Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_14.3232.289ON25325312371e-174
Skud_14.3052.289ON24924610651e-148
Smik_14.3072.289ON24624610431e-144
YNL024C2.289ON24624610301e-143
NCAS0G03850singletonON2512507871e-105
NCAS0G037702.289ON2512507871e-105
KNAG0H019802.289ON2492497661e-102
NDAI0G006802.289ON2552557651e-102
SAKL0E07612g2.289ON2522437159e-95
CAGL0M06897g2.289ON2482437105e-94
KAFR0H032902.289ON2452496759e-89
KLTH0G10428g2.289ON2512426621e-86
Kwal_27.115132.289ON2512436506e-85
ADL212W2.289ON2512476178e-80
Ecym_33282.289ON2542515994e-77
KLLA0E08295g2.289ON2662405753e-73
NDAI0J028604.352ON347187985e-04
Skud_10.3524.352ON336123850.023
Suva_12.2204.352ON337112850.025
Smik_2.4141.325ON417128850.029
SAKL0D06798g1.325ON42182830.043
KNAG0C018001.325ON42166830.050
KAFR0C042501.325ON39170800.12
Smik_10.4224.352ON340182790.14
Skud_2.4031.325ON41767790.15
AER240W1.325ON39079790.16
TDEL0D019401.325ON405211760.38
KNAG0E019002.259ON37586740.62
NCAS0B074101.325ON414131740.64
YJR129C4.352ON339118720.92
YBR271W (EFM2)1.325ON41967711.3
Kwal_47.166354.352ON322168711.3
Suva_4.5321.325ON41666701.7
Kwal_27.122678.591ON22265664.2
CAGL0I09438g1.325ON406134674.9
TPHA0A047905.141ON32340665.2
TPHA0L003404.352ON341116665.2
Kpol_1066.171.325ON43571666.1
TBLA0D052001.325ON39972657.2
Kwal_14.25501.325ON41868657.9
NDAI0C028605.141ON32040649.3
KNAG0I016201.364ON69191659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_14.323
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   481   e-174
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   414   e-148
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   406   e-144
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   401   e-143
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               307   e-105
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   307   e-105
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   299   e-102
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   299   e-102
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   280   9e-95
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   278   5e-94
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   264   9e-89
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   259   1e-86
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   254   6e-85
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   242   8e-80
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   235   4e-77
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   226   3e-73
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    42   5e-04
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    37   0.023
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    37   0.025
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    37   0.029
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    37   0.043
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    37   0.050
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    35   0.12 
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    35   0.14 
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    35   0.15 
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    35   0.16 
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    34   0.38 
KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.2...    33   0.62 
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    33   0.64 
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    32   0.92 
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    32   1.3  
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    32   1.3  
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    32   1.7  
Kwal_27.12267 s27 complement(1154465..1155133) [669 bp, 222 aa] ...    30   4.2  
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    30   4.9  
TPHA0A04790 Chr1 complement(1085793..1086764) [972 bp, 323 aa] {...    30   5.2  
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    30   5.2  
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    30   6.1  
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    30   7.2  
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    30   7.9  
NDAI0C02860 Chr3 complement(659616..660578) [963 bp, 320 aa] {ON...    29   9.3  
KNAG0I01620 Chr9 complement(315050..317125) [2076 bp, 691 aa] {O...    30   9.8  

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  481 bits (1237), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 238/253 (94%), Positives = 238/253 (94%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLV 120
           ILEKSDDHLLSETVHEKRPFMKVLE               EKNKFHDNTKVYVTDIDRLV
Sbjct: 61  ILEKSDDHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLV 120

Query: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180
           PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240
           LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL
Sbjct: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240

Query: 241 FQLVRKCSSHSEA 253
           FQLVRKCSSHSEA
Sbjct: 241 FQLVRKCSSHSEA 253

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  414 bits (1065), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 204/246 (82%), Positives = 213/246 (86%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFGGFEDLVVPR  EH GQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLV 120
           ILEKS  HLLSE  H +R F KVLE               EKN FHD +KVYVTDID+LV
Sbjct: 61  ILEKSLHHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLV 120

