Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_14.3252.286ON49049023890.0
Skud_14.3072.286ON49049022250.0
YNL022C2.286ON49048921420.0
Smik_14.3092.286ON49049021180.0
NDAI0G006602.286ON49649717760.0
Kpol_1003.382.286ON49649617500.0
KAFR0H033102.286ON48849217410.0
NCAS0G037902.286ON49249617370.0
TPHA0C034002.286ON49449317130.0
KNAG0H020002.286ON49849617030.0
TDEL0G021702.286ON48449216550.0
CAGL0M06941g2.286ON49249216500.0
SAKL0E07678g2.286ON47748916380.0
TBLA0B069602.286ON50850716130.0
KLLA0E08361g2.286ON49149615710.0
Ecym_33252.286ON49649115490.0
Kwal_27.115322.286ON47949015420.0
ZYRO0A01892g2.286ON46549115330.0
KLTH0G10362g2.286ON52948915330.0
ADL215W2.286ON48449314710.0
ADL254W2.247ON6031971572e-10
ZYRO0A01562g2.247ON6172031553e-10
KAFR0J009702.247ON6102341553e-10
CAGL0J10032g2.247ON6192051528e-10
SAKL0E08624g2.247ON6112031519e-10
KNAG0I018702.247ON6292361501e-09
AFR179C8.171ON7002931492e-09
KLLA0F03399g2.247ON6192031492e-09
Kpol_1003.152.247ON6332691482e-09
TBLA0E038502.247ON6322081473e-09
TPHA0C031502.247ON6082081473e-09
KLTH0G09460g2.247ON6372031464e-09
Ecym_32842.247ON6062031455e-09
NDAI0D010502.247ON6252031439e-09
NCAS0G030302.247ON4902031421e-08
Kwal_23.48412.247ON6272101421e-08
KNAG0G015108.171ON6662921421e-08
YNL061W (NOP2)2.247ON6182101412e-08
Skud_14.2712.247ON6192031412e-08
Smik_14.2662.247ON6182101402e-08
TDEL0C041502.247ON6142031402e-08
Suva_14.2802.247ON6202031392e-08
Ecym_23538.171ON6902931341e-07
TPHA0C028708.171ON6742921332e-07
KLTH0H08096g8.171ON6882891322e-07
ZYRO0G08998g8.171ON6832921277e-07
SAKL0H19448g8.171ON6912931261e-06
TPHA0H001508.171ON6493011251e-06
Kpol_1002.1098.171ON6702961224e-06
NDAI0B018308.171ON6862961198e-06
KNAG0D020508.171ON6822961189e-06
KAFR0B022208.171ON6862921171e-05
TDEL0B043908.171ON6732971161e-05
Suva_2.978.171ON6702961161e-05
Smik_2.928.171ON6742961134e-05
CAGL0K01991g8.171ON6722921125e-05
NCAS0B043908.171ON6712971125e-05
TBLA0A087408.171ON6862911116e-05
Skud_2.818.171ON6812961101e-04
YBL024W (NCL1)8.171ON6842961091e-04
NCAS0B056408.171ON6592981081e-04
NDAI0B029808.171ON679298980.003
KLLA0F12562g8.171ON704221960.004
AFL190C2.350ON23584770.52
Kwal_14.20818.171ON272121770.63
Ecym_30036.1ON31973732.0
ZYRO0F13486g1.251ON161058732.6
KNAG0L024406.1ON31777704.4
TDEL0D012701.251ON155159705.8
NCAS0B078001.251ON168926706.6
TBLA0H029901.251ON174826697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_14.325
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   924   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   861   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   829   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   820   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   688   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   678   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   675   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   673   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   664   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   660   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   642   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   640   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   635   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   625   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   609   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   601   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   598   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   595   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   595   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   571   0.0  
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    65   2e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    64   3e-10
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    64   3e-10
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    63   8e-10
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    63   9e-10
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    62   1e-09
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    62   2e-09
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    62   2e-09
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    62   2e-09
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    61   3e-09
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    61   3e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    61   4e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    60   5e-09
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    60   9e-09
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    59   1e-08
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    59   1e-08
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    59   1e-08
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    59   2e-08
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    59   2e-08
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    59   2e-08
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    59   2e-08
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    58   2e-08
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    56   1e-07
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    56   2e-07
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    55   2e-07
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    54   7e-07
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    53   1e-06
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    53   1e-06
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    52   4e-06
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    50   8e-06
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    50   9e-06
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    50   1e-05
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    49   1e-05
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    49   1e-05
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    48   4e-05
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    48   5e-05
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    48   5e-05
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    47   6e-05
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    47   1e-04
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    47   1e-04
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    46   1e-04
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    42   0.003
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    42   0.004
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    34   0.52 
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    34   0.63 
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    33   2.0  
ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa...    33   2.6  
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    32   4.4  
TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {...    32   5.8  
NCAS0B07800 Chr2 complement(1477435..1482504) [5070 bp, 1689 aa]...    32   6.6  
TBLA0H02990 Chr8 complement(732711..737957) [5247 bp, 1748 aa] {...    31   7.4  

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/490 (92%), Positives = 455/490 (92%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMKKARILEEIPKKKGKPLFAR            SKQKRIQMGKHPIKEYVLKFKSP
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSEMV       VRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
           GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
           NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKI           
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAVP 360

Query: 361 XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420
                FMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480
           DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI
Sbjct: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFVRK 490
           GFFAVCFVRK
Sbjct: 481 GFFAVCFVRK 490

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/490 (85%), Positives = 441/490 (90%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAK RISGSMQTLVL+SCK+YKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMKKARILE+IPKKKGKPLF+R            SKQKRIQMGKHPIK+YVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSEMV       VRDLSE+VLSEDI NDLPPVRWIRINPLKCHP+G+TEPVLAEL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           T KV+ WS+LVPGSIY+DEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
           G++DIVIDACSAPGNKTTHTASYI S PPKD  I+IYAFEKDPERAKILQKM+KVAGCS+
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
           NIDV VGDFTKLATP+KCKG TGFIVDPSCSGSGIFGRKFFDSLN+RK+           
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360

Query: 361 XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420
                FMAKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480
           DKAVQEWGWKVA RTEV+PSWPRRGKVEEF EVFRDG+AH+P+QLAEGCIRALPKEDGGI
Sbjct: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFVRK 490
           GFFAVCF RK
Sbjct: 481 GFFAVCFERK 490

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/489 (83%), Positives = 430/489 (87%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAK RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMKKA ILE+IPKKKGKPLF+R            SKQKRIQMGKHPIK+YVLKFKSP
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSEMV       VR+LSELVLSEDI NDLPPVRWIRINPLKCHP+G TEPVLAEL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           T KVD WSELVPGSIY+DE+IPNLFGIHP+DKITAHELYKHGKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
           G +DIVID+CSAPGNKTTHTASYI+ EPPKD   +IYAFEKDPERAK+LQKMIK+AGCS 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
           NI VNVGDFTKLATPEK K VT FIVDPSCSGSGIFGRKFFDS NRRKI           
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVP 360

Query: 361 XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420
                F+AKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480
           DK+V+EWGWKVA + EV+PSWPRRGKVEEFEEVFRDG  +DPQQLAEGCIRALPK DGGI
Sbjct: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480

Query: 481 GFFAVCFVR 489
           GFFAVCF R
Sbjct: 481 GFFAVCFER 489

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/490 (83%), Positives = 438/490 (89%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAK RISGSMQTLVLKSCKRYKLKSNPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMKKARILE+IPKKKGKPLF+R            SKQKRIQMGKHPIK+YVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSEMV       VR+LSELVLSEDI NDLPPVRWIRINPLKC+P+G TEPVLAEL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           T KV+ WSELVP SIY+DEYIPNLFGIHP+DKITAHELYK+GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
           G NDIVIDACSAPGNKTTHTASYI SEPPKD + +IYAFEKDPERAKILQKMIK+AGCS+
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
           NIDV+VGDFTKLATPEK K  TGFIVDPSCSGSGIFGRKFFDSLNR+K+           
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIVP 360

Query: 361 XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420
                FMAKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480
           DKAVQEWGW+VA R+EV+P WPRRGKVEEFEEVFR+G+AHDPQ+LAEGCIRALPK+DGGI
Sbjct: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480

