Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_14.2192.152ON61761728600.0
YNL121C (TOM70)2.152ON61761727230.0
Skud_14.2112.152ON61761727190.0
Smik_14.2072.152ON61761726830.0
Kpol_1048.212.152ON59754618970.0
ZYRO0G06512g2.152ON60454418550.0
KLTH0B05170g2.152ON59354618530.0
SAKL0E10956g2.152ON60054418430.0
TDEL0B051402.152ON59954618410.0
TPHA0I015102.152ON60354518300.0
Kwal_33.147672.152ON59454618140.0
NCAS0G024802.152ON59654217970.0
TBLA0C055302.152ON61054517770.0
ABR131W2.152ON59454417280.0
Ecym_82042.152ON59754417220.0
KLLA0F24046g2.152ON60454417160.0
NDAI0F028102.152ON60954716900.0
CAGL0L12936g2.152ON60053516560.0
NCAS0B070102.152ON62554416450.0
KNAG0H035302.152ON61455416320.0
KAFR0F007202.152ON60854416150.0
CAGL0L04048g2.152ON58753715390.0
Skud_8.1782.152ON63855614480.0
YHR117W (TOM71)2.152ON63955514450.0
Smik_8.1952.152ON63555014420.0
Suva_15.3142.152ON64455614330.0
NDAI0B043402.152ON66455513770.0
TBLA0E033005.617ON582851493e-09
NCAS0G008105.617ON5841251493e-09
NDAI0B057903.481ON5231441448e-09
AEL224W5.617ON580851449e-09
KLLA0A07062g5.617ON581861422e-08
ACR005W6.21ON3271201392e-08
Kwal_55.199355.617ON593861403e-08
Kpol_1032.86.21ON3431081383e-08
Suva_8.805.617ON586851394e-08
SAKL0G07084g5.617ON585851394e-08
YOR027W (STI1)5.617ON589851394e-08
Skud_15.1925.617ON5891241385e-08
CAGL0H08195g5.617ON583851385e-08
KNAG0B032005.617ON579851386e-08
KLTH0F14542g3.481ON5131031341e-07
Smik_15.2055.617ON589851332e-07
Kpol_1018.695.617ON590851305e-07
TPHA0D028805.617ON585851297e-07
NDAI0F009105.617ON583851271e-06
Kwal_55.211753.481ON5111031242e-06
TDEL0A048405.617ON576851233e-06
Ecym_30256.21ON3181251213e-06
Ecym_44133.481ON510951215e-06
KNAG0A079003.481ON5121321206e-06
TPHA0J003406.21ON3381111162e-05
SAKL0E01210g6.21ON3231151152e-05
KLTH0E02178g5.617ON593971172e-05
AAR083C3.481ON5381941162e-05
ZYRO0A05676g5.617ON572861162e-05
KAFR0C058905.617ON575851162e-05
KLLA0D01155g6.21ON335681142e-05
CAGL0D05060g3.481ON5101021153e-05
Ecym_55825.617ON584851143e-05
NCAS0A112003.367ON9071131136e-05
NDAI0I022406.21ON350881117e-05
SAKL0F03102g3.481ON5131431101e-04
TPHA0D032203.481ON5131021101e-04
Kpol_505.413.481ON5131051091e-04
Kpol_1037.266.21ON3421061072e-04
NCAS0H008306.21ON3381371063e-04
NCAS0F034903.481ON512971073e-04
Kwal_27.118908.506ON3341261053e-04
KAFR0L004106.21ON3311071054e-04
Kpol_1006.43.367ON7321131064e-04
KAFR0B066103.481ON511971064e-04
TDEL0G044806.21ON3431171044e-04
KLLA0B09966g8.506ON370981054e-04
TBLA0C039503.481ON5121111055e-04
TBLA0A072706.21ON3731031045e-04
NDAI0D008106.21ON3491011035e-04
ZYRO0F08624g8.506ON3791411037e-04
KLLA0B10912g3.481ON512951038e-04
KNAG0M011706.21ON3391081029e-04
KNAG0H006103.367ON9731271030.001
TDEL0E027505.352ON5641281010.001
KAFR0H008703.367ON887901000.002
KNAG0B022407.412ON739184990.002
Kpol_1018.1067.412ON753168990.003
Kpol_513.28.506ON37497970.004
NCAS0D026706.21ON351180960.004
TPHA0D038606.328ON12071900.004
Suva_7.4083.481ON51395960.005
CAGL0E02739g6.21ON34381950.005
KAFR0L018707.412ON712165960.006
KNAG0I025206.328ON11790880.007
Ecym_20906.328ON17259900.009
NCAS0A00490singletonON62086940.009
Kwal_56.224336.21ON322108930.011
Suva_15.1826.21ON346108920.011
YGR123C (PPT1)3.481ON513103930.012
Smik_2.367.412ON751168930.013
CAGL0C01903g7.412ON769168930.013
SAKL0H10934g8.506ON380202920.014
YBL084C (CDC27)7.412ON758168930.015
TBLA0G010506.21ON35084910.015
TDEL0B013108.506ON380126910.017
TPHA0E011105.352ON693125920.017
KNAG0F040107.546ON1418126920.019
Suva_2.347.412ON763168920.020
TBLA0H033808.506ON37587910.020
YLR072W8.14ON69393910.020
KAFR0C018505.352ON646122910.021
KLTH0E11748g8.506ON37897900.022
Smik_6.2153.481ON51395910.024
YBR112C (CYC8)3.367ON966111910.026
Skud_2.2828.506ON38587900.026
YBR155W (CNS1)8.506ON38587890.031
TBLA0I023106.328ON11661830.037
Smik_12.1328.14ON69693890.038
NCAS0F028705.352ON700125890.042
Skud_15.1686.21ON34865880.046
KLTH0C11220g6.21ON32789870.046
Smik_4.5795.352ON667162880.050
KAFR0J025706.328ON12137820.051
KAFR0E029808.506ON38097870.052
TBLA0H015203.367ON689169880.053
Smik_2.2958.506ON385175870.054
Smik_2.2543.367ON1020111880.060
ZYRO0B04224g3.481ON51395870.066
YOR007C (SGT2)6.21ON34665860.067
TPHA0E007407.412ON746168860.090
CAGL0H07425g8.506ON38098850.092
AGL268C8.506ON37987840.12
NCAS0E024907.412ON809214850.12
Smik_15.1766.21ON34565830.15
Skud_12.1378.14ON698102840.15
Skud_7.4323.481ON51391830.17
YCR060W (TAH1)6.328ON11170780.17
TBLA0D004607.412ON835116830.23
ZYRO0C07788g6.21ON334108820.23
NDAI0E040407.412ON78358820.25
Skud_2.247.412ON769168820.25
NCAS0B024008.506ON38097810.29
KNAG0C055005.352ON585125810.32
NDAI0I004406.328ON12867760.33
Suva_4.4058.506ON38583800.40
KLTH0E10934g8.470ON56892800.49
Suva_8.1295.689ON74135800.52
Suva_3.956.328ON11170740.53
KAFR0D023405.689ON69744790.57
TDEL0C027207.412ON700168790.61
YDR320C (SWA2)5.352ON668111790.64
SAKL0F16236g7.546ON140898790.64
Kpol_1028.516.328ON11763730.67
NCAS0C043503.5ON1087187790.73
TBLA0B049907.546ON1410131790.76
KNAG0A039508.506ON38697770.98
Suva_10.1568.14ON69381771.1
TPHA0G002407.546ON143094771.1
Kwal_27.107407.412ON628163771.1
SAKL0D03564g3.265ON908169771.2
NDAI0C043205.352ON706132771.2
Ecym_25598.506ON37087761.2
Kpol_339.135.352ON686176761.3
NDAI0G037103.5ON112197761.4
Skud_15.2455.689ON75035761.4
KLTH0C06204g7.412ON627168751.7
SAKL0A01672g6.328ON12862702.0
ACR168W2.665ON70776752.1
KAFR0B002507.546ON1420117752.1
CAGL0K09240g6.328ON14243712.2
Ecym_71427.412ON67569742.3
AGL294W7.412ON65669742.4
TDEL0D055703.489ON649126742.5
KLLA0E20857g7.412ON710254742.6
Kwal_27.117378.470ON57589742.6
Kpol_1050.1127.546ON136058742.7
AAR054C6.328ON13361693.0
Ecym_56372.665ON71776733.0
NDAI0G048701.456ON39469723.3
NDAI0C052908.506ON379100723.5
TDEL0A002403.5ON1059178733.9
Suva_2.4895.352ON659112724.1
TBLA0H019705.352ON840121724.2
ZYRO0B03828g7.412ON727120724.3
TDEL0D055003.481ON51263714.6
TPHA0L014208.506ON374118715.3
CAGL0A03630g1.88ON106273716.0
TPHA0L012108.470ON58878707.5
YOR080W (DIA2)5.689ON73235707.5
YOR132W (VPS17)5.466ON551113707.6
KLLA0C15455g8.470ON56692707.7
Kwal_26.72683.418ON87046707.7
CAGL0B01375g3.5ON1110182708.7
KLTH0F15202g5.466ON554145699.5
Skud_2.2403.367ON98497699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_14.219
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...  1106   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...  1053   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...  1051   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...  1038   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   735   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   719   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   718   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   714   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   713   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   709   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   703   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   696   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   689   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   670   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   667   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   665   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   655   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   642   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   638   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   633   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   626   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   597   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   562   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   561   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   560   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   556   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   535   0.0  
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    62   3e-09
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    62   3e-09
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    60   8e-09
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    60   9e-09
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    59   2e-08
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    58   2e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    59   3e-08
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    58   3e-08
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    58   4e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    58   4e-08
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    58   4e-08
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    58   5e-08
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    58   5e-08
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    58   6e-08
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    56   1e-07
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    56   2e-07
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    55   5e-07
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    54   7e-07
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     54   1e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    52   2e-06
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    52   3e-06
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    51   3e-06
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    51   5e-06
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    51   6e-06
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    49   2e-05