Query: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180
           PL+ERNIELDKVQYEVLARELWWGEPLS DFSPQEGDLQ NNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240
           LE+TLLDLTNCISPPVILMAYKKRRKADK FF+KIKRNFDVLEI DF KFD+YLKQ+THL
Sbjct: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240

Query: 241 FQLVRK 246
           FQL+RK
Sbjct: 241 FQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  406 bits (1043), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 213/246 (86%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFGGF DLVVPR KEH GQTDLSF GKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLV 120
           ILEKS DHLLS+TV  K+ F KVLE               EKN +HD TKVYVTDID+LV
Sbjct: 61  ILEKSVDHLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLV 120

Query: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180
           PL++RNIELDKVQYEVLAREL WGEPLS DFSPQEGDLQ NNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240
           LEKTLLDLT+C+SPPVILMAYKKRRKADK FFNKIKRNFDVLEI +F KFDYYLKQ+THL
Sbjct: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240

Query: 241 FQLVRK 246
           FQL+RK
Sbjct: 241 FQLIRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  401 bits (1030), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 196/246 (79%), Positives = 214/246 (86%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ IFGGF DLVVPR KEH GQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLV 120
           ILEKS DHLLS+TV+  + F KVLE               EKN FHD TKVYVTDID+L+
Sbjct: 61  ILEKSVDHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLI 120

Query: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180
           PL++RNIELD+VQYEVLARELWWGEPLS DFSPQEG +Q NNVDLVLAADCVYLE+AFPL
Sbjct: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180

Query: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240
           LEKTLLDLT+CI+PPVILMAYKKRRKADK FFNKIKRNFDVLEI DF KF++YLK++THL
Sbjct: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240

Query: 241 FQLVRK 246
           FQL+RK
Sbjct: 241 FQLIRK 246

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  307 bits (787), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 159/250 (63%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MDGIFG FE LVVPR  EH G +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-DDHLLSETVHE-KRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDR 118
           ILEKS  + LL++  H+ +R F  VLE               EKN+FH N  V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGD--LQVNNVDLVLAADCVYLEK 176
           LVPLM+RNIEL+ V  EV+A  LWWGEPL   F+P   D   + N VDL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQ 236
           AFPLLE+TLLDLT   +PPVILM+Y+KRRKADK FFNKIK+NFDV+E+KDF K++ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 KTHLFQLVRK 246
           +THLFQL R+
Sbjct: 241 RTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  307 bits (787), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 159/250 (63%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MDGIFG FE LVVPR  EH G +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-DDHLLSETVHE-KRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDR 118
           ILEKS  + LL++  H+ +R F  VLE               EKN+FH N  V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGD--LQVNNVDLVLAADCVYLEK 176
           LVPLM+RNIEL+ V  EV+A  LWWGEPL   F+P   D   + N VDL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQ 236
           AFPLLE+TLLDLT   +PPVILM+Y+KRRKADK FFNKIK+NFDV+E+KDF K++ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 KTHLFQLVRK 246
           +THLFQL R+
Sbjct: 241 RTHLFQLARR 250

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  299 bits (766), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 183/249 (73%), Gaps = 3/249 (1%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ IFG F DLVV R  EH G  D+SFGG+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 61  ILEKSD--DHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDR 118
           I+EKSD  D L +    + + F  ++E               EK  FH   KV +TDID+
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQ-EGDLQVNNVDLVLAADCVYLEKA 177
           LVPLM++NIEL+ V  E++A ELWWGEPLSG F+P  EG  +V +VDL+LAADCVYLEKA
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180

Query: 178 FPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQK 237
           FPLLEKTLLDLTNC  PPVILMAY+KRR ADK+FF KI ++F V EI DF  +D YLKQ+
Sbjct: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240

Query: 238 THLFQLVRK 246
           THLF+L+R 
Sbjct: 241 THLFELIRN 249

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 186/255 (72%), Gaps = 9/255 (3%)