Query: 481 GFFAVCFVRK 490
           GFFAVCF RK
Sbjct: 481 GFFAVCFERK 490

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/497 (67%), Positives = 398/497 (80%), Gaps = 9/497 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC +YKLK NPKH+YAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMKK+ IL++IPKKKGKP+++R            SK KRIQMGKHPIKEYVLK KS 
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSE+V       V++LSE+V + D   D+ PVRWIRINPL+C+   +   VL EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
            ++V+NW+++VPGSIY+DEYIP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPK-DKKIQIYAFEKDPERAKILQKMIKVAGCS 299
             +DI+IDAC+APGNKTTH ASY+F +  + D  +QIYAFEKDPERAKIL+KMIKVAGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 300 ANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXX 359
            NI V VGDFTK ATP+K K VTGFIVDPSCSGSGIFGRK+ DSLNR++           
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 360 XX-------XXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENE 412
                        +  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 413 RVVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRA 472
           RVV+DLLLD  V++WGWKVA++  V+P+WPRRGK+EEFEEVFRD  A   Q LA+GCIRA
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAK-CQALADGCIRA 479

Query: 473 LPKEDGGIGFFAVCFVR 489
           LP++DGGIGFFAVCF R
Sbjct: 480 LPRDDGGIGFFAVCFER 496

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/496 (66%), Positives = 388/496 (78%), Gaps = 8/496 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRD+TWVLE +EKE AK +ISGS+Q LVLKSCK+YK+KSNP+H+YA + SCWK KPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMK++ IL++IP KKGKP F R            SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSE+V       VRDLSEL+  E+  +D+ PVRWIRINP++   D   EP++ EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V++WS++VPG+IYHD+YIPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHIL+P
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
           G NDIVIDAC+APGNKTTHTASYI   P KD+  QIYAFEKDPERAKILQ MIKVAGCS 
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
            I VNVGDFTK+ATPEK + VTGFIVDPSCSGSGIFGRK+ DS+N++K            
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 361 XXXXXFMAKEE-------LQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENER 413
                   +EE       L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 414 VVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRAL 473
           VVIDLLLDK VQEWGWKVA R+EV+P+WPRRG   EF +VFRD      Q+LA+GCIR L
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRD-EDEKCQELADGCIRVL 479

Query: 474 PKEDGGIGFFAVCFVR 489
           PKEDGGIGFFAVCF R
Sbjct: 480 PKEDGGIGFFAVCFER 495

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/492 (67%), Positives = 391/492 (79%), Gaps = 9/492 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVLKSC++YKLK+NPKHIYAVLDSCWKYKP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVM K+ IL++IPKKKGKP++ R            SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSE+V       VRDLSELV + D  ND+ PVRW RINPL+C PD +   V+ EL+KKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC-PDASA--VMKELEKKF 177

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
            Q+V++W  +VPGSIYHDE+IP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHIL+P
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
              D +IDACSAPGNKTTH ASY+F     D  ++I+AFEKDPERAK+LQKMIKVAGCS 
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVD-DVRIFAFEKDPERAKVLQKMIKVAGCSK 296

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
            I VNVGDFTKLATP K   VTGFIVDPSCSGSGIFGRK+ DSLNR+K            
Sbjct: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPD 356

Query: 361 XXXXXFMAKEE---LQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVID 417
                 MA++E   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +D
Sbjct: 357 EQEE--MAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALD 414

Query: 418 LLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKED 477
           LLLD+ V++WGWK+A R  V+P WPRRG V EF+E+FRD +A + Q++A+GCIRALP+ED
Sbjct: 415 LLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPRED 474

Query: 478 GGIGFFAVCFVR 489
           GGIGFFA+CF R
Sbjct: 475 GGIGFFAICFER 486

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/496 (68%), Positives = 390/496 (78%), Gaps = 11/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCKRYKLK NPKH+YAVLDSCWKYKPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMKK+ IL+EIPK+KGKP+++R            SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LHSE+V       V++LSELV + D  ND+ PVRWIRINPL+C    + E    E++KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V+NWS++VPGSIY+DEYIPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHILHP
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
             ND+VID C+APGNKTTHTASY+  EP KD KIQIYAFEK+PERAKIL KMIKVAGCS 
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXX------ 354
           NI +NVGDFTK+A PEK K VTGFIVDPSCSGSGIFGRKF DSLNR+K+           
Sbjct: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGD 356

Query: 355 XXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERV 414
                      +  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 357 EEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416

Query: 415 VIDLLLDKAVQEWGWKVASRTEVVPSWPRRGK-VEEFEEVFRDGSAHDPQQLAEGCIRAL 473
           VIDL+LD  V++WGWKVA R++V+P+WPRRGK  E  E    DG++   ++LA GCIRAL
Sbjct: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476

Query: 474 PKEDGGIGFFAVCFVR 489
           P+ DGGIGFFAVCF R
Sbjct: 477 PRSDGGIGFFAVCFER 492

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/493 (64%), Positives = 389/493 (78%), Gaps = 5/493 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VLKSCK YK++SNPKHIYAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LE +MKK+ IL  IPKK GKP F R            SK KRIQMGKHP+KEYVLK+K+ 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           L SEMV       ++   +L+ S+D  ND+ PVRW RINP++       E +L EL+KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +VD+WS++  G+IYHDE+IPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+L+P
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
           G +DIVID+C+APGNKTTHTA+YI   P KD+KIQI+AFEKDPERAK+LQKM++ AGC+ 
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRK----IXXXXXXX 356
            I+VNVGDFTK+ATPEK K VTGFIVDPSCSGSGIFGRKF D+LN++K    +       
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 357 XXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVI 416
                    F  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420

Query: 417 DLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKE 476
           DLLLD+ +++ GW+VA+R +V+P+WPRRG V+EF+EVFRD      +++A GCIRALPKE
Sbjct: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCIRALPKE 479

Query: 477 DGGIGFFAVCFVR 489
           DGGIGFFAVCF R
Sbjct: 480 DGGIGFFAVCFER 492

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/496 (62%), Positives = 391/496 (78%), Gaps = 7/496 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCKR+K+K+NPKHIYAV+ SCW+YKP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEKVMKK++IL+E+P+KKG P+F R            SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           L++E+        V+DLS+L  S+D+ ND+ PVRW R+NPL+C  +   + V+ EL+KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           T+KVD+W ++VPGSIY+DEYIPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDK--KIQIYAFEKDPERAKILQKMIKVAGC 298
            S+DIVIDAC+APGNKTTH A+++F +   D+  K+QIYAFEKDPERA++L KMIK+AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 299 SANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXX 358
           S  I+V VGDFTKLATP+ C  V G IVDPSCSGSGIFGRK+ DS+N +K          
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 359 XXXXX----XXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERV 414
                          + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 415 VIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFR-DGSAHDPQQLAEGCIRAL 473
           VIDLLLDK V+E GW+VA R++V+P+W RRG V+EF++VFR D  + + Q++A+GCIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 474 PKEDGGIGFFAVCFVR 489
           P+EDGGIGFFAVCF R
Sbjct: 481 PREDGGIGFFAVCFER 496

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/492 (64%), Positives = 383/492 (77%), Gaps = 11/492 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E+E  K R+SGSMQTLVLKSC+RYKLKS+PKH+YAV+DSCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEK+MK+++I ++IPKKKGKP+++R            SKQKRIQMGK PIKEYVLK K+ 
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           L+SE+V       V+ LSE+V  ED  ND+ PVRWIRINPL+C P  + EPVL EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRC-PKNDVEPVLKELIKKF 179

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
            Q+V +WS++  G++Y+DE++PNLFG+HP DKIT+HELY+ GKIIIQDR+SCFPAHIL+P
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
           G ND+VIDAC+APGNKTTH A++I  E  +++  +IYAFEKDP RA IL+KM  VAGC  
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
            ++++VGDFTKLA P   K VTG IVDPSCSGSGIFGRK  DS N   +           
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHN---VAKKKTETDSEI 356

Query: 361 XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420
                 M  +++  RL+KL+SFQFQ+VKHAMS P AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 357 PDEEEKMVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLL 416

Query: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDP---QQLAEGCIRALPKED 477
           D+ ++EWGWKVASR EV+P WPRRGKV+EFE+VFRD    DP    +LA+GCIRALP+ED
Sbjct: 417 DRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRD----DPVKCNELADGCIRALPQED 472

