116 DLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDS 170
           +       R AT EE+   H++E+++F+     E+  K+ R  L K     D   F N  
Sbjct: 71  E------TRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPN-L 123

Query: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNIL 229
           Y  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 124 YDYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 181

Query: 230 KNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGE 289
           + +P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G +D+ G 
Sbjct: 182 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGC 234

Query: 290 GKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCH 349
            +G+ F  N+     G+ D  Y+  F+ ++ P+   +KP +++   G D+   D +G  +
Sbjct: 235 ARGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFN 293

Query: 350 VTPSCYGHMTHMLKSLARGNLCVVLEGGY 378
           +    +G   + ++S     L VV  GGY
Sbjct: 294 LNVKAHGECVNFVRSFGLPML-VVGGGGY 321

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  127 bits (320), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 164/326 (50%), Gaps = 30/326 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V DL +  
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKP------FRLMLTDHLVSAYGLHKVMDLYE-- 75

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R+AT +E+ + H+++++ F+     ++  K+ R  L K     D   F    +  
Sbjct: 76  ----TRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQG-MFDY 130

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 131 AALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYH 188

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G  D+ G  +G
Sbjct: 189 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 241

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  ++  
Sbjct: 242 KHFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGY 378
             +G     +KS     L VV  GGY
Sbjct: 301 KAHGECVRFVKSFGVPML-VVGGGGY 325

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     L VV  GGY +  +A
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVA 319

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 129 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 239 L-RDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVA 320

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++ +G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  124 bits (310), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ D+ Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     L VV  GGY +  +A
Sbjct: 297 YVKSFGIPML-VVGGGGYTMRNVA 319

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + +V  GGY +  +A
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVA 319

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     L +V  GGY +  +A
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVA 319

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + H+ E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ D  Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     L VV  GGY +  +A
Sbjct: 297 YVKSFGIPML-VVGGGGYTMRNVA 319

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  123 bits (308), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      +     KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  122 bits (307), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  122 bits (307), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MESAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  122 bits (305), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  121 bits (304), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 153/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 153/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  120 bits (300), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  +    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  118 bits (296), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 153/324 (47%), Gaps = 28/324 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA +   FE VV  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIA 384
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 116/242 (47%), Gaps = 21/242 (8%)

Query: 144 ESTEKMSREQLLKETEKGDSVYFNNDSY--ASARLPCGGAIEACKAVVEGRVKNSLAVVR 201
           ++ ++M RE+L     +GD   F   SY     ++  G  +   K +     + ++AV  
Sbjct: 172 DNEKEMIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNW 228

Query: 202 PPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDD 260
             G HHA    A GFC  +++ +  + +  N     +RI  +D+D+HHG+G Q+SF    
Sbjct: 229 DGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYST 285

Query: 261 QVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVM 320
            V  IS H FE G ++P T  G   ++  GK      NI   + GV D       E+V++
Sbjct: 286 SVQTISAHMFEPG-FFPCT--GSLKESKMGKNI---VNIPL-LHGVDDMLMNEIVEKVMI 338

Query: 321 PMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL---EGG 377
           P  + + P++++I  G D   GD   +  +T   +G + ++LK L     C V+    GG
Sbjct: 339 PCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGGG 396

Query: 378 YN 379
           YN
Sbjct: 397 YN 398

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 91/177 (51%), Gaps = 13/177 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + ++  LD+D+HHG+G +K+F    Q+  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQVVMPMG 323
           IS+H +E G ++PGT  G  + +  GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 379
           +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HH+  + A GFC  +++ +    I K   +  R+I  LD+D+HHG+G +KSF     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGR 324
           IS+H FE G ++P T  G  ++T      GFN      + G+ D    +   +V++P+ +
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 325 EFKPDLVIISSGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNLCVVLEGGYN 379
           + KP+ +++  G D   GD   +  +T S    ++  +L++    ++ ++  GGYN
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + +I  +D+D+HHG+G +++F    Q+  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQVVMPMG 323
           IS+H +E G ++PGT  G  +   +GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 379
           +   PD++II  G D   GD   +  +T       + +++K   R ++ ++  GGYN
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 104/208 (50%), Gaps = 14/208 (6%)