Query: 1   MDGIFG-GFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           MD IFG GF+DLVV R  EH G +DLSFGG+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 60  YILEKSD-DHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDR 118
           +ILEKS+ D LL+      + F K++E               EKN FH +   Y+TDID+
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDL-------QVNNVDLVLAADC 171
           +VPLM++NI+L+ ++ EV A ELWWGEPL   F+P E          +   VDL+LAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 172 VYLEKAFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFD 231
           VYLEKAFPLLEKTLLDLT   +PP ILMAY+KRRKADK FF KIK+NFD++EIKDF K++
Sbjct: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240

Query: 232 YYLKQKTHLFQLVRK 246
           YYLKQ+THLFQL+R+
Sbjct: 241 YYLKQRTHLFQLIRQ 255

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  280 bits (715), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 177/243 (72%), Gaps = 7/243 (2%)

Query: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSDD 67
           F DLV  R  EH G +DLSFGGKL P LKI EDGGESGCGGKVWIAGELLCE++LEKSD 
Sbjct: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70

Query: 68  H-LLSETVHEKR---PFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLVPLM 123
             L S+   + R   P  K++E                K     +  +YVTDID+LV LM
Sbjct: 71  QGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLM 130

Query: 124 ERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEK 183
           +RNI+L+++++ V  +ELWWGEPL  +F+P   + +   VDL+LAADCVYLEKAFPLLE 
Sbjct: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQR--QVDLILAADCVYLEKAFPLLEV 187

Query: 184 TLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQL 243
           TLLDLT+C  PP+ILM+YKKRRKADK FF +IK+NFDVLEI +F +FD+YLKQKTHLFQL
Sbjct: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247

Query: 244 VRK 246
           VRK
Sbjct: 248 VRK 250

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  278 bits (710), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 176/243 (72%), Gaps = 3/243 (1%)

Query: 7   GFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS- 65
           GF DL+  R  EH GQ+DL+F G L+P LKI EDGGESGCGGKVWIAGELLCE+ILEKS 
Sbjct: 6   GFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSR 65

Query: 66  DDHLLSETVHEKR-PFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLVPLME 124
           D  LL + +++    F  VLE                K +     K Y+TDID+LVPLME
Sbjct: 66  DGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLME 125

Query: 125 RNIELDKVQYEVLARELWWGEPLSGDFSP-QEGDLQVNNVDLVLAADCVYLEKAFPLLEK 183
           +N+EL+ +  +V A+EL WGE L  +F+P + G    +++DLVLAADCVYLEKAFPLLEK
Sbjct: 126 KNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEK 185

Query: 184 TLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQL 243
           TLLDLT C +PPVILMAY+KRRKADK FF KI++NF+V+ I DF  +D YLKQ+THLFQL
Sbjct: 186 TLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQL 245

Query: 244 VRK 246
           VRK
Sbjct: 246 VRK 248

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  264 bits (675), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 171/249 (68%), Gaps = 7/249 (2%)

Query: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ +FG +  L+  R  EH G  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 61  ILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLV 120
           ++EKSD    SE +        +LE               EK +FH + KV +TDI  LV
Sbjct: 61  LIEKSD----SENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLV 116

Query: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQ---VNNVDLVLAADCVYLEKA 177
           PLMERNI L+K+    +A+EL WG+ L  ++     D     V+NVDLV+AADCVY EKA
Sbjct: 117 PLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKA 176

Query: 178 FPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQK 237
           FPLLEK LLDLTNC +PP+ILMAY+KRRKADK+FF +I++NFDV+EI DF   + Y+KQ+
Sbjct: 177 FPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQR 236

Query: 238 THLFQLVRK 246
           THLF+L RK
Sbjct: 237 THLFELKRK 245

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  259 bits (662), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 135/242 (55%), Positives = 170/242 (70%), Gaps = 8/242 (3%)

Query: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSDD 67
           F DLV  R  EHFG +DL+FGG++ PALKI EDGGESGCGGK+WIAGELLCEY+LE SDD
Sbjct: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70

Query: 68  H-LLSETVH---EKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLVPLM 123
           + +LS+ ++     +PF+ +LE                +     N KV++TDID+LV LM
Sbjct: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQLVRLM 129

Query: 124 ERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEK 183
           E N+EL+ +   V A +LWWGEPL  +F P   D   N  DLVLAADCVYLE AFPLLEK
Sbjct: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP---DAISNKTDLVLAADCVYLETAFPLLEK 186