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    49   2e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    50   2e-05
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    49   2e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    49   2e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    49   2e-05
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    49   2e-05
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    49   3e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    49   3e-05
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    48   6e-05
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    47   7e-05
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    47   1e-04
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    47   1e-04
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    47   1e-04
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    46   2e-04
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    45   3e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    46   3e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    45   3e-04
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    45   4e-04
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    45   4e-04
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    45   4e-04
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    45   4e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    45   4e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    45   5e-04
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    45   5e-04
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    44   5e-04
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    44   7e-04
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    44   8e-04
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    44   9e-04
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    44   0.001
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    44   0.001
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    43   0.002
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    43   0.002
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    43   0.003
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    42   0.004
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    42   0.004
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    39   0.004
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    42   0.005
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    41   0.005
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    42   0.006
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    39   0.007
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    39   0.009
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       41   0.009
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    40   0.011
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    40   0.011
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    40   0.012
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    40   0.013
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    40   0.013
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    40   0.014
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    40   0.015
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    40   0.015
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    40   0.017
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    40   0.017
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    40   0.019
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    40   0.020
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    40   0.020
YLR072W Chr12 (278862..280943) [2082 bp, 693 aa] {ON} Protein of...    40   0.020
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    40   0.021
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    39   0.022
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    40   0.024
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    40   0.026
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.026
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    39   0.031
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.037
Smik_12.132 Chr12 (258696..260786) [2091 bp, 696 aa] {ON} YLR072...    39   0.038
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    39   0.042
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    39   0.046
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    38   0.046
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    39   0.050
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    36   0.051
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    38   0.052
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    39   0.053
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    38   0.054
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    39   0.060
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    38   0.066
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    38   0.067
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    38   0.090
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    37   0.092
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    37   0.12 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    37   0.12 
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    37   0.15 
Skud_12.137 Chr12 (263617..265713) [2097 bp, 698 aa] {ON} YLR072...    37   0.15 
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    37   0.17 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.17 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    37   0.23 
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    36   0.23 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    36   0.25 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    36   0.25 
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    36   0.29 
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    36   0.32 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    34   0.33 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.40 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    35   0.49 
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    35   0.52 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    33   0.53 
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    35   0.57 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    35   0.61 
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    35   0.64 
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    35   0.64 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.67 
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    35   0.73 
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    35   0.76 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    34   0.98 
Suva_10.156 Chr10 (280461..282542) [2082 bp, 693 aa] {ON} YLR072...    34   1.1  
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    34   1.1  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    34   1.1  
SAKL0D03564g Chr4 (287287..290013) [2727 bp, 908 aa] {ON} simila...    34   1.2  
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    34   1.2  
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    34   1.2  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    34   1.3  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    34   1.4  
Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080...    34   1.4  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    33   1.7  
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    32   2.0  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    33   2.1  
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    33   2.1  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    32   2.2  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    33   2.3  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    33   2.4  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...    33   2.5  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    33   2.6  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    33   2.6  
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    33   2.7  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    31   3.0  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    33   3.0  
NDAI0G04870 Chr7 complement(1173964..1175148) [1185 bp, 394 aa] ...    32   3.3  
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    32   3.5  
TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON...    33   3.9  
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    32   4.1  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    32   4.2  
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    32   4.3  
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    32   4.6  
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    32   5.3  
CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa] ...    32   6.0  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    32   7.5  
YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}  DIA2Origi...    32   7.5  
YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subu...    32   7.6  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    32   7.7  
Kwal_26.7268 s26 (288292..290904) [2613 bp, 870 aa] {ON} YPR104C...    32   7.7  
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    32   8.7  
KLTH0F15202g Chr6 complement(1247894..1249558) [1665 bp, 554 aa]...    31   9.5  
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    31   9.6  