Query: 179 GGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVR 237
           G  +     V++G  + S+ +    G HHA  Q A GFC  +++ +  + + +   +  +
Sbjct: 181 GATLMLADKVIKG--ERSIGINWDGGRHHAFKQKASGFCYVNDIVLLIQKLRR---KGFQ 235

Query: 238 RIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNC 297
           +I  +D+D+HHG+G +K+F     V  ISLH FE+G ++PGT  G   ++ + +      
Sbjct: 236 KISYIDFDLHHGDGVEKAFQFSSNVQTISLHLFEVG-FFPGT--GNLSESDKRRNV---V 289

Query: 298 NITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH 357
           NI   + G+ D       EQ+V P+    +PD+++I  G D   GD   +  ++      
Sbjct: 290 NIPL-LHGLDDTSLEQLIEQIVKPVIERHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAK 348

Query: 358 -MTHMLKSLARGNLCVVLEGGYNLDAIA 384
            +T ++ +     + ++  GGYN+  ++
Sbjct: 349 CITELINNTKDCPVILLGGGGYNVTLMS 376

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 131/277 (47%), Gaps = 31/277 (11%)

Query: 127 TSEEILEVHTKEHLEFIESTEKMSR-EQLLKETEKGDSVY-------FN--NDSYASARL 176
           T  E+L  + ++H+E  E  +K +  E  L + E GD V        FN  +D      L
Sbjct: 110 TYSELLHYY-RDHIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLDDCPIFPYL 168

Query: 177 P------CGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNIL 229
           P       G  +   + ++EG  + ++A+    G HH+    A GFC  +++A+    + 
Sbjct: 169 PLYCYVSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLR 227

Query: 230 KNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGE 289
           +     V RI  +D+D+HHG+G +K+F    QV  ISLH +E G ++P +  G  +    
Sbjct: 228 RG---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSS 281

Query: 290 GKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCH 349
           GK      NI   + G+ D+      +++++P   + +P++++I  G D   GD   +  
Sbjct: 282 GKS---IVNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQ 337

Query: 350 VTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAIS 386
           +  S  G  + +   + + N  +VL GG   + + +S
Sbjct: 338 L--SIKGLTSTITSLIEQFNCHIVLLGGGGYNNLLMS 372

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 107/222 (48%), Gaps = 19/222 (8%)

Query: 166 FNNDSYASARLP--CGGAIEACKAVVEG---RVKNSLAVVRPPG-HHAEPQAAGGFCLFS 219
            ++D Y  A LP  C     A  ++V     R + ++++    G HHA    A GFC  +
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDGGRHHASRSRASGFCYIN 235

Query: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGT 279
           ++A+  + + +     +RRI  +D+D+HH +G +++F     V  IS+H  E G ++PGT
Sbjct: 236 DIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPGT 291

Query: 280 IQGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338
             G   +   GK       +  PV  G+ D       ++V+MP  R   P++++I  G D
Sbjct: 292 --GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 339 AADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYN 379
              GD   +  +T      ++ ++++     N+ ++  GGYN
Sbjct: 345 GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + +I  +D+D+HHG+G +K+F    Q+  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAF-EQVVMPMG 323
           IS+H +E G ++PGT  G    + + K       +  P+    D  Y+     ++V P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 379
              +P+ +II  G D   GD   +  +T       + +++KS  R ++ ++  GGYN
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + +I  LD+D+HHG+G +K+F    Q+  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMG 323
           IS+H +E G ++PGT  G  D +  GK       +  P+  G  D+       +++ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 379
            +  P+++II  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 14/177 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HH+    A GFC  +++ +A + + +N+      I  +D+D+HHG+G +++F     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 323
           ISLH  E G ++PGT   +  Q G          I  P+  G  D   M   E VV+P  
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-------INIPLRHGADDDCLMKITESVVIPCI 349

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYN 379
           ++  P +++I  G D   GD   +  +T       +  +L SL   ++ ++  GGYN
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYN 406

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 98/203 (48%), Gaps = 14/203 (6%)

Query: 180 GAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
           GA  +    ++   + S+A+    G HHA    A GFC  +++ +  + I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 239 IMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCN 298
           I  +D+D+HHG+G QK+F     V  +SLH FE G ++P T   Q     E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCTGSLQ-----EAKAGSSIVN 299