Query: 184 TLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQL 243
           TLLDLT   +PPV+LM+Y+KRRKAD+ FF  I++NF V+ I  F + D +LKQ+THLFQL
Sbjct: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246

Query: 244 VR 245
           +R
Sbjct: 247 IR 248

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  254 bits (650), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 169/243 (69%), Gaps = 10/243 (4%)

Query: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSDD 67
           F DLV  R  EH G +DLSFGG++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE SD 
Sbjct: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70

Query: 68  H-LLSETVHE---KRPFMKVLEXXXXXXXXXXXXXXXEKNKFH-DNTKVYVTDIDRLVPL 122
             +LS+ + E   K PF+ +LE                +   H D TKVY+TDIDRLV L
Sbjct: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ--LHGDRTKVYITDIDRLVGL 128

Query: 123 MERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLE 182
           ME N+ L+ +   V    L WGEPL   F P   D + + VDLVLAADCVYLE AFPLLE
Sbjct: 129 METNVNLNHLAETVSVEILSWGEPLKEKFGP---DAKADKVDLVLAADCVYLETAFPLLE 185

Query: 183 KTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQ 242
           KTLLDLT   +PP +LM+Y+KRRKADK FF  I++NF ++ I +FI++DYYLK++THLFQ
Sbjct: 186 KTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQ 245

Query: 243 LVR 245
           LVR
Sbjct: 246 LVR 248

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  242 bits (617), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 138/247 (55%), Positives = 172/247 (69%), Gaps = 8/247 (3%)

Query: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-D 66
           FEDLV PR  EH GQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+ILEKS D
Sbjct: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68

Query: 67  DHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLVPLMERN 126
             +LS+    +R F  ++E                K     +T VY+TDI+ L PLM++N
Sbjct: 69  GRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKN 128

Query: 127 IELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLL 186
           +EL+ +   V  R L+WGEPLS +F+ Q        +DLVLAADCVYLEKAFPLLEKTLL
Sbjct: 129 VELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPLLEKTLL 181

Query: 187 DLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQLVRK 246
           DLT   S P++LM+YKKRRKADK+FF KIK+ FD++EIKDF  ++ Y +Q+T+LFQLVRK
Sbjct: 182 DLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQLVRK 241

Query: 247 CSSHSEA 253
            +    A
Sbjct: 242 PARAPHA 248

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  235 bits (599), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 130/251 (51%), Positives = 169/251 (67%), Gaps = 8/251 (3%)

Query: 1   MDGIFGG-FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           M  +F   FE+LV     EH G +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 60  YILEKSDD-HLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDR 118
           ++LEKS D  LLS+ V   + F KVLE                     ++  VY+TDID 
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120

Query: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAF 178
           L PLM RN+ ++ ++  V  REL+WG+ L  +F  ++     + VDL+LAADCVYLEKAF
Sbjct: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD-----SPVDLILAADCVYLEKAF 175

Query: 179 PLLEKTLLDLT-NCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQK 237
           PLLE  LL+LT N    PV+LM+Y+KRRKADK+FF KIK++F + E+ DF ++D Y+KQ+
Sbjct: 176 PLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQR 235

Query: 238 THLFQLVRKCS 248
           TH+FQLVR+ S
Sbjct: 236 THIFQLVRRSS 246

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  226 bits (575), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 166/240 (69%), Gaps = 9/240 (3%)

Query: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSD- 66
           FE+LV  R  EH G+ D+SF GKL   L I EDGGESGCGGKVWIAGELLCEYILEKSD 
Sbjct: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93

Query: 67  DHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFHDNTKVYVTDIDRLVPLMERN 126
           +HLLS    +      VLE               ++   + + +VY++DID+L+ LME N
Sbjct: 94  EHLLSHLFPDGN-CNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESN 152

Query: 127 IELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLL 186
           I+++ +  +V A  LWWG PL   F  +        VDLVLAADCVYLE AFPLLEKTLL
Sbjct: 153 IQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLEKTLL 205