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/617 (89%), Positives = 553/617 (89%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKETLSRDXXXXXXXXXXXXX 60
           MKSFISKNK                             GKKETLSRD             
Sbjct: 1   MKSFISKNKTAILATIAATGTAVGAYYYYTQLQQQQQQGKKETLSRDEKKEAKGSQKKSE 60

Query: 61  XXXXXXXXXXPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
                     PPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK
Sbjct: 61  GSKKSAGESKPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP 240

Query: 241 PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR 300
           PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR
Sbjct: 241 PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR 300

Query: 301 ADESFTKAVKLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLF 360
           ADESFTKAVKLFEDQL            LAISLEHTGIFKFLKNDPLGAHEDITKAIDLF
Sbjct: 301 ADESFTKAVKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540
           FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600
           SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600

Query: 601 ATKIQETLAKLREQGLM 617
           ATKIQETLAKLREQGLM
Sbjct: 601 ATKIQETLAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/617 (84%), Positives = 542/617 (87%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKETLSRDXXXXXXXXXXXXX 60
           MKSFI++NK                             GKK T+++D             
Sbjct: 1   MKSFITRNKTAILATVAATGTAIGAYYYYNQLQQQQQRGKKNTINKDEKKDTKDSQKETE 60

Query: 61  XXXXXXXXXXPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
                     PPIYPV++NGEPDFS KA+FTAEEKDKYALALKDKGNQ+FRNKKYDDAIK
Sbjct: 61  GAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP 240
            FADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS+LKEKFGDID ATATPTELSTQP
Sbjct: 181 KFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQP 240

Query: 241 PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR 300
            KERKDKQE+LPSVTSMASFFGIFKPELTFAN DESNEADKELMNGL+NLYKRSP+SYD+
Sbjct: 241 AKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDK 300

Query: 301 ADESFTKAVKLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLF 360
           ADESFTKA +LFE+QL            LAISLEHTGIFKFLKNDPLGAHEDI KAI+LF
Sbjct: 301 ADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKLD NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540
           FDKALKQYDLAIELENKL+GIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600

Query: 601 ATKIQETLAKLREQGLM 617
           A KIQETLAKLREQGLM
Sbjct: 601 AKKIQETLAKLREQGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/617 (84%), Positives = 544/617 (88%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKETLSRDXXXXXXXXXXXXX 60
           MKSFISKNK                             GKK+T+++D             
Sbjct: 1   MKSFISKNKTAILATIGATGAAVGAYYYYTQLQQQQQRGKKDTITKDEKKDVKGSQKKAE 60