Query: 478 GGIGFFAVCFVR 489
           GGIGFFAVCF R
Sbjct: 473 GGIGFFAVCFKR 484

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/492 (62%), Positives = 383/492 (77%), Gaps = 4/492 (0%)

Query: 1   MNFYRDATWVLEDIEKEAAKV-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRD+TWVLE +E +  K  R+SGS+QT+VL+ CK+Y++K+NPKHIYA++ SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKS 119
           YL+K+MKK+ +L+ IP+KKGKP F++            SK KRIQMGKHPIK YVLK+K+
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 PLHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKK 179
            L++E V       + DLS++V  +D  +D+ PVRWIRINPL+   + +T+ VL ELKKK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179

Query: 180 FTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F  +V+ W +++PGSIY+DE+IPNL+GIH +DKIT+HELYK GKIIIQDRASCFPAHIL+
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PGSNDIVIDACSAPGNKTTHTASYIFSEP--PKDKKIQIYAFEKDPERAKILQKMIKVAG 297
           P ++D+VIDACSAPGNKTTH A++IF +P  P++  +QIYAFEKDPERA+ILQKMIK AG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 298 CSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXX 357
           C  NIDVNVGDFT++ATP K   VTGFI+DPSCSGSGIFGRK  D LN            
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359

Query: 358 XXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVID 417
                       E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENERVVID
Sbjct: 360 ENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVID 419

Query: 418 LLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKED 477
           LLLDK VQ WGW+VA +  V+P+W RRG  EEF+EVF D +  + Q+LA+GC+RALPKED
Sbjct: 420 LLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKED 479

Query: 478 GGIGFFAVCFVR 489
           GGIGFFAVCFVR
Sbjct: 480 GGIGFFAVCFVR 491

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/489 (62%), Positives = 374/489 (76%), Gaps = 13/489 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCKRYKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEK++KK+ IL++IPKKKG+P F+             SK KRIQMGKHPIKE+VLK K  
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           L +E+        V +LS+LV  +D  ND+ PVRWIRINP++C  +G  + V  EL+KKF
Sbjct: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             KV NWSE+VPG+IYHDE+IPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
              D++ID+CSAPGNKTTH A+++F      K+ QI+AFEKDPERAK LQKMI+VAGC  
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
           +I+V+VGDFTKLA P+K   VTGFIVDPSCSGSGIFGRK  D  N +             
Sbjct: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKN-------EVLPE 349

Query: 361 XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420
                    ++L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLLL
Sbjct: 350 EEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 409

Query: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480
           D  VQ+WGW+V  R  V+P+W RRG VEEF++V++D      Q+LA+GCIRALPKEDGGI
Sbjct: 410 DDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQELADGCIRALPKEDGGI 467

Query: 481 GFFAVCFVR 489
           GFFAVCF R
Sbjct: 468 GFFAVCFER 476

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/507 (60%), Positives = 385/507 (75%), Gaps = 19/507 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E +  K R+SGS+ +LV+KSCK++K++SNPKH+YAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           +E++M K+ IL++IPKKKGKP++ R            SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVL----SEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAEL 176
           LHSE+V       V +L++++     S D  +D+ PVRWIRINP++     +++ ++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 KKKFTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           +KKFT KVD+WS++ PG IY+DEYIPNLFGI PTDKIT+HELYK+GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 ILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPK-----DKKIQIYAFEKDPERAKILQK 291
           IL+   +D +IDAC+APGNKTTH ASYI S         DKK +++AFEKDPER+KIL K
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKK-RVFAFEKDPERSKILDK 299

Query: 292 MIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXX 351
           M+K+AGC   +++N GDFTK+ATPEK   VTGFIVDPSCSGSGIFGRKF D++N  K   
Sbjct: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359

Query: 352 XXXXXXXXXXXXXXFM---------AKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYS 402
                          +         AK++L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYS
Sbjct: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419

Query: 403 TCSIHAEENERVVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDP 462
           TCSIHAEENERVVIDLLLDK V+EWGWKV  R+  +P+W RRG V EFE+VF++  A DP
Sbjct: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479

Query: 463 QQLAEGCIRALPKEDGGIGFFAVCFVR 489
           +QLAEGCIR LPKEDGGIGFFAVCF R
Sbjct: 480 KQLAEGCIRTLPKEDGGIGFFAVCFER 506

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/496 (60%), Positives = 368/496 (74%), Gaps = 13/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAK-VRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRDATWVLE +E+E +K  R++GS+QTLVL SCKRYKLK+NP+HIYA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKS 119
           YL+K++KK+ ILE++PKKKGKPLF +            SK KRIQMGKHPIK ++LK ++
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 PLHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKK 179
            L +E+        V  LS+L+ ++D   D+ PVRWIRINP+        + VLAEL KK
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDD-GEDVTPVRWIRINPILVKE--RYDDVLAELNKK 177

Query: 180 FTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F Q+V++W ++VPGSIY+DEYIPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHIL+
Sbjct: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237

Query: 240 PGSNDIVIDACSAPGNKTTHTASYIFSE-PPKDKKIQIYAFEKDPERAKILQKMIKVAGC 298
           P S D+VIDAC+APGNKTTH A++IF +   K   ++I+AFEKDPERAK LQ M+  AGC
Sbjct: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297

Query: 299 SANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXX 358
           +  + ++VGDFTKL  PE  + VTGFIVDPSCSGSGIFGRK  D +N  K          
Sbjct: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357

Query: 359 XX-----XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENER 413
                       F  +++L+ RLAKLSSFQ+Q+VKHAMSFP AKKI YSTCSIHAEENER
Sbjct: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417

Query: 414 VVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRAL 473
           VVIDLLLD  V+EWGWKV  RT V+P+WPRRG   EFEEVF      + ++LAEGCIRAL
Sbjct: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEAKELAEGCIRAL 474

Query: 474 PKEDGGIGFFAVCFVR 489
           PKEDGGIGFFAVCF R
Sbjct: 475 PKEDGGIGFFAVCFER 490

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/491 (60%), Positives = 370/491 (75%), Gaps = 9/491 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAK-VRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRD++WVLE IE+E +K  RISGS+QTLVL+SCKRYKLK+NPKHIYA++ SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKS 119
           YLEK++K + +L ++P KKG+P+F++            SK KRI MGKHPIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 PLHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKK 179
            L  E         V+ LSELV  ED   D+ PVRWIRINP +C   G  + VL EL+KK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELV--EDNDADMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189

Query: 180 FTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F ++VD+W+++VPGSIY DEYIPNL+G+HP+DKIT+HELYK GKIIIQDRASCFPA+IL+
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCS 299
           P  +D+VIDACSAPGNKTTH A++IF +      ++IYAFE+D +RA+IL+KM+  AGC 
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPD-GNASDVKIYAFERDAKRAEILEKMVTSAGCE 308

Query: 300 ANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXX 359
           + I ++VGDFT+LA P+  K VTGFI+DPSCSGSGIFGR+  D  N+ K+          
Sbjct: 309 SCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFE 368

Query: 360 XXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLL 419
                     E  +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 369 EQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 428

Query: 420 LDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGG 479
           LD+ ++++GWKVA R  V+P+W RRG + EFEEVF    A   Q+LA+GCIRALPKEDGG
Sbjct: 429 LDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKEDGG 485

Query: 480 IGFFAVCFVRK 490
           IGFFAVCF R+
Sbjct: 486 IGFFAVCFERE 496

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/490 (58%), Positives = 368/490 (75%), Gaps = 13/490 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCK+Y LK+NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LEK++KK+ IL+++PKKKGK +F              +K KRIQMGKHP+KE+VLK K+ 
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           L+SE+V       V DL +L+  +D  ND+ PVRW RINP++CH  G  E V+AEL KKF
Sbjct: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +VD+W ++VPGSIYHDEYIPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 GSNDIVIDACSAPGNKTTHTASYIF-SEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCS 299
             +D++IDAC+APGNKTTH A+++F ++ P++    I+AFEKDPERAK L+ M+K AGCS
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCS 294

Query: 300 ANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXX 359
             I+++VGDFTKLA P     V+GFIVDPSCSGSGIFGR+  D  N+ +           
Sbjct: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEE 354

Query: 360 XXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLL 419
                  +  ++++ RLAKL+SFQF++VK+A+SFP AKK+VYSTCSIHAEENER+VIDLL
Sbjct: 355 RQE----IEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLL 410