Query: 187 DLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQLVRK 246
           +LT+  + P+ILMAYKKRRKADK FF KIK+NF ++EI+DFI FD YLKQ+THLFQL+R+
Sbjct: 206 ELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 70/187 (37%), Gaps = 31/187 (16%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXX 100
            G+S  G + W     L ++++   + +L+ +T         V+E               
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLINNCEKYLIEKT--------DVIELGAGTGLVSLCILEN 187

Query: 101 EKNKFHDNTKVYVTDIDR--LVPLMERNIELDKVQYE---VLARELWWGEPLSGDFSPQE 155
           +  K     KVYVTD D   +  ++ +N EL+ V  E   V+ R+LWW +P         
Sbjct: 188 DLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIAGEDN 247

Query: 156 GDLQVNNVDLVLAADCVYLEKAFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKI 215
           G      + LV+ AD  Y     P       DL  C      L  +  + +  K   +  
Sbjct: 248 G-----KIGLVVGADITYDNSVIP-------DLCAC------LKQFMDKNRDCKAIISAT 289

Query: 216 KRNFDVL 222
            RN D +
Sbjct: 290 VRNIDTI 296

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 21/123 (17%)

Query: 110 KVYVTDID-RLVPL-MERNIELDKVQYE----VLARELWWGEPLSGDFSPQEGDLQVNNV 163
           ++YVTD D  LV   ++RN EL+    E    V  + LWWG            D   +++
Sbjct: 192 RMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWG-----------SDRIPDDI 240

Query: 164 DLVLAADCVYLEKAFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFF----NKIKRNF 219
           DLV+AAD  Y    FP L + L +        + L++   R ++  + F    NKI  N+
Sbjct: 241 DLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLFAQECNKIGLNY 300

Query: 220 DVL 222
            V+
Sbjct: 301 TVV 303

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 22/112 (19%)

Query: 109 TKVYVTDIDR--LVPLMERNIELDKVQYE----VLARELWWGEPLSGDFSPQEGDLQVNN 162
           +K+YVTD D   +   + RN EL+    E    +  + LWWG     D  P E       
Sbjct: 191 SKMYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWG----SDRVPDE------- 239

Query: 163 VDLVLAADCVYLEKAFPLLEKTL---LDLTNCISPPVILMAYKKRRKADKQF 211
           V+LV+AAD  Y    FP L + L   L +++C     +L A  +    DK+F
Sbjct: 240 VNLVVAADVTYDSTIFPELCQCLAECLAMSHC--KVCLLSATIRSYSTDKEF 289

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 5/128 (3%)

Query: 47  GGKVWIAGELLCEYILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKFH 106
           G K W +  +L + ++++     +    +     +KVLE                K  + 
Sbjct: 219 GWKTWGSSLILSQLVVDRLHTADMDFVANRGTKRIKVLELGSGTGLVGLSWASKWKELYG 278

Query: 107 -DNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDL 165
            DNT+++VTD+  +V  +++N+ L+ +Q  V A  L W  P S  F  + G    N  D+
Sbjct: 279 IDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNPQS--FIDRFG--YENEFDI 334

Query: 166 VLAADCVY 173
           +L AD +Y
Sbjct: 335 ILIADPIY 342

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 10/82 (12%)

Query: 110 KVYVTDIDRLVPLMERNIELDKVQYE----VLARELWWGEPLSGDFSPQEGDLQVNNVDL 165
           ++Y+TD+  +VP +++N+E++ +  +    V A  L W  P+S  F+ + GD   +  D+
Sbjct: 280 EMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVS--FTEKYGD---DKFDV 334

Query: 166 VLAADCVYLEKAFPLLEKTLLD 187
           +L AD +Y     P+   T++D
Sbjct: 335 ILIADPIY-SPQHPVWVVTMID 355

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 108 NTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVL 167
           N ++Y+TD+  +V  +++N++L+K+++ V+A  L W  P   +F  +    Q  + DL+L
Sbjct: 284 NLQIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTNPY--NFIERYNGEQ--SFDLIL 339

Query: 168 AADCVY 173
            AD +Y
Sbjct: 340 VADPIY 345

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 107 DNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLV 166
           D  ++Y+TD+  +V  +E+NI ++++   V++  L W  P S  F    GD +    D++
Sbjct: 250 DEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNPES--FVSNYGDTR---FDVL 304