Query: 61  XXXXXXXXXXPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
                      P+YPV++NGEPDFSKKA+FTAEEKDKYALALKDKGNQYFRNKKYDDAIK
Sbjct: 61  GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE+KPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGD+DAATATPTELSTQP
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP 240

Query: 241 PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR 300
           PKERKDKQE+LPS+TSMASFFGIFKPELTFAN DE N+ADKELM+GLANLYKRSP+SYDR
Sbjct: 241 PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR 300

Query: 301 ADESFTKAVKLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLF 360
           ADESFTKA KLFE+QL            LAISLEHTGIFKFLKNDPLGAHEDI KAI+LF
Sbjct: 301 ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKL+ NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540
           FDKALKQYDLAIELENKL+ IYVGIAPLVGKATLLTRNPTVENF+EATNLLEKASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQQ+IRSDP+L
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL 600

Query: 601 ATKIQETLAKLREQGLM 617
           A KIQETLAKLREQGLM
Sbjct: 601 AAKIQETLAKLREQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/617 (83%), Positives = 540/617 (87%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKETLSRDXXXXXXXXXXXXX 60
           MK+FISKNK                             GKK T+++D             
Sbjct: 1   MKNFISKNKTAILATIAATGTALGAYYYYSQLQQQQQQGKKNTITKDDKKEVKGSQKKTK 60

Query: 61  XXXXXXXXXXPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
                      P+YPV++NG+PDFS KA+FTAEEKD+YALALKDKGNQ+FRNKKYDDAIK
Sbjct: 61  DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELK+DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS+LKEKFGDID ATATPTELSTQ 
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA 240

Query: 241 PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR 300
           PKE KDK E+LPS+TSMASFFGIFKPELTFAN DESNEADK+LMNGL NLYKRSP+SYD+
Sbjct: 241 PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK 300

Query: 301 ADESFTKAVKLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLF 360
           ADESFTKAVKLF++QL            LAISLEHTGIFKFLKNDPLGAHEDI KAI+LF
Sbjct: 301 ADESFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKLD NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540
           F+KALKQYDLAIELENKL+GIYVGIAPLVGKATLLTRNPTVENFIEATNLLE+ASKLDPR
Sbjct: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQ+RIRSDP+L
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600

Query: 601 ATKIQETLAKLREQGLM 617
           A KIQETLAKLREQGLM
Sbjct: 601 AAKIQETLAKLREQGLM 617

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/546 (65%), Positives = 431/546 (78%), Gaps = 20/546 (3%)

Query: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P YP+ +NGEPD    A+FT E+K+ Y++ALKDKGNQ+F+ +KY+DA+KYYN+AL+LK+D
Sbjct: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN+SACYVS+G+L+KVVE STKALELKPDYSK LLRRASANE L NFA+AMFDLSV
Sbjct: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESL 251
           LSLNGDFN+ASIEPMLERNLNKQAM  LK+K                       D ++ L
Sbjct: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS--------------------SDAKQQL 231

Query: 252 PSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKL 311
           PS T +ASFFGIF PE T  N DESNEAD EL+N L NLYKR  +SY  ADESF+KA + 
Sbjct: 232 PSNTFLASFFGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAES 291

Query: 312 FEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMAL 371
           +  QL             A +LE+ GIFKFLKNDPLG+HEDI ++I+L PRVN+YIY AL
Sbjct: 292 YVKQLEANPDDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSAL 351

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+ +S  Y+++FDKAL +D N++ VYYHRGQM+F+ Q Y++A  DF+KAKE D  NI
Sbjct: 352 IMADKGESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNI 411

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACL Y E KFDDCETLFSEAKRKFP APEVPNF+AE+LTDK DFD A KQYD+A
Sbjct: 412 FPYIQLACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIA 471

Query: 492 IELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQM 551
             LE  L+ I+VG++PLVGKATLL R PTVEN +E+T LLE+A K+D RSEQAKIGLAQ+
Sbjct: 472 KRLEESLDAIHVGVSPLVGKATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQL 531

Query: 552 KLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKL 611
           KLQQE+IDEAI LFEE++DLAR MEEKLQA TFAEA+KVQ++IR+DPV+  KIQ TLA  
Sbjct: 532 KLQQEEIDEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAY 591

Query: 612 REQGLM 617
           REQGL+
Sbjct: 592 REQGLI 597

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/544 (65%), Positives = 426/544 (78%), Gaps = 20/544 (3%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YPV   GEP     A+ + E+K+ ++ ALKDKGN++F+ K YD+A+KYY++AL LK+DPV
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN+SACYVS+  L KVVE STKALELKPDYSK LLRRASANE L N+ DAMFDLSVLS
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253
           LNGDF  +SIEPMLERNLNKQAM+ LK+K G                    + K + LPS
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKLG--------------------QQKNQLLPS 240

Query: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313
            T++ASFFGIF PE  FAN DE++EAD++L  GL NLYKRS + Y +ADE F++AV  + 
Sbjct: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300

Query: 314 DQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373
                           AI+LEH GIF+FLKNDPLGAHED+ KAIDL PRVNSYIYMALIM
Sbjct: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360