Query: 420 LDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGG 479
           LD  V+EWGW+V  R   +P+WPRRG   EFE+VFR+G     ++LAE CIR  PKEDGG
Sbjct: 411 LDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAPKEDGG 468

Query: 480 IGFFAVCFVR 489
           IGFFAVCF R
Sbjct: 469 IGFFAVCFER 478

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/491 (59%), Positives = 369/491 (75%), Gaps = 28/491 (5%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VLK+C +YK+K+NPKHIYAV+ SCWKY+ Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           LE++M K+ IL+ IP+KKGKP F+R            SKQKRIQMGKHPIK+YVLK+K+ 
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           LH+E+V       V++LSELV  +D  +D  PVRWIRINPLKC    +   V+ +L KKF
Sbjct: 121 LHAELVKLKVKLKVKELSELV-DQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +VD+W +L PGSIY+DEY+PNLFGIHP++KIT+H+LYK GK+IIQDRASC PAHIL+P
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDK--KIQIYAFEKDPERAKILQKMIKVAGC 298
           G  D+V+DAC+APGNKTTH A++I S        + QI+AFEK+P RAK+LQKM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 299 SANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXX 358
            + + ++VGDFT+LA P++ + VT  +VDPSCSGSGIFGRK  +S N  +          
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQ---------- 345

Query: 359 XXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDL 418
                      ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 346 ----------DQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395

Query: 419 LLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDG 478
           LLD  V+EWGW+++ R+EVVP+WPRRG  EEFEEVFRD      Q LAE CIRALP+EDG
Sbjct: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454

Query: 479 GIGFFAVCFVR 489
           GIGFFAVCF R
Sbjct: 455 GIGFFAVCFQR 465

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/489 (57%), Positives = 360/489 (73%), Gaps = 7/489 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E      R++GS+QTLVL SCK+Y+LK+NPKHIYA + SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKSP 120
           L+K++K++ IL++IPKKKGK +F              SK KRIQMGKHP+KE+VLK+K+ 
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180
           L SE+V       V DL +L+  +D  ND+ PVRW R+NP++C     +E +L EL KKF
Sbjct: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222

Query: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V++W+ + PG IYHDEYIP LFG+HP DKIT+HELYK GK+IIQDRASCFPAHIL+ 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300
            S D++IDAC+APGNKTTH A++IF +   +  ++I+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVE-SVRIHAFEKDPERAKTLRTMINTAGCTK 341

Query: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXX 360
            I+V+VGDFT+LA P K   VTGFI+DPSCSGSGIFGRK  D  N+ K            
Sbjct: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEK 401

Query: 361 XXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420
                 ++ ++L+ RL KL+SFQF++VKHAMSFP AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 402 EEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461

Query: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480
           D  V+EWGW+V  R  V+P+W RRG  +EFEEVFRD      ++LAE CIR  PKEDGGI
Sbjct: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT--AKELAEACIRVAPKEDGGI 519

Query: 481 GFFAVCFVR 489
           GFFAVCF R
Sbjct: 520 GFFAVCFER 528

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/493 (57%), Positives = 357/493 (72%), Gaps = 12/493 (2%)

Query: 1   MNFYRDATWVLEDIEKE-AAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRDA+WVLE IE+E A K +++GS+ +LVL+S K+YKLKS+ +H+YA++ S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLEKVMKKARILEEIPKKKGKPLFARXXXXXXXXXXXXSKQKRIQMGKHPIKEYVLKFKS 119
           YL+++++K+ +L+++P+KKG+P F R            SK+KRI MGKHP+K +VLK ++
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 PLHSEMVXXXXXXXVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKK 179
            L  E         V DLS  VL +D   D  PVRWIR+NP +    G  E VL EL+KK
Sbjct: 121 RLRGEYAKQLVKLGVADLS--VLVQDEREDATPVRWIRLNPFRIR--GQREEVLQELQKK 176

Query: 180 FTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F ++V +W EL PGSIY DEY+  L+G+HP DKIT+HELYK GKIIIQDRASCFPA IL 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCS 299
           PG +D++IDAC+APGNKTTH A++IF E   D   QI+AFE+DP+RAK L+KMI  AGC 
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGADHA-QIHAFERDPQRAKTLRKMIATAGCD 295

Query: 300 ANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXX 359
             I+V+VGDFT+ A PE  K VTGFIVDPSCSGSGIFGR+  D+    +           
Sbjct: 296 NAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADV 355

Query: 360 XXXXXXFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVID 417
                    K   EL+ RLAKLSSFQFQ+VKHAMSFP AKK++YSTCS+HAEENERVVID
Sbjct: 356 PEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVID 415

Query: 418 LLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKED 477
           LLLD  VQ+ GWKVASR++V+P+WPRRG   EFEEVF D +    ++LA GCIR LPKED
Sbjct: 416 LLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQA----EELAGGCIRVLPKED 471

Query: 478 GGIGFFAVCFVRK 490
           GGIGFFAVCF R+
Sbjct: 472 GGIGFFAVCFERE 484

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 87/197 (44%), Gaps = 29/197 (14%)

Query: 219 YKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYA 278
           Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ +     K+    ++A
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGC-VFA 362

Query: 279 FEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGR 338
            + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG+G+ G+
Sbjct: 363 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 419

Query: 339 KFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKK 398
                +NR +                 FM    LQ +L  LS+     V       G   
Sbjct: 420 DQSVKVNRTE---------------KDFMQIPHLQKQLI-LSA--IDSVDSNSKHGGV-- 459

Query: 399 IVYSTCSIHAEENERVV 415
           IVYSTCS+  EENE VV
Sbjct: 460 IVYSTCSVAVEENEAVV 476

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 90/203 (44%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ +     K+ 
Sbjct: 317 IGATPEYLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM-----KNT 371

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P    G    ++D  CSG
Sbjct: 372 GC-VFANDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSG 427

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 FM    LQ +L  L S    +  H+ +
Sbjct: 428 TGVIGKDQSVKVSRTE---------------KDFMQIPHLQKQL--LLSAIDSVDSHSKT 470

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
                 IVYSTCS+  EE+E+VV
Sbjct: 471 ---GGIIVYSTCSVAVEEDEQVV 490

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 102/234 (43%), Gaps = 41/234 (17%)

Query: 182 QKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPG 241
           Q + NW+++  G    D  +P          I A   Y  G+ I+Q  +S  P   L P 
Sbjct: 292 QPIGNWTKV--GLQIFDSQVP----------IGATPEYLAGQYILQAASSFLPVIALDPQ 339

Query: 242 SNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSAN 301
            N+ ++D  SAPG KTT+ ++ +     K+    ++A + +  R K L   I   GC+  
Sbjct: 340 ENERILDMASAPGGKTTYISALM-----KNTGC-VFANDANKNRTKSLIANIHRLGCTNT 393

Query: 302 IDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXXX 361
           I   V ++     P+   G    ++D  CSG+G+ G+     ++R +             
Sbjct: 394 I---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTE------------- 437

Query: 362 XXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVV 415
               F+    LQ +L  LS+        A S  G   IVYSTCS+  EE+E VV
Sbjct: 438 --KDFIQIPHLQKQLL-LSAID---SVDANSKSGG-VIVYSTCSVAVEEDEAVV 484

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 89/205 (43%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ V+D  SAPG KTT+ ++ + +      
Sbjct: 319 IGATPEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALMKNTGC--- 375

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + + +R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 376 ---VFANDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSG 429

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R +                 F+    LQ +  L+ + S      K  
Sbjct: 430 TGVIGKDQSVKVSRTE---------------KDFIQIPHLQKQLLLSAIDSVDANSKKGG 474

Query: 391 MSFPGAKKIVYSTCSIHAEENERVV 415
           +       IVYSTCS+  EE+E VV
Sbjct: 475 V-------IVYSTCSVAVEEDEAVV 492

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 90/203 (44%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ +     K+ 
Sbjct: 310 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM-----KNT 364

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC   I   V ++     P+   G    ++D  CSG
Sbjct: 365 GC-VFANDANKARTKSLIANIHRLGCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 420

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 FM    LQ +L  LS+    +  H+ +
Sbjct: 421 TGVIGKDQSVKVSRTE---------------KDFMQIPHLQKQLI-LSAID-SVDAHSKT 463