Query: 299 ITWPVGGVGDAEYMWAFEQ-VVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT-PSCYG 356
           I  P+    D  ++    + +++P+  + +P++++I  G D   GD   +  +T     G
Sbjct: 300 I--PLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSG 357

Query: 357 HMTHMLKSLARGNLCVVLEGGYN 379
            +  ++ +    ++ ++  GGYN
Sbjct: 358 AIMKLINTFPSCSVVLLGGGGYN 380

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 100/222 (45%), Gaps = 19/222 (8%)

Query: 166 FNNDSYASARLP-----CGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFS 219
            ++D +  A LP       GA          R + +++V    G HHA    A GFC  +
Sbjct: 179 LSHDCHPFAYLPMYCQVVTGATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVN 238

Query: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGT 279
           ++A+  + + +     + +I  LD+D+HHG+G +++F     V  IS+H +E G ++PGT
Sbjct: 239 DIAILIQKLRR---RGIHKISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT 294

Query: 280 IQGQYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338
             G       G+       +  PV  G+ D        +VV+P      P++VII  G D
Sbjct: 295 --GTLKDASSGRNI-----VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGD 347

Query: 339 AADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYN 379
              GD   +  +T       +  +++     N+ ++  GGYN
Sbjct: 348 GLIGDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYN 389

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 99/215 (46%), Gaps = 17/215 (7%)

Query: 175 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYP 233
           ++  G  +   K +V      ++ +    G HHA  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 234 ESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGE 293
              ++I  LD+D+HHG+G +K+F     +  ISLH FE G ++PG        TG    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 294 GFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           G    I  P+  G+ D       +Q+++P       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 353 SCYGHMTHMLKSLARGNLC-VVLEGGYNLDAIAIS 386
              G    ++  + + + C +VL GG   + + +S
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYNELLVS 388

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 136/330 (41%), Gaps = 74/330 (22%)

Query: 128 SEEILEVH----TKEHLEFIE-STEKMSREQL--LKETEKGDSVYFNNDSYASARLPCGG 180
           S  +L+VH     KE L     + EK+ R+Q+    E   GD +Y   ++  + R   G 
Sbjct: 105 SSHVLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGD-IYLCEETVYALRGSIGA 163

Query: 181 AIEACKAVVEGRVKNSLA-----VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
                 ++ +G V    A      +RPPGHH+      GFCL +N  +A +     Y   
Sbjct: 164 VEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--G 221

Query: 236 VRRIMILDWDIHHGNGTQ-------------------------KSFYQDDQVLYISLHRF 270
           V   +ILD+D+HHG+GTQ                         K F +  +V Y S+H  
Sbjct: 222 VTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMH-- 279

Query: 271 EIGKYYPGTIQGQYDQTGEGKG---EGFNCNITWPV-----------GGVGDAEY--MWA 314
           +I  +         D+  +      +  + NI W +             +    Y  ++A
Sbjct: 280 DINSFPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTLFA 338

Query: 315 -----FEQVVMPMGREFKP--DLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLK 363
                F+   + M ++ KP   LV++S+GFDA++ + +  Q H   V  S Y   T    
Sbjct: 339 KADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDAL 398

Query: 364 SLAR----GNLCVVLEGGYNLDAIAISALS 389
            LA+    G +  +LEGGY+  AIA    S
Sbjct: 399 KLAQMHTNGKIISLLEGGYSDAAIASGVFS 428

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 88/179 (49%), Gaps = 17/179 (9%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  + A GFC  +++ +    I K   +  +R+  +D+D+HHG+G +++F     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMG 323
           IS+H FE G ++P +  G  +   +GK      NI  P+  G+ D        QVV+P+ 
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL---EGGYN 379
               P ++II  G D   GD   +  +T    G   ++LK + R   C ++    GGYN
Sbjct: 304 DRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA    A GFC  +++ +  + + K   + + ++  +D+D+HHG+G +K+F     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 323
           IS+H +E G ++P T  G  + T  GK       +  P+  GV D        +++ P+ 
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKN-----IVNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNLCVVLEGGYN 379
               P++++I  G D   GD   +  +T S    ++ ++++   + ++ ++  GGYN
Sbjct: 332 ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 89/187 (47%), Gaps = 14/187 (7%)