Query: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EYY +FDKA+KLD  N++VYYHRGQM FI   Y++AG+DFDKAK+L+ ENIFP
Sbjct: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYRENKFDDCETLFSEAKRKF  APEVPNFFAEIL DK D +KALKQYD+A  
Sbjct: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480

Query: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE  ++GI+VGI+PLVGKATLL R P+VENFIEAT LLE+A   DPRSEQ K+GLAQ+KL
Sbjct: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540

Query: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613
           QQEDID+AI LFEE+A LART++EKLQA TFAEAAKVQ+RIR+DP+++ KI+ETLA  + 
Sbjct: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600

Query: 614 QGLM 617
           QG++
Sbjct: 601 QGVI 604

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/546 (64%), Positives = 429/546 (78%), Gaps = 20/546 (3%)

Query: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P YPV   GEPD S  A+ + E+KDKYA+ LKDKGN++F+NKKYD+AI+YY+WA+E+KED
Sbjct: 68  PSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKED 127

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN SACYVS+G  +KVVE +T AL+LKPDYSK LLRRASANE LGNFADAMFDLS 
Sbjct: 128 PVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSA 187

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESL 251
           +SL GDF+ ASIEP+LERN+NKQ+M  LKEK                      K ++  L
Sbjct: 188 VSLYGDFSGASIEPLLERNMNKQSMLVLKEKL--------------------EKQQEYKL 227

Query: 252 PSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKL 311
           PS TS+ASFFGIF+PE TF N D+++EADK L+ GL NLYKR+ D Y+ AD SF KA   
Sbjct: 228 PSNTSLASFFGIFQPETTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDA 287

Query: 312 FEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMAL 371
           F+  L             AI+LEH GIFKFLKNDP+ AHED+ KA++ FPR N+YIYMAL
Sbjct: 288 FKVLLEQNPEDADLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMAL 347

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+  +TEY++ F+KALKLD + ++VYYHRGQM FI Q ++QAGKDF+KAKEL   NI
Sbjct: 348 IMADKGQATEYFDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNI 407

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACL YRE KFDD ETLFSEA+RKFP APEVPNF+AE L+DK D   A KQYD+A
Sbjct: 408 FPYIQLACLTYREGKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIA 467

Query: 492 IELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQM 551
            +LE+ L+GI+VG++PL+GKATLL+R P+VENF+EAT L EKA + DPRSEQAKIGLAQ+
Sbjct: 468 AKLEDALDGIHVGVSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQL 527

Query: 552 KLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKL 611
           KLQQEDIDEAIALFEE+ADLAR+ +EKLQA TFAEA K+Q++IR+DPV++ KI+ETLA  
Sbjct: 528 KLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAY 587

Query: 612 REQGLM 617
           R QG++
Sbjct: 588 RAQGMI 593

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/544 (65%), Positives = 426/544 (78%), Gaps = 20/544 (3%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YPV  NGEP        T E+K+KYA+ LKDKGN++F+ KK+DDAIKYYN ALELK+DPV
Sbjct: 77  YPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDPV 136

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN SACYVS+G L+KVVE +T AL+LK DYSK LLRRASANE LGN+ADAMFDLS LS
Sbjct: 137 FYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSALS 196

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253
           L GDFN ASIEPMLERN+NKQAM  LKEK                   +E+KD +  LPS
Sbjct: 197 LYGDFNGASIEPMLERNMNKQAMLVLKEKL------------------EEKKDHR--LPS 236

Query: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313
            TS+ASFFGIF+PE +F N DES EAD+ L+ GL NLYKR+ + YD ADESFTKA   ++
Sbjct: 237 NTSLASFFGIFEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYK 296

Query: 314 DQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373
             L             AI+LEH GIFKFLKNDPL AH+D+ +A++  PRVNSYIY+ALIM
Sbjct: 297 TLLEESPENEILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIM 356

Query: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  +TEY+  FDKAL+LD N ++VYYHRGQM FI Q Y+ AGKDFDKAKE +  NIFP
Sbjct: 357 ADKGQATEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFP 416

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+AEIL+DK D   A KQY++A +
Sbjct: 417 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARK 476

Query: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE+ L+GI+VGIAPLVGKATLL R PTVENF+EAT   E+A + DPRSEQAKIGLAQ+KL
Sbjct: 477 LEDALDGIHVGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKL 536

Query: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613
           QQE++DEAI LFEE+ADLAR+ +EKLQA TFAEA K+Q++IR+DP+++ KI+ETLA  R 
Sbjct: 537 QQEEVDEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRA 596

Query: 614 QGLM 617
           QG++
Sbjct: 597 QGMI 600

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/546 (65%), Positives = 423/546 (77%), Gaps = 20/546 (3%)

Query: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P+YPV  NGEP      + + E ++ YA ALKD+GN++F+ K YD+A+KYYN+AL +K+D
Sbjct: 74  PVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKD 133

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN+SACYVS+G L KVVE STKALELKPDYSK LLRRASANE L N+ADAMFDLSV
Sbjct: 134 PVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSV 193

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESL 251
           LSLNGDFN +SIEPMLERNLNKQAM  LK+K G+                    +  + L
Sbjct: 194 LSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGN--------------------NVSQQL 233

Query: 252 PSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKL 311
           PS T++ASFFGIF PE TFAN +E++EAD  L NGL +LYKRS + Y  ADE+F K+   
Sbjct: 234 PSNTALASFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASF 293