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
                 IVYSTCS+  EENE VV
Sbjct: 464 ---GGVIVYSTCSVAVEENEAVV 483

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 99/236 (41%), Gaps = 45/236 (19%)

Query: 182 QKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPG 241
           Q + NW+++  G    D  +P          I A   Y  G  I+Q  +S  P   L P 
Sbjct: 309 QPIGNWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPQ 356

Query: 242 SNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSAN 301
            N+ ++D  +APG KTT+ ++ + +         ++A + +  R K L   I   GC+  
Sbjct: 357 ENERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKNRTKSLIANIHRLGCTNT 410

Query: 302 IDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXXX 361
           I   V ++     P+   G    ++D  CSG+G+ G+     ++R +             
Sbjct: 411 I---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTE------------- 454

Query: 362 XXXXFMAKEELQTR--LAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVV 415
               F+    LQ +  L+ + S      K  +       IVYSTCS+  EE+E VV
Sbjct: 455 --KDFIQIPHLQKQLLLSAIDSVDANSKKGGI-------IVYSTCSVAVEEDEAVV 501

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 115/293 (39%), Gaps = 59/293 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P ++L    +  V+D C+APG+KT      + +  P+     + A + 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGF-VVANDA 204

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKGVTGF---IVDPSCSGSGI 335
           D  R+ +L   +K    SAN+ V   D   F ++ T E  K    F   + D  CSG G 
Sbjct: 205 DYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGT 263

Query: 336 FGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS-FP 394
                     R+ I                 + K+        L + Q  ++   ++   
Sbjct: 264 M---------RKNIN----------------VWKDWGTGSGLGLHTVQLNILNRGLTLLK 298

Query: 395 GAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------SRTEVVPSWPR 443
              ++VYSTCS++  ENE VV       A+++WG K+             R+  + SWP 
Sbjct: 299 NGGRLVYSTCSLNPIENEAVVA-----AALRKWGAKIKLVNCDDQLLGLVRSTGISSWPV 353

Query: 444 RGKVEEFEEVFRDG--------SAHDPQQLA-EGCIRALPKEDGGIGFFAVCF 487
             K  E +    DG        S  + ++   E CIR  P +    GFF   F
Sbjct: 354 LDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVF 406

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 313 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMMKNTGC--- 369

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 370 ---VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 423

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 FM    LQ +L  LS+     V     
Sbjct: 424 TGVIGKDQSVKVSRTE---------------KDFMQIPHLQKQLL-LSA--IDSVDSNSK 465

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  +ENE VV
Sbjct: 466 TGGV--IVYSTCSVAVDENEAVV 486

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 109/269 (40%), Gaps = 43/269 (15%)

Query: 147 VNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKFTQKVDNWSELVPGSIYHDEYIPNLFG 206
            N++P    IR N LK       + ++   K    Q +  W+++  G    D  +P    
Sbjct: 279 ANEVPRPISIRTNTLKTRRRDLAQALVN--KGVNLQPIGAWTKV--GLQIFDSQVP---- 330

Query: 207 IHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFS 266
                 I A   Y  G+ I+Q  +S  P   L P  N+ V+D  +APG KTT+ ++ + +
Sbjct: 331 ------IGATSEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALMKN 384

Query: 267 EPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIV 326
                    ++A + +  R K L   I   GC+  I   V ++     P+   G    ++
Sbjct: 385 TGC------VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILL 435

Query: 327 DPSCSGSGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQM 386
           D  CSG+G+ G+                           F+    LQ +L  LS+     
Sbjct: 436 DAPCSGTGVIGKD---------------QSVKSSRTEKDFIQIPHLQKQLL-LSAID--- 476

Query: 387 VKHAMSFPGAKKIVYSTCSIHAEENERVV 415
              A S  G   IVYSTCS+  EE+E VV
Sbjct: 477 SVDANSKTGG-VIVYSTCSVAVEEDEAVV 504

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 87/208 (41%), Gaps = 39/208 (18%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ V+D  SAPG KTT+ ++ + +      
Sbjct: 330 IGATPEYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALMKNTGC--- 386

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              I+A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 387 ---IFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 440

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAM- 391
           +G+ G+     ++R                          +    ++   Q Q++  A+ 
Sbjct: 441 TGVIGKDQSVKVSR-------------------------TEKDFIQIPHLQKQLILSAID 475

Query: 392 SFPGAKK----IVYSTCSIHAEENERVV 415
           S     K    +VYSTCS+  EE+E VV
Sbjct: 476 SLDSNSKNGGVLVYSTCSVAVEEDEAVV 503

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 87/208 (41%), Gaps = 39/208 (18%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G+ I+Q  +S  P   L P  N+ V+D  +APG KTT+ ++ + +      
Sbjct: 311 IGATSEYLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALMKNTGC--- 367

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 368 ---VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 421

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                          +    ++   Q Q++  A+ 
Sbjct: 422 TGVIGKDQSVKVSR-------------------------TEKDFIQIPHLQKQLLLSAID 456

Query: 393 FPGAKK-----IVYSTCSIHAEENERVV 415
              A       IVYSTCS+  EE+E VV
Sbjct: 457 SVDANSKTGGFIVYSTCSVAVEEDEAVV 484

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 87/203 (42%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 327 IGATPEYLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 383

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 384 ---VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 437

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+  +     ++R                   FM    LQ +L  LS+        A S
Sbjct: 438 TGVIAKDQSVKVSR---------------TDKDFMQIPHLQKQLL-LSAID---SVDANS 478

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  EENE VV
Sbjct: 479 KTGG-VIVYSTCSVAVEENEAVV 500

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 87/203 (42%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 305 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC--- 361

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 362 ---VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 415

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+  +     ++R +                 FM    LQ +L  LS+     V     
Sbjct: 416 TGVIAKDQSVKVSRTE---------------KDFMQIPHLQKQLI-LSA--IDSVDSNSK 457

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  EENE VV
Sbjct: 458 TGGI--IVYSTCSVAVEENEAVV 478

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 323 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTG---- 378

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 379 --TVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 433

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 F+    LQ +L  LS+     V     
Sbjct: 434 TGVIGKDQSVKVSRTE---------------KDFIQIPHLQKQLL-LSA--IDSVDCNSK 475

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  EE+E VV
Sbjct: 476 HGGI--IVYSTCSVAVEEDEAVV 496

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 188 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 244

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 245 ---VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 298

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 F+    LQ +L  LS+     V     
Sbjct: 299 TGVIGKDQSVKVSRTE---------------KDFIQIPHLQKQLL-LSA--IDSVDCNSK 340

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  EE+E VV
Sbjct: 341 HGGV--IVYSTCSVAVEEDEAVV 361

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 91/210 (43%), Gaps = 30/210 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 325 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 381

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 382 ---VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 435

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+  +     ++R +                 F+    LQ +L  LS+        A S
Sbjct: 436 TGVIAKDQSVKVSRTE---------------KDFIQIPHLQKQLL-LSAID---SVDANS 476

Query: 393 FPGAKKIVYSTCSIHAEENERVVIDLLLDK 422
             G   IVYSTCS+  EENE  VID  L K
Sbjct: 477 KTGG-VIVYSTCSVAVEENE-AVIDYALRK 504

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 108/292 (36%), Gaps = 56/292 (19%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L   SN  V+D C+APG+KT      +  +  +   I I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGI-IVANDS 217

Query: 282 DPERAKILQKMIKVAGCSANIDVN--VGDFTKLATPEKCKGVT----GFIVDPSCSGSGI 335
           D  R+ +L   +K    S  + VN     F  + T      +T      + D  CSG G 
Sbjct: 218 DMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGT 277

Query: 336 FGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMSFPG 395
             RK  +  N  +                  +    LQ  +        Q++++      
Sbjct: 278 L-RKNINIWNDWRFQNA--------------LGLHRLQNNILNRG---LQLLRN------ 313

Query: 396 AKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAS-----------RTEVVPSWP-- 442
             ++VYSTCS++  ENE V+ +     A++ W  +V+            R+  + SWP  
Sbjct: 314 GGRLVYSTCSMNPIENEAVIAN-----ALRNWAGEVSLVNFDDELPGLIRSRGISSWPVI 368

Query: 443 -------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
                   RG  E  +  F   +        E CIR  P +     FF   F
Sbjct: 369 DRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVF 420