Query: 196 SLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQK 254
           S+A+    G HHA    A GFC  +++ +  +++ +   +  +R+  +D+D+H+G+G  K
Sbjct: 183 SIAINWDGGRHHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAK 239

Query: 255 SFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPV-GGVGDAEYMW 313
           +F   + V  IS+H +E G ++PGT  G  ++T   K       +  PV  G+ D   + 
Sbjct: 240 AFRFSENVQTISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLE 291

Query: 314 AFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVV 373
               V+ P+   F  + ++I  G D   GD   +  ++     H    +  + R     +
Sbjct: 292 LISSVITPLIETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFL 351

Query: 374 L-EGGYN 379
           L  GGYN
Sbjct: 352 LGGGGYN 358

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 96/206 (46%), Gaps = 19/206 (9%)

Query: 179 GGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVR 237
            GA  A    +     ++LAV    G HHA    A GFC  +++A+  + + +   +   
Sbjct: 166 AGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFL 222

Query: 238 RIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNC 297
           R+  +D+D+HHG+G + +F     V   SLH FE G ++PG        TG  K    N 
Sbjct: 223 RVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTDNS 273

Query: 298 NITWP-VGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYG 356
            +  P + GV D+      + +V P  +   P+++II  G D   GD  G+  +  S +G
Sbjct: 274 VLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHG 331

Query: 357 HMTHMLKSLAR---GNLCVVLEGGYN 379
              ++LK +       + ++  GGYN
Sbjct: 332 LTRNILKLVQAHKFKKIALLGGGGYN 357

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 140/329 (42%), Gaps = 73/329 (22%)

Query: 128 SEEILEVH----TKEHLEFI-ESTEKMSREQL--LKETEKGDSVYFNNDSYASARLPCGG 180
           S  +L+VH     KE L+   +S+EK++ +Q+    +   GD +Y +  + A+     G 
Sbjct: 106 SPHVLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGA 164

Query: 181 AIEACKAVVEGRVKNSLA-----VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
                 ++ +G  +  +A      VRPPGHH+      GFCL +N  +A +     +  +
Sbjct: 165 LETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--N 222

Query: 236 VRRIMILDWDIHHGNGTQ------------------------KSFYQDDQVLYISLHRF- 270
           V   ++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 223 VTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDIN 282

Query: 271 ----EIG-------KYYPGTIQGQYD-----------QTGEGKGEGFNCNITWPVGGVGD 308
               E+G       K     I   +D           +T E   + +             
Sbjct: 283 SFPTELGYATKENIKNASTCIMNAHDLNIWNVHLSHYETEEDFVKLYQSKYRSLFAKAD- 341

Query: 309 AEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIG-QCH--VTPSCYGHM-THMLKS 364
            E+    ++ +   G++FK  LV+IS+GFDA++ +    Q H    P+C+ +M T     
Sbjct: 342 -EFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALK 399

Query: 365 LAR----GNLCVVLEGGYNLDAIAISALS 389
           LA+    G +  V+EGGY+  AI+    S
Sbjct: 400 LAQMHTSGKVLSVMEGGYSDGAISSGVFS 428

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 92/182 (50%), Gaps = 24/182 (13%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA    A GFC  +++ +  + + K   +   ++  LD+D+HHG+G +++F    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 265 ISLHRFEIGKYYP--GTIQGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMP 321
           ISLH +E G ++P  G+++G           GF+  +  P+  G+ D+      +QVV P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 322 MGREFKPDLVIISSGFDAADGDTIGQCHVT----PSCYGHMTHMLKSLARGNLCVVLEGG 377
           + +   P++++I  G D   GDT  +  ++      C   +  ++    + ++ ++  GG
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGG 368

Query: 378 YN 379
           YN
Sbjct: 369 YN 370

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 99/247 (40%), Gaps = 58/247 (23%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH+      GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 254 -----------------------KSFYQDDQVLYISLHRF-----EIGKYYPGTIQG--- 282
                                  K F +  +V Y SLH       E G  +  +I+    
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 283 -----------QYDQTGEGKGEGFN--CNITWPVGGVGDAEYMWAFEQVVMPMGREFKPD 329
                          T     E FN      +        E++   ++ +   G+ +K  
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYK-G 360