Query: 167 LAADCVYLEK 176
           L +D +Y  K
Sbjct: 305 LISDPIYSSK 314

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 71/182 (39%), Gaps = 26/182 (14%)

Query: 41  GGESGCGGKVWIAGELLCEYILEK--SDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXX 98
              S  G + W A   + ++++ K   +  L  E   E +  + VLE             
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKKLNVLEIGAGTGIVSLVLS 186

Query: 99  XXEKNKFHDNTKVYVTDIDRLVPLMER----NIELDKVQYE----VLARELWWGEPLSGD 150
              +N  +   K+YVTD D    L+ER    N EL+    E    +  + LWWG      
Sbjct: 187 QNYRNFVN---KMYVTDGDS--DLVERQLKKNFELNDALSEHKPDIRFQRLWWG------ 235

Query: 151 FSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQ 210
                 D   +++DLV+ AD  Y    FP L K L +        + L++   R ++  +
Sbjct: 236 -----SDKVPDDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDK 290

Query: 211 FF 212
            F
Sbjct: 291 LF 292

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 107 DNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLV 166
           D  +++VTD+  +V  +++N+ L+ +Q  V A  L W  P   DF  + G    N  D++
Sbjct: 280 DKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNP--QDFIDRFG--HENEFDII 335

Query: 167 LAADCVY 173
           L AD +Y
Sbjct: 336 LVADPIY 342

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 107 DNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLV 166
           D   V+VTD+  +VP +  N+ L+ +   V A  L W +P S  F  + G+LQ    D +
Sbjct: 252 DADDVFVTDLPEIVPNLRHNLALNNLT-NVRASVLDWSDPTS--FLHEHGELQ---FDAI 305

Query: 167 LAADCVYLEKAFPLLEKTL 185
             AD +Y      LL +T+
Sbjct: 306 FVADPIYSPNHPQLLVQTV 324

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 90/211 (42%), Gaps = 29/211 (13%)

Query: 47  GGKVWIAGELLCEYILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKNKF- 105
           G K W A      +IL +   ++L+E+    +P  +VLE                  K+ 
Sbjct: 214 GWKTWGAS-----FILSQKLINVLAESTFNFKP--RVLELGSGTGLAGISWLCKWVQKYG 266

Query: 106 HDNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDL 165
           + +T++++TD+  +V  +++N+E++KV+       L W +P   DF     D   +  D+
Sbjct: 267 NGHTEIFLTDLPVIVANLQKNVEVNKVESFATVSALDWTDP--TDFINSYTD---DEFDI 321

Query: 166 VLAADCVYL----EKAFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQF-----FNKIK 216
           ++ +D +Y     E    +++K L     C     +   Y   RK  +Q      F  IK
Sbjct: 322 LIVSDPIYSPNHPELVVNMIKKFLSSQGQCYLEIPLRPRYAAERKRLRQLLSDNGFKIIK 381

Query: 217 RNFDVLEIKDFIKFDYYLKQKTHLFQLVRKC 247
              D   ++D+   DY         ++V+KC
Sbjct: 382 EEVD-QGMEDWGMVDYL------FLEIVKKC 405

>KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.259
           YIL110W
          Length = 375

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 14/86 (16%)

Query: 122 LMERNIELDKVQYEVLARELWWGEPLSG---DFSPQ-EGDLQVNNVDLVLAADCVYLEKA 177
           L ER++ LD V          WG   +       PQ EG        LVL ++ +Y  + 
Sbjct: 260 LAERHVTLDFVSGS-------WGRKFTDIVHSLLPQCEG---TTAASLVLTSETIYQPEN 309

Query: 178 FPLLEKTLLDLTNCISPPVILMAYKK 203
            PL+ +TLLDL   I  P  ++   K
Sbjct: 310 LPLITETLLDLKGYIGGPTTVLVAAK 335

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 60/131 (45%), Gaps = 16/131 (12%)

Query: 47  GGKVWIAGELLCEYI---LEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXXEKN 103
           G K W A  +L + +   LEK+ D    + +H     ++VLE                + 
Sbjct: 221 GWKTWGASLILSQKVVNLLEKNKDQ---KHIHP----LRVLELGSGTGLVGIAWASKWRQ 273