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 91/210 (43%), Gaps = 30/210 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 316 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 372

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 373 ---VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 426

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 F+    LQ +L  LS+     V     
Sbjct: 427 TGVIGKDQSVKVSRTE---------------KDFIQIPHLQKQLL-LSA--IDSVDCNSK 468

Query: 393 FPGAKKIVYSTCSIHAEENERVVIDLLLDK 422
             G   IVYSTCS+  EE+E  VID  L K
Sbjct: 469 HGGV--IVYSTCSVAVEEDE-AVIDYALRK 495

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 317 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 373

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 374 ---VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 427

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 F+    LQ +L  LS+     V     
Sbjct: 428 TGVIGKDQSVKVSRTE---------------KDFIQIPHLQKQLL-LSA--IDSVDCNSK 469

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  EE+E VV
Sbjct: 470 HGGV--IVYSTCSVAVEEDEAVV 490

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 91/210 (43%), Gaps = 30/210 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 316 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 372

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 373 ---VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 426

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 F+    LQ +L  LS+     V     
Sbjct: 427 TGVIGKDQSVKVSRTE---------------KDFIQIPHLQKQLL-LSA--IDSVDCNSK 468

Query: 393 FPGAKKIVYSTCSIHAEENERVVIDLLLDK 422
             G   IVYSTCS+  EE+E  VID  L K
Sbjct: 469 HGGV--IVYSTCSVAVEEDE-AVIDYALRK 495

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 89/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ +     K+ 
Sbjct: 313 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM-----KNT 367

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  C+G
Sbjct: 368 GC-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTG 423

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 F+    LQ +L  LS+     V     
Sbjct: 424 TGVIGKDQSVKVSRTE---------------KDFIQVPHLQKQLL-LSA--IDSVDSNSK 465

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  EE+E VV
Sbjct: 466 TGGI--IVYSTCSVAVEEDEMVV 486

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDK 272
           I A   Y  G  I+Q  +S  P   L P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 318 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 374

Query: 273 KIQIYAFEKDPERAKILQKMIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I   V ++     P+   G    ++D  CSG
Sbjct: 375 ---VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 428

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R +                 F+    LQ +L  LS+     V     
Sbjct: 429 TGVIGKDQSVKVSRTE---------------KDFIQIPHLQKQLL-LSA--IDSVDCNSK 470

Query: 393 FPGAKKIVYSTCSIHAEENERVV 415
             G   IVYSTCS+  EE+E VV
Sbjct: 471 HGGV--IVYSTCSVAVEEDEAVV 491

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 116/293 (39%), Gaps = 59/293 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L       V+D C+APG+KT      + ++ P+     + A + 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKGVTGF---IVDPSCSGSGI 335
           D  R+ +L   +K    SAN+ V   D   F ++ T E  K    F   + D  CSG G 
Sbjct: 204 DYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGT 262

Query: 336 FGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS-FP 394
                     R+ I                 + K+        L + Q  ++   ++   
Sbjct: 263 M---------RKNIN----------------VWKDWATASGLGLHTVQVNILNRGLNLLK 297

Query: 395 GAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAS-----------RTEVVPSWPR 443
              ++VYSTCS++  ENE VV       A+++WG K+             R++ +  WP 
Sbjct: 298 DGGRLVYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRSQGISQWPV 352

Query: 444 RGK---VEEFEEVFRDGSAHDP--QQLA----EGCIRALPKEDGGIGFFAVCF 487
             K    ++  +   D S   P  ++++    E C+R  P +    GFF   F
Sbjct: 353 YDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVF 405

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 111/292 (38%), Gaps = 62/292 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L   SN  V+D C+APG+KT      + +   +   I + A + 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGI-VVANDA 202

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKGVTGF------IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++A  E       F      + D  CSG
Sbjct: 203 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSG 261

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                 + ++        L + Q  ++   + 
Sbjct: 262 DGTM---------RKNVN----------------VWRDWTSQGGLGLHNIQLNILNRGLH 296

Query: 393 FPGAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
               K ++VYSTCS++  ENE V+       A+++WG K+             R++ + S
Sbjct: 297 LLKPKGRLVYSTCSMNPIENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRSKGIDS 351

Query: 441 WPRRGKVEEFEEVFRDGSAHD---------PQQLAEGCIRALPKEDGGIGFF 483
           WP   +  E  +    G ++           Q   + CIR  P +     FF
Sbjct: 352 WPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFF 403

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 114/289 (39%), Gaps = 59/289 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L   S+  V+D C+APG+KT      + S   +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKGVTGF---IVDPSCSGSGI 335
           D  R+ +L   +K    SAN+ V   D   F ++ T ++      F   + D  CSG G 
Sbjct: 204 DARRSHMLVHQLKRLN-SANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGT 262

Query: 336 FGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS-FP 394
                     R+ +                 + K+        L + Q  ++K  ++   
Sbjct: 263 M---------RKNVN----------------VWKDWGTASGLGLHTVQLNILKRGLNLLK 297

Query: 395 GAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------SRTEVVPSWPR 443
              ++VYSTCS++  ENE VV       A+++WG K+             R++ + +WP 
Sbjct: 298 KGGRLVYSTCSMNPIENEAVVA-----AALRQWGDKIKLVDCSDKLPGLVRSKGISNWPV 352

Query: 444 RGKVEEFEEVFRDGSAHD--PQQLAEG-------CIRALPKEDGGIGFF 483
             K  E +E   +G+     P    E        CIR  P +    GFF
Sbjct: 353 IDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFF 401

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 114/292 (39%), Gaps = 62/292 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT     Y+  +  +     + A + 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGF-VVANDA 200

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKL-ATPEKC--KGVTGF---IVDPSCSG 332
           D +R+ +L   +K    SAN+ V   D   F ++ A P+    K +  F   + D  CSG
Sbjct: 201 DAKRSHMLVHQLKRLN-SANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSG 259

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                       Q  LA L + Q  ++   + 
Sbjct: 260 DGTM---------RKNVNVWRDWTT---------------QNGLA-LHNVQLNILNRGLH 294

Query: 393 F-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
                 ++VYSTCS++  ENE VV +     A+++WG KV             R+  +  
Sbjct: 295 LLKSGGRLVYSTCSMNPIENEAVVAE-----ALRKWGGKVRLVDCSDKLPGLVRSNGINQ 349

Query: 441 WPRRGKVEEFEEVFRDGSAHD--PQQLAEG-------CIRALPKEDGGIGFF 483
           WP   +  E +E   DG+     P    E        C+R  P +    GFF
Sbjct: 350 WPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFF 401

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 110/293 (37%), Gaps = 59/293 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    N  V+D C+APG+KT      + ++  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKGVTGF---IVDPSCSGSGI 335
           D +R+ +L   +K    SAN+ V   D   F ++ +    K    F   + D  CSG G 
Sbjct: 204 DAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGT 262

Query: 336 FGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS-FP 394
                     R+ +                 + ++        L + Q  ++   ++   
Sbjct: 263 M---------RKNVN----------------VWRDWGTASGLGLHTVQLNILNRGLNLLK 297

Query: 395 GAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPSWP- 442
              ++VYSTCS++  ENE V+       A+++WG K+             R++ +  WP 
Sbjct: 298 DGGRLVYSTCSLNPIENESVIA-----AALRKWGDKIRLVNCDEKLPGLVRSKGITQWPV 352

Query: 443 --------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
                    +G     E  F        +   E CIR  P +    GFF   F
Sbjct: 353 YDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVF 405

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 117/301 (38%), Gaps = 70/301 (23%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTAS--YIFSEPPKDKKIQIYAF 279
           G I  Q+  S  P  +L    +  V+D C+APG+KT       +I S+ P      + A 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSG---FVIAN 196

Query: 280 EKDPERAKILQKMIKVAGCSANIDVN--------VGDFTKLATPEKCKGVTGFIVDPSCS 331
           + D +R+ +L   +K    S  + VN        +   TK A+ ++       + D  CS
Sbjct: 197 DADNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCS 256

Query: 332 GSGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           R+ +                       Q  L  L + QF ++   +
Sbjct: 257 GDGTM---------RKNVN---------------VWKNWNTQNALG-LHNVQFNILDRGL 291

Query: 392 SF-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVP 439
           +      K+VYSTCS++  ENE VV  +L     ++WG KV             R++ + 
Sbjct: 292 TLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRSKGLT 346