Query: 330 LVIISSGFDAADGDTIGQ----CHVTPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLD 381
           L+IIS+GFDA++ + +       HV  S Y   T     LA    +G L  +LEGGY+ D
Sbjct: 361 LIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYS-D 419

Query: 382 AIAISAL 388
           A  +S +
Sbjct: 420 AALVSGV 426

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 133/324 (41%), Gaps = 74/324 (22%)

Query: 128 SEEILEVHTKEHLEFIESTEKMSREQLLK-ETEKGDS-----VYFNNDSYASARLPCGGA 181
           S  +L+VH ++    +    K + E+L K E E  DS     +Y ++ +  + +   G  
Sbjct: 105 SPHVLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGAL 164

Query: 182 IEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236
                ++ EG     V N +  V+RPPGHH       GFCL +N  V+ +     Y   +
Sbjct: 165 ETGVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GI 222

Query: 237 RRIMILDWDIHHGNGTQ-------------------------KSFYQDDQVLYISLHRFE 271
              ++LD+D+HHG+GTQ                         K F +  +V Y S+H  +
Sbjct: 223 THAVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMH--D 280

Query: 272 IGKYYPGTIQGQYDQTGEGKG---EGFNCNITWPV-----------GGVGDAEYMWAFEQ 317
           I  +   +     D           G + NI W V             +  ++Y   F +
Sbjct: 281 INSFPTESGYATKDNIKSASTCIMNGHDLNI-WNVHLSAWETEEDFNKLYQSKYRTLFAK 339

Query: 318 V----------VMPMGREFKPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLK 363
                      +   G++FK  LV+IS+GFDA++ + +  Q H   V  + Y   T    
Sbjct: 340 ADEFFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDAL 398

Query: 364 SLAR----GNLCVVLEGGYNLDAI 383
            LA+    G +  VLEGGY+  AI
Sbjct: 399 KLAQMHSEGKVLSVLEGGYSDKAI 422

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 100/262 (38%), Gaps = 63/262 (24%)

Query: 189 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHH 248
           VE     +   +RPPGHH+      GFCL +N  +A +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 249 GNGTQ---------------------------------KSFYQDDQVLYISLHRF----- 270
           G+GTQ                                 KSF +  +V Y SLH       
Sbjct: 234 GDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPT 293

Query: 271 EIGKYYPGTIQGQ---------------YDQTGEGKGEGFNCNITWPVGGVGDAEYMWAF 315
           E+G      I+                 + Q+ + + E      T        A+  +  
Sbjct: 294 ELGYATKENIRNASTCIMDAHDINIWNVHLQSYKDEEEFVKLYQTKYRSIFAKADEFFKN 353

Query: 316 EQVVMPMGREFKPDLVIISSGFDAADGDTIG----QCHVTPSCYGHMTHMLKSLAR---- 367
            ++ M  G      LV+IS+GFDA++ +         +V  S Y   T     LA+    
Sbjct: 354 AKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSN 413

Query: 368 GNLCVVLEGGYNLDAIAISALS 389
           G +  V+EGGY+  AIA    S
Sbjct: 414 GKIISVMEGGYSDGAIASGVFS 435

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 83/183 (45%), Gaps = 26/183 (14%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA    A GFC  +++ +  + + KN      R+  +D+D+HHG+  + +F     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 265 ISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVG-----GVGDAEYMWAFEQVV 319
            SLH FE G ++PGT            G   NC  T  V      G+ D       + ++
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 320 MPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSL---ARGNLCVVLEG 376
           +P   +  P++++I  G D   GD   +  +T   +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 377 GYN 379
           GYN
Sbjct: 357 GYN 359

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 96/253 (37%), Gaps = 63/253 (24%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH       GFCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 254 ----KSFYQDD-----------------------QVLYISLHRFEIGKYYPGTIQGQYDQ 286
                 F  DD                       +V Y S+H  +I  +   +     D 
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMH--DINSFPTESGYATKDN 301