Query: 104 KF-HDNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNN 162
            F  +N +++VTD+  +V  +++N++ + +   V A  L W  P   DF  + GD     
Sbjct: 274 SFGTENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTNP--DDFIEKHGD---EK 328

Query: 163 VDLVLAADCVY 173
            D++L AD +Y
Sbjct: 329 FDVILVADPIY 339

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 18/118 (15%)

Query: 104 KFHD-NTKVYVTDIDR--LVPLMERNIELDKVQYE----VLARELWWGEPLSGDFSPQEG 156
           K+H+   K+YVTD D   +   ++RN EL+    E    +  + LWWG     D  P+  
Sbjct: 187 KYHEFVNKMYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWG----SDRVPE-- 240

Query: 157 DLQVNNVDLVLAADCVYLEKAFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNK 214
                ++DLV+ AD  Y     P L + L +        + L++   R ++  Q F++
Sbjct: 241 -----DIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRSESTVQLFSQ 293

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 107 DNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLV 166
           +N +++VTD+  +V  +++N+ L+ +   V A  L W  P   DF  + G    N  D++
Sbjct: 282 ENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNP--HDFIDKFG--HENEFDVI 337

Query: 167 LAADCVY 173
           L AD +Y
Sbjct: 338 LIADPIY 344

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 62/168 (36%), Gaps = 46/168 (27%)

Query: 37  ICEDGGESGCGGKVWIAGELLCEYILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXX 96
           +C  G     G + W A   L EY+++  +        + +  F ++LE           
Sbjct: 127 LCASGT---TGFRTWEAALYLAEYLVQNQE-------YYAQDRFSRILELGAGTGLVSLV 176

Query: 97  XXXXEKNKFHDNTKVYVTDIDRLV--PLMERNIELDKV----------QYEVLARELWWG 144
                +    +   +YVTD D  +    +  N +L+ V          QY+   + LWWG
Sbjct: 177 WSQLFQATMKE---LYVTDGDSTLVEQAIRYNFQLNNVTAAPANTLDCQYKF--QRLWWG 231

Query: 145 EPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLLDLTNCI 192
           E +            V +VD+VLAAD  Y     P        L NCI
Sbjct: 232 EDV------------VPDVDIVLAADVTYDASVVP-------SLVNCI 260

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 108 NTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVL 167
           N ++YVTD+  +V  +++N+ L+ ++  V A  L W  P   +F  Q G     + D++L
Sbjct: 280 NIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNP--QNFINQFG--HEMDFDIIL 335

Query: 168 AADCVY 173
            AD +Y
Sbjct: 336 VADPIY 341

>Kwal_27.12267 s27 complement(1154465..1155133) [669 bp, 222 aa]
           {ON} YPL107W - Hypothetical ORF [contig 22] FULL
          Length = 222

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 149 GDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLLDLTNCISPPVILMAYKKRRKAD 208
            DF+P  G L + NV   L A  + L+K       +L        P  +L A KKRRKA+
Sbjct: 122 ADFNPPLGSLDIQNVPSQLKAAKIKLDKLKSKGTASLFPPRTGKLPQSVLDA-KKRRKAE 180

Query: 209 KQFFN 213
            Q  N
Sbjct: 181 NQRVN 185

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 58/134 (43%), Gaps = 17/134 (12%)

Query: 45  GCGGKVW----IAGELLCEYILEKSDDHLLSETVHEKRPFMKVLEXXXXXXXXXXXXXXX 100
             G K W    I GE++  Y+        LS T    R  ++ LE               
Sbjct: 209 NLGWKTWGSSLILGEIVVSYL------ENLSSTFESNRK-VRTLELGAGTGLVGIAWAAK 261

Query: 101 EKNKF-HDNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQ 159
            ++KF +  T++Y+TD+  +V  ++ N++++ +Q    A  L W  P    F+ + G+  
Sbjct: 262 WRDKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTNP--DTFTEKYGN-- 317