Query: 312 FEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMAL 371
           F ++L             AI+LEH GIFKFLKNDPL AH+DI KAI L PR+NSYIYMAL
Sbjct: 294 FTNKLSEFPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMAL 353

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+  + EYY YFDKA+ LD N    YYHRGQM +I   Y++AGKDFDKAKE D  NI
Sbjct: 354 IMADKGQAEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNI 413

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACLAYRE+KFDDCETLFSEAKRKFP APEVPNF+AEIL DK D + ALKQY++A
Sbjct: 414 FPYIQLACLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIA 473

Query: 492 IELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQM 551
             LE  L+GI+VG+APLVGKATLL R P+VENF EAT LLE+A + DP SEQAK+GLAQ+
Sbjct: 474 KRLEEALDGIHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQL 533

Query: 552 KLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKL 611
           KLQQE++DEAI LFEE+A+LART++EKLQA TFAEAAKVQ+RI++DPV++ KI+ETLA  
Sbjct: 534 KLQQEEVDEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAY 593

Query: 612 REQGLM 617
           R QG+M
Sbjct: 594 RAQGMM 599

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/545 (64%), Positives = 429/545 (78%), Gaps = 20/545 (3%)

Query: 73  IYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP 132
           IYPVA+NGEPD S K  F+ E K+KYA+ALKDKGN YF+ + +++A+KYYN+AL LK+DP
Sbjct: 79  IYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTLKQDP 138

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACYVS+G L+KVVE ST+AL+LK DYSK LLRRASA E L N+ DAM DLSVL
Sbjct: 139 VFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVL 198

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLP 252
           SLNGDFN ASIEPMLERNLNKQAM  LKEK  +                    +K + LP
Sbjct: 199 SLNGDFNGASIEPMLERNLNKQAMQVLKEKIAE--------------------NKPQLLP 238

Query: 253 SVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLF 312
           S TS+ASFFG+FKPE++  N +E++E++KEL+NGL NLY R+ D Y  ADESF KAVKL 
Sbjct: 239 SNTSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLL 298

Query: 313 EDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALI 372
           E +              AI+LE+ GI KFLKNDPL AH DI KAI +FPRVNSYIY +LI
Sbjct: 299 EKEYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLI 358

Query: 373 MADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           +AD+ ++ E    FD A+ LD  N++ YYHRGQ+ F+ Q Y++AG DFDKAKELD  NI 
Sbjct: 359 LADKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNIL 418

Query: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492
           PYIQLACLAY+ENKF+DCETLFSEA+RKFP APEVPNF+A++L ++N+FDKALKQYD++ 
Sbjct: 419 PYIQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISK 478

Query: 493 ELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMK 552
           +LE  +EGI+VGIAP++GKATLL RNP VEN +E+T L E+A KLDPRSEQAKIGLAQ+K
Sbjct: 479 KLEEAVEGIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLK 538

Query: 553 LQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLR 612
           LQQE++DEAIALFEE+A LAR M+EKLQA TFAEA+KVQ+++RSDPV+  KIQETLA  +
Sbjct: 539 LQQEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQ 598

Query: 613 EQGLM 617
           +QGLM
Sbjct: 599 QQGLM 603

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/546 (62%), Positives = 429/546 (78%), Gaps = 20/546 (3%)

Query: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P +PV   GEPD  K  + +AEEKDK+A+ LKDKGN++F+NK+++DA+KYY+ A+E+KED
Sbjct: 69  PSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKED 128

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN SACYVS+G  +KVVE +T AL+LKPDYSK LLRRASANE LG FADAMFDLS 
Sbjct: 129 PVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSA 188

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESL 251
           +SL GDFN +SIEP+LERN+NKQAM  LKEK                      K ++  L
Sbjct: 189 VSLYGDFNGSSIEPLLERNMNKQAMLVLKEKL--------------------EKQQEYKL 228

Query: 252 PSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKL 311
           PS TS+ASFFGIF+PE +F N DE++EADK L++GL NLYKR+   Y+ AD +F+KA   
Sbjct: 229 PSNTSLASFFGIFQPETSFENYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDE 288

Query: 312 FEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMAL 371
           ++  L             AI+LEH GIFKFLKNDP+ AHED+ KA++ FPR N+YIYMAL
Sbjct: 289 YKTLLEHNSEDASLKQKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMAL 348

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+  +TEY++ F+KAL+LD N ++VYYHRGQM+FI Q ++QAGKDF+KAKEL+  NI
Sbjct: 349 IMADKGQATEYFDNFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNI 408

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACL YRE KF D ETLFSEA+RKFP +PEVPNF+AE L+DK D   A K+YD+A
Sbjct: 409 FPYIQLACLTYREGKFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIA 468

Query: 492 IELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQM 551
            +LE+ L+GI+VG++PL+GKATLL+R P+VENFIEAT L E+A + DPRSEQAKIGLAQ+
Sbjct: 469 AKLESALDGIHVGVSPLIGKATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQL 528

Query: 552 KLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKL 611
           KLQQEDIDEAIALFEE+ADLAR+ +EKLQA TFAEA K+Q++IR+DP+++ KI+ETLA  
Sbjct: 529 KLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAY 588

Query: 612 REQGLM 617
           R QG++
Sbjct: 589 RAQGMI 594

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/542 (63%), Positives = 420/542 (77%), Gaps = 19/542 (3%)