Query: 287 TGEGKG---EGFNCNI------TWPVGGVGDAEYMWAFEQVVMPMGREFK---------- 327
                    +  + NI      TW      +  Y   +  +       FK          
Sbjct: 302 IKNASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMN 361

Query: 328 ---PDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR----GNLCVVLEG 376
                LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+    G +  VLEG
Sbjct: 362 KPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEG 421

Query: 377 GYNLDAIAISALS 389
           GY+  AIA    S
Sbjct: 422 GYSDKAIASGVFS 434

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 98/241 (40%), Gaps = 55/241 (22%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH +     GFCL +N  ++ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 254 -----------------------KSFYQDDQVLYISLH---RFEIGKYYPGTIQGQYDQT 287
                                  K F +  +V Y S+H    F     Y   +  +   T
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 288 GEGKGEGFNC-NITW-PVGGVGDAEYMWA-------------FEQVVMPMGREFKP--DL 330
               G   N  NI   P     D + ++              F      M +E KP   L
Sbjct: 305 CIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGL 364

Query: 331 VIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLDA 382
           V+IS+GFDA++ + T  Q H   V  + Y   T     LA    +G +  +LEGGY+  A
Sbjct: 365 VVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDKA 424

Query: 383 I 383
           +
Sbjct: 425 L 425

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 120/293 (40%), Gaps = 41/293 (13%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESV---RRIMILDWDIHHGNGTQKSFYQDDQ 261
           HHA    A GFC  +++ V+  N L+  P      R++  +D D+HHG+G + +F     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 262 VLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVM 320
           +  IS+H FE G +YP T   ++     GK +  N  I  PV  G+ ++        +++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 321 PMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLAR----------GNL 370
           P+    + D ++I  G D  + D   +  +T    G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 371 CVVLEGGYN-LDAIAISALSVAKV--LIGXXXXXXXXXXXXXXXXVI------------E 415
            ++  GGYN L A         KV  L G                 I            E
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHE 435

Query: 416 MIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHY 468
            ID+  +   KYW C+   +   G +F   IN +  +K  P  K I + + HY
Sbjct: 436 HIDEYEKEYYKYW-CYEIENGLDGLSFKRQINYN-DTKQKPFTKYIAELRAHY 486

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 131/318 (41%), Gaps = 69/318 (21%)

Query: 131 ILEVHTKE-HLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCG-----GAIE- 183
           +L+VH      E IE  + M+  +LLK   +    + + D Y S++         GAIE 
Sbjct: 110 VLKVHGSHWPAELIELCQ-MADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 184 ACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
              ++ EG     + N +   +RPPGHH       GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 239 IMILDWDIHHGNGTQ------------------------KSFYQDDQVLYISLHRF---- 270
           +++LD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDINSFP 286

Query: 271 -EIG-------KYYPGTIQGQYD-------QTGEGKGEGFNC--NITWPVGGVGDAEYMW 313
            E G       K     I   +D        +     E FN      +        E+  
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFR 346

Query: 314 AFEQVVMPMGREFKPDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR-- 367
           + +Q +    + FK  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+  
Sbjct: 347 SAKQEMNQNEKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 368 --GNLCVVLEGGYNLDAI 383
             G +  ++EGGY+  AI
Sbjct: 406 CHGKVLSLMEGGYSDKAI 423

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 94/254 (37%), Gaps = 69/254 (27%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH       GFCL +N  +A +     Y   +   +ILD+D+HHG+GTQ  
Sbjct: 185 AFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDI 242

Query: 254 -----------------------KSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEG 290
                                  K F +  +V Y S+H  +I  +     + QY  T E 
Sbjct: 243 CWKRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMH--DINSF---PTESQY-ATKEN 296

Query: 291 KGEGFNC-------NI------TWPVGGVGDAEYMWAFEQVVM--------------PMG 323
                 C       NI       W      D  Y   +  +                 +G
Sbjct: 297 IRNASTCVMNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALG 356

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLA--------RGNLCVVLE 375
           + F+  LV+IS+GFDA++ +       + +   H   M    A         G +  ++E
Sbjct: 357 KPFQ-GLVVISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIME 415

Query: 376 GGYNLDAIAISALS 389
           GGY+  AIA    S
Sbjct: 416 GGYSDKAIASGVFS 429

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 68/137 (49%), Gaps = 13/137 (9%)