Query: 160 VNNVDLVLAADCVY 173
               D ++ AD +Y
Sbjct: 318 -ERFDYIVIADPIY 330

>TPHA0A04790 Chr1 complement(1085793..1086764) [972 bp, 323 aa] {ON}
           Anc_5.141 YGR144W
          Length = 323

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 33  PALKICEDGGESGCGGKVWIAGELLCEYILEKSDDHLLSE 72
           P LKI        CGG  W++G+L    ++ K  D  L E
Sbjct: 86  PDLKIVLVESALACGGGGWVSGQLFSAMVMRKPTDLFLKE 125

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 19/116 (16%)

Query: 104 KFHDN-TKVYVTDIDR--LVPLMERNIELDKVQYE--VLARELWWGEPLSGDFSPQEGDL 158
           K+ D  T +Y+TD D   L   + RN+ L+ +     V  ++L W E    D  P     
Sbjct: 187 KYKDQITTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNE----DHIP----- 237

Query: 159 QVNNVDLVLAADCVYLEKAFPLLEKTLLDL---TNCISPPVILMAYKKRRKADKQF 211
             +N+DL++AAD  Y     P L   +LD    +N  S    L A ++ ++    F
Sbjct: 238 --DNLDLIVAADVTYDSSVIPSLCHCILDCFKSSNKCSTVCYLAATRRNQETIAVF 291

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 108 NTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLS--GDFSPQEGDLQVNNVDL 165
           NT++ +TD+  +V  ++RNI ++ +     A  L W  P S   ++S ++        D+
Sbjct: 298 NTEIILTDLPEIVGNLQRNISINNLNDIARASVLDWTNPKSFIQEYSNEK-------FDI 350

Query: 166 VLAADCVYLEK 176
           +L AD +Y  K
Sbjct: 351 ILVADPIYSPK 361

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 106 HDN--TKVYVTDIDRLVPLMERNIELD--KVQYEVLARELWWGEPLSGDFSPQEGDLQVN 161
           H N  ++V++TD+  +VP +  N +L+       V+A  L W       F  + GD+Q  
Sbjct: 255 HSNEFSQVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADVLDWTN--HDSFVEKYGDIQ-- 310

Query: 162 NVDLVLAADCVY 173
             D++L AD +Y
Sbjct: 311 -FDIILIADPIY 321

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 9/68 (13%)

Query: 110 KVYVTDIDRLVPLMERNIELDKV----QYEVLARELWWGEPLSGDFSPQEGDLQVNNVDL 165
           +V++TD+  +VP +++N++L+K       EV    L W +P S  F  + G       D+
Sbjct: 278 RVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLDWTDPSS--FQEKYG---YKKFDV 332

Query: 166 VLAADCVY 173
           +L AD +Y
Sbjct: 333 LLIADPIY 340

>NDAI0C02860 Chr3 complement(659616..660578) [963 bp, 320 aa] {ON}
           Anc_5.141 YGR144W
          Length = 320

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%)

Query: 33  PALKICEDGGESGCGGKVWIAGELLCEYILEKSDDHLLSE 72
           P LKI         GG  W++G+LL   +L K  D LL E
Sbjct: 84  PDLKIAIIEQNLAPGGGCWVSGQLLSAMVLRKPADLLLKE 123

>KNAG0I01620 Chr9 complement(315050..317125) [2076 bp, 691 aa] {ON}
           Anc_1.364 YOL023W
          Length = 691

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 9/91 (9%)

Query: 111 VYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAAD 170
           V +T ID+   L ERN  ++KV  +++A+ +              GD+QV  +      +
Sbjct: 267 VAITKIDKFPRLEERNKRIEKVTNDLMAQGIM--------VEKMGGDVQVIPISAKSGEN 318

Query: 171 CVYLEKAFPLLEKTLLDLTNCISPPVILMAY 201
              LE++  LL   ++D+ + ISP  + + +
Sbjct: 319 MENLEESIILLSD-IMDIRSEISPKTMSLGW 348

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.141    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,322,546
Number of extensions: 1154332
Number of successful extensions: 2756
Number of sequences better than 10.0: 49
Number of HSP's gapped: 2792
Number of HSP's successfully gapped: 49
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)