Query: 71  PPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE 130
           PPIYP+ ANGEP          + K+++A ALK+KGN  F+ K +++AIKYY +AL LKE
Sbjct: 67  PPIYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKE 126

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           DPV+YSN+SACY S+ + +KV+EM+TKAL L+PDYSKVL+RRA+A E LGNF DAMFDLS
Sbjct: 127 DPVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLS 186

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQES 250
           V SLN D +DASIEP+LERNLN+QAM  L  K G                     DK+  
Sbjct: 187 VCSLNTDMSDASIEPILERNLNQQAMFVLNTKLG-------------------VTDKKSQ 227

Query: 251 LPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVK 310
           LPS T++ SFFGIFKPEL+FAN D++ E DKEL+NGL NLY+ + + Y+ AD SFTKA +
Sbjct: 228 LPSNTALTSFFGIFKPELSFANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATE 287

Query: 311 LFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMA 370
            F  QL             AI+LEH GIFKFLKN+PL AHEDI KA++L PR+NSYIYMA
Sbjct: 288 YFLKQLSETPDDETVKEKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMA 347

Query: 371 LIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
           LI+AD+ D+  Y+  ++KA+KLD  N+++YYHRGQM FI Q Y++AG+DFDKAKELDPEN
Sbjct: 348 LILADKGDTDNYFANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPEN 407

Query: 431 IFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDL 490
           IFPYIQLACL+YRENKFDDCETLFSEA+RKFP + EVPNF+AEIL DK DFD ALK+Y+ 
Sbjct: 408 IFPYIQLACLSYRENKFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYER 467

Query: 491 AIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQ 550
           AIELE K + ++VGIAPLVGKATLL R PTVENF+EAT+LLE+A K DPRSEQAKI L Q
Sbjct: 468 AIELEKKQDAVHVGIAPLVGKATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQ 527

Query: 551 MKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAK 610
           +KLQQEDIDEAI LFE +A LART EEKLQA TFAEAAK+Q+RIR+DP ++ KIQET+A 
Sbjct: 528 LKLQQEDIDEAIELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAA 587

Query: 611 LR 612
           LR
Sbjct: 588 LR 589

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/545 (63%), Positives = 424/545 (77%), Gaps = 21/545 (3%)

Query: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           PIYPV  NGEP+   K  FT EEK+KY++ALKDKGN  F+  K+++AIKYYNWA+ELKE+
Sbjct: 84  PIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN 143

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           P+FYSNLSACYVS+  L+++++   KALELKPDYSKVLLRRA+ANE L N+ADAMFDLSV
Sbjct: 144 PIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSV 203

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESL 251
           LSLNGD+N ASIEP+LERNLNKQAMS LK+K                   K  KD Q  L
Sbjct: 204 LSLNGDYNGASIEPILERNLNKQAMSVLKDKL------------------KNSKDDQ--L 243

Query: 252 PSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKL 311
           PS TS+++FFGIFKPEL+F N DE+N+ADKEL+NGL +L+KR  +SY  AD+SF  A++L
Sbjct: 244 PSDTSLSAFFGIFKPELSFENYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALEL 303

Query: 312 FEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMAL 371
           +  QL             +I+ E+ GIF FLKND  GA E+I K+I L PR+NSYIY AL
Sbjct: 304 YIKQLEETPDDTDLKVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRAL 363

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           I+AD+ +S +Y +YFDKALKLD  + +VYYHR Q+NF+ Q++ +A  DF+KAKE DP NI
Sbjct: 364 IIADKGESQDYLDYFDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNI 423

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACL YRENKFDDCETLFSEAKRKFP  PEVPNF+AE+LTDK DFD A+K Y+ A
Sbjct: 424 FPYIQLACLTYRENKFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETA 483

Query: 492 IELEN-KLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQ 550
             LE    +GI+VG+APL+GKATLL R PT+EN   A  LLE+A+++DPRSEQAKIGLAQ
Sbjct: 484 RRLEEASKDGIHVGVAPLIGKATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQ 543

Query: 551 MKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAK 610
           +KLQ+E+IDE+I LFEESADLARTMEEKLQA TFAEAAKVQ+ IR+DP+++ KI+ETLA 
Sbjct: 544 LKLQKEEIDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAA 603

Query: 611 LREQG 615
            R Q 
Sbjct: 604 YRAQN 608

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/544 (60%), Positives = 407/544 (74%), Gaps = 20/544 (3%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YPV  NGEPD S  A FT E+K+KYA+ALKDKGN+ F++++Y++AIK+Y+ AL+LKEDPV
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN SACYV +  L+KVVE +T AL+LKPDYSK LLRRA+ANE LGN+ADAM DLS +S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253
           L G ++  +IEP+LERN+NKQAM  LK+K                        ++  LPS
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSG--------------------GEKHELPS 229

Query: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313
            TS+ASFF IF  E +  N DE++EAD+ L+ GL  L+ R   SY+ ADE+FT AV+ F 
Sbjct: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289

Query: 314 DQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373
                          LAI+LEH GI KFLKN+PL AH  + KAIDLFPR NSYIYM LIM
Sbjct: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349

Query: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EY   F+KAL+LD  +S+ YYHR QMNF++Q +DQAGKDFDKAKE DP  ++P
Sbjct: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYRE KFDDCETLFSEA+R+FP APEVPNF+AEIL+DK DF+ ALK+YD A +
Sbjct: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469