Query: 440 SWPRRGKVEEFEEVFR-------DGSAHDPQQLA------EGCIRALPKEDGGIGFFAVC 486
           +WP   +  + EEV R       + S + P +        + C+R  P +    GFF   
Sbjct: 347 TWPVINR--DMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITM 404

Query: 487 F 487
           F
Sbjct: 405 F 405

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 111/296 (37%), Gaps = 62/296 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  E  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKC---KGVTGF---IVDPSCSG 332
           D +R+ +L   +K    SAN+ V   D   F ++   E     K V  F   + D  CSG
Sbjct: 204 DAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                       Q+ L  L + Q  ++   + 
Sbjct: 263 DGTM---------RKNVN---------------VWRDWNTQSGLG-LHTVQLNILNRGLH 297

Query: 393 FPGAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
               K ++VYSTCS++  ENE VV       A+++WG K+             R++ + +
Sbjct: 298 LLKPKGRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRSKGIST 352

Query: 441 WP---------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
           WP         ++G     E  F        +     CIR  P +    GFF   F
Sbjct: 353 WPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVF 408

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 109/296 (36%), Gaps = 62/296 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGDFT-----KLAT-PEKCKGVTGF---IVDPSCSG 332
           D +R+ +L   +K    SAN+ V   D       KL T  EK K +  F   + D  CSG
Sbjct: 204 DAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   ++
Sbjct: 263 DGTMRKNV------------------------NVWKDWNTQGGLG-LHTVQLNILNRGLN 297

Query: 393 F-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------SRTEVVPS 440
                 ++VYSTCS++  ENE VV +     A+++WG K+             R++ + +
Sbjct: 298 LLKSGGRLVYSTCSMNPIENEAVVAE-----ALRKWGSKIKLVNCDDKLVGLVRSKGISN 352

Query: 441 WP---------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
           WP          +G     E  F            + CIR  P +    GFF   F
Sbjct: 353 WPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVF 408

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 111/296 (37%), Gaps = 62/296 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L       V+D C+APG+KT      +  +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATP---EKCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++ T    EK   +  F   + D  CSG
Sbjct: 204 DNRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                       Q  L  L   Q  ++   + 
Sbjct: 263 DGTM---------RKNVNVWRDWNT---------------QNALG-LHQVQANILNRGLH 297

Query: 393 F-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
                 ++VYSTCS++  ENE VV      +A+++WG KV             R + +  
Sbjct: 298 LLKKGGRLVYSTCSMNPIENEAVVA-----QALRKWGDKVRLVNCDDKLPGLVRNKGISK 352

Query: 441 WPRRGK----VEEFEEVFRDGSAHDPQQLA-----EGCIRALPKEDGGIGFFAVCF 487
           WP   +    +E+ +E   D      ++ A     E CIR  P +    GFF   F
Sbjct: 353 WPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVF 408

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 108/292 (36%), Gaps = 62/292 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L       V+D C+APG+KT      +  +  +     + A + 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGF-VVANDA 204

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATP---EKCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++      +K K +  F   + D  CSG
Sbjct: 205 DSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSG 263

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                       Q+ L  L + Q+ ++   ++
Sbjct: 264 DGTM---------RKNVN---------------VWKDWNTQSGLG-LHTVQYNILNRGLN 298

Query: 393 F-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------SRTEVVPS 440
                 ++VYSTCS++  ENE VV      +A++ WG K+             R++ +  
Sbjct: 299 LLKSGGRLVYSTCSLNPIENEAVVA-----QALRTWGDKIKLVNCGDKLPGLVRSQGISQ 353

Query: 441 WP---------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFF 483
           WP          +G     E  F            E CIR  P +    GFF
Sbjct: 354 WPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFF 405

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 114/297 (38%), Gaps = 63/297 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  +  +     + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGF-VVANDA 201

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGDF-------TKLATPEKCKGVTGF---IVDPSCS 331
           D +R+ +L   +K    SAN+ V   D        +  A       V  F   + D  CS
Sbjct: 202 DSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLCDVPCS 260

Query: 332 GSGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           R+ +                 + ++        L + QF ++   +
Sbjct: 261 GDGTM---------RKNVN----------------VWRDWTPQGGLGLHTVQFNILNRGL 295

Query: 392 SFPGAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV--ASRTEVVPSWPRRGKVE 448
                K ++VYSTCS++  ENE VV +     A+++WG K+   S  + +P   R   V 
Sbjct: 296 HLLKNKGRLVYSTCSMNPIENEAVVAE-----ALRKWGDKIRLVSCEDKLPGLVRSKGVS 350

Query: 449 EFEEVFR--------DGSAHDP------QQLA----EGCIRALPKEDGGIGFFAVCF 487
           ++  + R        D   HD       ++ A    E CIR  P +    GFF   F
Sbjct: 351 QWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVF 407

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 108/296 (36%), Gaps = 62/296 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPE---KCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++   E   K   V  F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                       Q  L  L + Q  ++   + 
Sbjct: 263 DGTM---------RKNVN---------------VWKDWNTQAGLG-LHTVQLNILNRGLH 297

Query: 393 F-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
                 ++VYSTCS++  ENE V+ +     A+++WG K+             R++ V  
Sbjct: 298 LLKDGGRLVYSTCSLNPIENEAVIAE-----ALRKWGDKIRLVNCDDKLSGLVRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
           WP          +G     E  F        +   + C+R  P +    GFF   F
Sbjct: 353 WPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVF 408

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 104/296 (35%), Gaps = 62/296 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKL---ATPEKCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++           V  F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWKDWNTQAGLG-LHTVQLNILNRGLH 297

Query: 393 F-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
                 ++VYSTCS++  ENE VV +     A+++WG K+             R++ V  
Sbjct: 298 LLKNNGRLVYSTCSLNPIENEAVVAE-----ALRKWGDKIRLVNCDDKLPGLIRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
           WP          +G     E  F        +   + C+R  P +    GFF   F
Sbjct: 353 WPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVF 408

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 109/292 (37%), Gaps = 62/292 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KTT     +  +  +     + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGF-VVANDA 201

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLA---TPEKCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++     P K K    F   + D  CSG
Sbjct: 202 DSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSG 260

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                 + K+        L + Q  ++   + 
Sbjct: 261 DGTM---------RKNVN----------------VWKDWNTQGALGLHTVQLNILDRGLH 295

Query: 393 -FPGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
                 ++VYSTCS++  ENE VV +     A++ WG KV             R++ +  
Sbjct: 296 LLQNNGRLVYSTCSMNPIENEAVVAE-----ALRRWGDKVRLVDCSEKLPGLIRSQGITQ 350

Query: 441 WP-------RRGKVEE--FEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFF 483
           WP        R K +E      F        +   E C+R  P +    GFF
Sbjct: 351 WPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 112/297 (37%), Gaps = 64/297 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L       V+D C+APG+KT      +  +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLA---TPEKCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++      EK + +  F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                 + K+        L + Q+ ++   + 
Sbjct: 263 DGTM---------RKNVN----------------VWKDWNAQGALGLHTVQWNILNRGLH 297

Query: 393 F--PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVP 439
              P  + +VYSTCS++  ENE VV      +A+++WG K+             R++ + 
Sbjct: 298 LLKPNGR-LVYSTCSLNPIENEAVVA-----QALRKWGNKIRLVNCDEKLPGLVRSKGIS 351

Query: 440 SWP-------RRGKVEE--FEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
            WP        + K +E   E  F            + CIR  P +    GFF   F
Sbjct: 352 QWPVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVF 408

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 107/291 (36%), Gaps = 60/291 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  E  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGF-VVANDS 203

Query: 282 DPERAKILQKMIKVAGCS----ANIDVNVGDFTKLATPE-KCKGVTGF---IVDPSCSGS 333
           D  R+ +L   +K    +     N D       KL+  + K K    F   + D  CSG 
Sbjct: 204 DYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGDNKAKDALKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS- 392
           G           R+ +                       Q  L  L + Q+ ++   +  
Sbjct: 264 GTM---------RKNV---------------NVWKDWNTQAGLG-LHTIQYNILNRGLHL 298

Query: 393 FPGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------SRTEVVPSW 441
                ++VYSTCS++  ENE VV      +A++ WG K+             R+  V  W
Sbjct: 299 LKTGGRLVYSTCSLNPIENEAVVA-----RALRTWGSKIKIINCDDKLPGLIRSNGVTQW 353