Query: 128 SEEILEVHTKEHLEFI-----ESTEKMSREQL-LKETEKGDSVYFNNDSYASARLPCGGA 181
           S  + +VH KE  + +     E+ EK+++ ++ + E+     +Y ++ +  + +   G  
Sbjct: 105 SPHVYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGAL 164

Query: 182 IEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236
                ++ +G     + N +   +RPPGHH       GFCL +N  VA +     Y   V
Sbjct: 165 ETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GV 222

Query: 237 RRIMILDWDIHHGNGTQ 253
             + +LD+D+HHG+GTQ
Sbjct: 223 THVAVLDFDLHHGDGTQ 239

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 55/114 (48%), Gaps = 10/114 (8%)

Query: 147 EKMSREQL--LKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLA-----V 199
           EK++R ++   KE   GD +Y ++ +  + R   G        +  G     ++     V
Sbjct: 128 EKLARGEIEVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVV 186

Query: 200 VRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           VRPPGHH       GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ
Sbjct: 187 VRPPGHHCHVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 144 ESTEKMSREQL-LKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGR-----VKNSL 197
           E+  K+   +L + E+     +Y N+D+  + +   G       ++  G         + 
Sbjct: 127 EADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAF 186

Query: 198 AVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
             +RPPGHH       GFCL +N  +  +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 187 VAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 35.4 bits (80), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 9/82 (10%)

Query: 310 EYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIG----QCHVTPSCYGHMTHMLKSL 365
           E+  A +  +  MG+ +K  LV+ISSGFDA++ + +       +V  + Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 366 AR----GNLCVVLEGGYNLDAI 383
           A+    G +  ++EGGY+  AI
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAI 426

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 13/117 (11%)

Query: 148 KMSREQLLKETEKGDSVYFNNDSYASARL--PCGGAIEACKAVVEGRVK---------NS 196
           +M+  +LLK   +    + + D Y S++      G I A +  V+   K          +
Sbjct: 127 QMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIETGVDSIFKGPSPEHISNRA 186

Query: 197 LAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
              +RPPGHH       GFCL +N  VA +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 187 FVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHVVVLDFDLHHGDGTQ 241

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 189 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHH 248
           VE     +   +RPPGHH+      GFCL +N  +A +     Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 249 GNGTQ 253
           G+GTQ
Sbjct: 236 GDGTQ 240

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 310 EYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSL 365
           EY    +Q +  +G+ FK  LV+IS+GFDA++ +    Q H   V    Y   T     L
Sbjct: 343 EYFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKL 401

Query: 366 AR----GNLCVVLEGGYNLDAIA 384
           A+    G L  VLEGGY+  AI+
Sbjct: 402 AQMHSHGKLLSVLEGGYSDGAIS 424

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 66/135 (48%), Gaps = 15/135 (11%)

Query: 131 ILEVH-TKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARL--PCGGAIEACKA 187
           +L+VH +    E IE  + M+  +LLK   +    + + D Y S++      G I A + 
Sbjct: 110 VLKVHGSSWPAELIELCQ-MADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 188 VVEGRVK---------NSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
            V+   K          +   +RPPGHH       GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 239 IMILDWDIHHGNGTQ 253
           +++LD+D+HHG+GTQ
Sbjct: 227 VVVLDFDLHHGDGTQ 241

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 38/69 (55%), Gaps = 9/69 (13%)

Query: 323 GREFKPDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR----GNLCVVL 374
           GR FK  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+    G +  ++
Sbjct: 356 GRPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCHGKVLSLM 414

Query: 375 EGGYNLDAI 383
           EGGY+  AI
Sbjct: 415 EGGYSDKAI 423

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           +   +RPPGHH+      GFCL +N  +A +     Y  +V   ++LD+D+HHG+GTQ
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQ 242

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 310 EYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSL 365
           E+    +Q +  +G+ FK  LV+IS+GFDA++ +    Q H   V    Y   T     L
Sbjct: 344 EFFRISKQTMKALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKL 402

Query: 366 AR----GNLCVVLEGGYNLDAI 383
           A+    G +  V+EGGY+  AI
Sbjct: 403 AQMHSHGKVLSVMEGGYSDGAI 424

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 161 GDSVYFNNDSYASARLPCGGAIEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGF 215
           GD +Y ++ +  + +   G    A  ++ +G     + N +   +RPPGHH       GF
Sbjct: 145 GD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGF 203

Query: 216 CLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           C+ +N  VA +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 204 CVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           +   +RPPGHH       GFCL +N  VA +     Y  +V  +++LD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQ 241

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 197 LAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
              +RPPGHH       GFCL +N  +  +     Y   V   +ILD+D+HHG+GTQ
Sbjct: 183 FVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQ 237

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 9/76 (11%)

Query: 322 MGREFKPDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLA----RGNLCVV 373
           +G+ FK  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA    +G +  +
Sbjct: 351 LGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSL 409

Query: 374 LEGGYNLDAIAISALS 389
           LEGGY+  AI     S
Sbjct: 410 LEGGYSDKAITSGVFS 425

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 15/138 (10%)

Query: 128 SEEILEVHTKE-HLEFIESTEKMSREQLLKETE------KGDSVYFNNDSYASARLPCGG 180
           S  +L+VH K+   + +   ++   +   KE E       GD +Y ++ +  + +   G 
Sbjct: 103 SPHVLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGD-IYLSSKTVEALQGSIGA 161

Query: 181 AIEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
              A  ++ +G     + N +   +RPPGHH       GFCL +N  VA +     +   
Sbjct: 162 LETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--G 219

Query: 236 VRRIMILDWDIHHGNGTQ 253
           V    ILD+D+HHG+GTQ
Sbjct: 220 VTHAAILDFDLHHGDGTQ 237

>CAGL0D04136g Chr4 (409387..409397,409461..410097) [648 bp, 215 aa]
           {ON} similar to uniprot|P34162 Saccharomyces cerevisiae
           YHR041c SRB2 DNA-directed RNA polymerase II
          Length = 215

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 484 ELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISG 521
           E+PDN+  C+  +SES   L +    S++WA+R VI G
Sbjct: 82  EIPDNLQTCSTGLSESIDQL-LASKLSNMWAQRQVIRG 118

>ZYRO0B01122g Chr2 (93637..94983) [1347 bp, 448 aa] {ON} similar to
           uniprot|Q75DK5 Ashbya gossypii ABR016C ABR016Cp and
           weakly similar to YKL090W uniprot|P36075 Saccharomyces
           cerevisiae YKL090W CUE2 Protein of unknown function has
           two CUE domains that bind ubiquitin which may facilitate
           intramolecular monoubiquitination
          Length = 448

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 21/103 (20%)

Query: 625 KQLKPLVPLVDETLTE--WY-----FKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDT 677
           +QLK + PLV +   E  W+     F N++V   N H   +EN+SR P        +   
Sbjct: 87  EQLKSMFPLVHQPTIEKVWHDQNGDFDNTVVELLNHHMLLEENDSRDPEPSPQPESKSTV 146

Query: 678 D------GLSNTVEERFEEATDF--------ILDSFEEWSDEE 706
           D      G+++++   F   + F        ILDS+ E   E+
Sbjct: 147 DIVQEYTGVTSSIARHFSYRSSFNVVKAIVSILDSYREPPQEK 189

>Kwal_55.20650 s55 (505162..505776) [615 bp, 204 aa] {ON} YLL033W -
           Hypothetical ORF [contig 142] FULL
          Length = 204

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 123 VRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVY-FNNDSYASARLPCGGA 181
           +R   S+++L +  +    F+  T  +SR  ++++T      Y F N++Y   RL  G A
Sbjct: 35  IREYPSDDVLRMCYRR---FMRLTPLISRRSMIRQTYVHYVRYKFKNENYEEKRLASGLA 91

Query: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKN 231
           +   K  +  +V NSL        + +  + G   +   + + +KNILKN
Sbjct: 92  VLEAKPCILQQVVNSLNFCLEAVVYVKKGSPGEQAVAEEIRL-SKNILKN 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,408,464
Number of extensions: 3493385
Number of successful extensions: 10056
Number of sequences better than 10.0: 114
Number of HSP's gapped: 10047
Number of HSP's successfully gapped: 127
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)