Query: 442 PRRGKVEEFEEVFRDGSAH------DPQQLA---EGCIRALPKEDGGIGFF 483
           P   +  E +    +G+        D +  A   + C+R  P +    GFF
Sbjct: 354 PVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFF 404

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 106/296 (35%), Gaps = 62/296 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKL---ATPEKCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++       K   +  F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWKDWNTQAGLG-LHTVQLNILNRGLH 297

Query: 393 FPGAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
              +  ++VYSTCS++  ENE V+ +     A+++WG K+             R++ V  
Sbjct: 298 LLKSNGRLVYSTCSLNPIENEAVIAE-----ALRKWGDKIRLVNCDDKLTGLIRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
           WP          +G     E  F        +   + C+R  P +    GFF   F
Sbjct: 353 WPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVF 408

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 106/296 (35%), Gaps = 62/296 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKL---ATPEKCKGVTGF---IVDPSCSG 332
           D  R+ +L   +K    SAN+ V   D   F ++           V  F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                       Q  L  L + Q  ++   + 
Sbjct: 263 DGTM---------RKNVN---------------VWKDWNTQAGLG-LHAVQLNILNRGLH 297

Query: 393 F-PGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------ASRTEVVPS 440
                 ++VYSTCS++  ENE VV +     A+++WG K+             R++ V  
Sbjct: 298 LLKNNGRLVYSTCSLNPIENEAVVAE-----ALRKWGDKIRLVNCDDKLPGLIRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFFAVCF 487
           WP          +G     +  F        +   + C+R  P +    GFF   F
Sbjct: 353 WPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVF 408

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 107/298 (35%), Gaps = 66/298 (22%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  +  +     + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGF-VVANDS 197

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKGVTGF------IVDPSCSG 332
           D  RA +L   +K    SAN+ V   D   F K+         +G       + D  CSG
Sbjct: 198 DSRRAYMLVHQLKRLN-SANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSG 256

Query: 333 SGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G           R+ +                 + K+        L + Q  ++   + 
Sbjct: 257 DGTM---------RKNVN----------------VWKDWNTQNALGLHNVQLNILNRGLQ 291

Query: 393 -FPGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------SRTEVVPS 440
                 ++VYSTCS++  ENE VV       A+++WG K+             R+  +  
Sbjct: 292 LLKDNGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRSNGISH 346

Query: 441 WPRRGKVEEFEEVFRD-----GSAHDPQQLA------EGCIRALPKEDGGIGFFAVCF 487
           W    +  E   + +D      S  +P          E C+R  P +    GFF   F
Sbjct: 347 WSVYDR--EMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVF 402

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 106/298 (35%), Gaps = 73/298 (24%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      +  + P+     + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGF-VVANDS 197

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKG--------VTGFIVDPSC 330
           D +R+ +L   +K    SAN+ V   D   F K+   +  KG            + D  C
Sbjct: 198 DSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPKIQL-DSNKGRHNKEYLKFDRILCDVPC 255

Query: 331 SGSGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G           R+ +                 + K+        L + Q  ++   
Sbjct: 256 SGDGTI---------RKNVN----------------IWKDWNTQNSLGLHNVQLNILNRG 290

Query: 391 MS-FPGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWG--------------------- 428
           +       ++VYSTCS+   ENE V+        +++WG                     
Sbjct: 291 IQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGI 345

Query: 429 --WKVASRT-EVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGIGFF 483
             W+V  RT  +V     + K   F+    + +  +       CIR  P +    GFF
Sbjct: 346 SKWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSH----CIRVFPHQQNTGGFF 399

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 88/221 (39%), Gaps = 43/221 (19%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      + +E  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGF-VIANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGDFT-----KLATPEKCKG-----VTGFIVDPSCS 331
           D +R+ +L   +K    SAN+ V   D       K+ + E  KG         + D  CS
Sbjct: 204 DYKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCS 262

Query: 332 GSGIFGRKFFDSLNRRKIXXXXXXXXXXXXXXXXFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           R+ +                 + K+        L   Q  +++  +
Sbjct: 263 GDGTM---------RKNVN----------------VWKDWNTGSGLGLHIVQLNILERGL 297

Query: 392 S-FPGAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV 431
           +      K+VYSTCS++  ENE V+       A++ WG KV
Sbjct: 298 NLLKEGGKLVYSTCSLNPIENEAVIA-----AALRRWGDKV 333

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR161W
           (HLJ1)
          Length = 235

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 139 ELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKFTQKVDNWSELVPGSIYHD 198
           EL+  ++  +D    +  R   +K HPD N  P  AE  KK  +  +  S+     +Y  
Sbjct: 27  ELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEAFKKVNRAFEVLSDEKKRRVY-- 84

Query: 199 EYIPNLFGIHPTDKITAHELYKHG 222
               +  G  P D+  A E Y+ G
Sbjct: 85  ----DQLGYDPDDRAAAQESYRRG 104

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 49/121 (40%), Gaps = 8/121 (6%)

Query: 222 GKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      + +   +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGF-VVANDA 203

Query: 282 DPERAKILQKMIKVAGCSANIDVNVGD---FTKLATPEKCKGVTGF---IVDPSCSGSGI 335
           D  R+ +L   +K    SAN+ V   D   F ++           F   + D  CSG G 
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGT 262

Query: 336 F 336
            
Sbjct: 263 M 263

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 9/73 (12%)

Query: 243 NDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSANI 302
           +DIV++     GN TT            +K  ++ A E DP  A  L K +        +
Sbjct: 57  SDIVLEVGPGTGNLTTRIL---------EKARKVVAVEFDPRMAAELTKRVHGTAAEKKL 107

Query: 303 DVNVGDFTKLATP 315
           ++ +GDFTK   P
Sbjct: 108 EIILGDFTKTELP 120

>ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa]
            {ON} similar to uniprot|P36126 Saccharomyces cerevisiae
            YKR031C SPO14 Phospholipase D catalyzes the hydrolysis of
            phosphatidylcholine producing choline and phosphatidic
            acid involved in Sec14p-independent secretion required
            for meiosis and spore formation differently regulated in
            secretion and meiosis
          Length = 1610

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 207  IHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYI 264
            + P DK+   ELY HGK++I D  +C        GS +  I+  S  GN+ +  A+ I
Sbjct: 1016 LGPHDKLVTEELYVHGKVLIVDDRACI------VGSAN--INERSQLGNRDSEVAAII 1065

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 9/77 (11%)

Query: 239 HPGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGC 298
           H   +DIV++     GN T             +K  ++ A E DP  A  L K +     
Sbjct: 53  HIKPSDIVLEVGPGTGNLTVRIL---------EKAKKVVAVEMDPRMAAELTKRVHGTPA 103

Query: 299 SANIDVNVGDFTKLATP 315
              +D+ +GDF K   P
Sbjct: 104 EKKLDIMLGDFMKTELP 120

>TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {ON}
           Anc_1.251 YKR031C
          Length = 1551

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 8/59 (13%)

Query: 206 GIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDACSAPGNKTTHTASYI 264
            I P DK+   +LY H K++I D  SC        GS +  I+  S  GN+ +  A  I
Sbjct: 946 AIGPQDKLVTEQLYVHAKVLIADDRSCI------IGSAN--INERSQLGNRDSEVAMII 996

>NCAS0B07800 Chr2 complement(1477435..1482504) [5070 bp, 1689 aa] {ON}
            Anc_1.251 YKR031C
          Length = 1689

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 207  IHPTDKITAHELYKHGKIIIQDRASC 232
            I P DK+   +LY H KI+I D  SC
Sbjct: 1101 IGPHDKLMTEQLYVHAKILISDDRSC 1126

>TBLA0H02990 Chr8 complement(732711..737957) [5247 bp, 1748 aa] {ON}
            Anc_1.251 YKR031C
          Length = 1748

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 207  IHPTDKITAHELYKHGKIIIQDRASC 232
            I P DKI   +LY H KI+I D  +C
Sbjct: 1051 IGPFDKIVTEQLYVHAKILISDDRNC 1076

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,727,215
Number of extensions: 2056894
Number of successful extensions: 4657
Number of sequences better than 10.0: 73
Number of HSP's gapped: 4638
Number of HSP's successfully gapped: 95
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)