Query: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE+  EGI+VG+APLVGKA LL R P+  NF EAT L E A + DPRSEQAKIGLAQ+KL
Sbjct: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529

Query: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613
           QQE++DEAI LFE +ADL+R  EEKLQA TFAEAAK+Q+RIR+DPV++ KIQETL   R 
Sbjct: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589

Query: 614 QGLM 617
           QG++
Sbjct: 590 QGMV 593

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/544 (61%), Positives = 406/544 (74%), Gaps = 20/544 (3%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YPV +NGEPD S    FT E+K++Y++A+KDKGN+ F+ KKY++AIKYY+ AL LK+DPV
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN SAC+V +  L+KVVE +T ALELKPDYSK LLRRA+ANE LGNFADAM DLS +S
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253
           L G +N  SIEP+LERN+NKQAM  LK K  D                      +  LPS
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD--------------------GSKHQLPS 232

Query: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313
            TS+ASFFGIF  E +FAN DE +EAD  L+ GL  L +R   SY+ +DE F KA  L  
Sbjct: 233 NTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLS 292

Query: 314 DQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373
                          LAI+LEH GIFKFLKN+PL A++ + KA+DL PR NSYIYMALIM
Sbjct: 293 LSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIM 352

Query: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EY  YFDKAL+L  N+S+VYYHRGQM F+ Q ++++GKDFDKAKE +P+NIFP
Sbjct: 353 ADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFP 412

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+AEIL+DK D + ALK+Y+ A +
Sbjct: 413 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARK 472

Query: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE+  EGI+VG+APLVGKAT+L R     +F EAT L E+A K DPRSEQAKIGLAQ+KL
Sbjct: 473 LEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKL 532

Query: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613
           QQE +DEAI LFEE+ DLAR  EEKLQA TFAEAAK+Q+RIR+DP+++ KIQETL   R 
Sbjct: 533 QQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRV 592

Query: 614 QGLM 617
           QG++
Sbjct: 593 QGVV 596

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/544 (60%), Positives = 413/544 (75%), Gaps = 18/544 (3%)

Query: 73  IYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP 132
           +YPV ANG+PD SKK +FT E+ DKYALALKDKGN++F+ K ++ AI+YY  A+ LKEDP
Sbjct: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN SA YVS+ + +KVVE +T AL+LKPDYSK  LRRASA E LG F+DAMFDLS +
Sbjct: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLP 252
           SL G+++  S+E +LERN+NKQA   L EK                   KE + K+  LP
Sbjct: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKL------------------KENQGKESPLP 239

Query: 253 SVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLF 312
           S TS+ASFFGIF PE +F + D  NEAD EL  GL NLYK     Y+ ADE FTKA +L+
Sbjct: 240 SNTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELY 299

Query: 313 EDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALI 372
           + +L             AI+ EH GIFKF KNDP+ AH ++ +++ L PR ++YIYMALI
Sbjct: 300 KKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALI 359

Query: 373 MADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           MAD+ ++ +Y  YFDKAL+LD N S+VYYHRGQM+F+++N+ +AG DFDKAKEL+PENIF
Sbjct: 360 MADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIF 419

Query: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492
            YIQ ACLA+R+++FDDCETLFSEA+RKFP APEVPNF+AEIL  KN  D A+KQYD+AI
Sbjct: 420 AYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAI 479

Query: 493 ELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMK 552
           +LE+ L GI+VGIAP++GKAT L RNPTVENF+EA+ L E+A K+DPRSEQAKIGLAQ+K
Sbjct: 480 KLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLK 539

Query: 553 LQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLR 612
           LQQE+ID+AI LFE++ADL+R+ +EKLQA TFAEA KVQ++IR+DP +  KI E +A  R
Sbjct: 540 LQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYR 599

Query: 613 EQGL 616
            QGL
Sbjct: 600 AQGL 603

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/547 (59%), Positives = 414/547 (75%), Gaps = 21/547 (3%)

Query: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           PIY V +NGEP+ S     T E K+++A+ALKDKGN+ F+  K++DAIKYY++AL+LK+D
Sbjct: 83  PIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDD 142

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           P++YSN+SACY S+   +KV+E +TKAL+L+P +SKVL+RRA A E +GNF DAMFD+S 
Sbjct: 143 PIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESL 251
            SLNGD NDASIEP+LER LNKQA   LKEK                       +K+++L
Sbjct: 203 CSLNGDMNDASIEPILERILNKQAEFVLKEKIS--------------------ANKEQNL 242

Query: 252 PSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKL 311
           PS T +ASFF +FKPE +FAN +ESNEAD+ELMNGL NLYK S + +  AD+SF KA +L
Sbjct: 243 PSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAEL 302

Query: 312 FEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMAL 371
           F+DQL             AI+LE++GI  ++KN+ L AH+ I  AI+L PRVNSYIY +L
Sbjct: 303 FKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSL 362

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           I +D   ++EY   FDKAL+L+ NN ++YYHRGQ  FI Q Y++AGKDFDK KELD  NI
Sbjct: 363 IGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNI 422

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           F YIQLACLAYRE+KFDDCETLFSEA+RKFP APEVPNFFAE+L D+ + +KA+K++D A
Sbjct: 423 FAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKA 482

Query: 492 IELENKL-EGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQ 550
           IELE K  E I+VGIAPL+GKATLL   PTVENF+E   LL++A   DPRSEQA++GLAQ
Sbjct: 483 IELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQ 542

Query: 551 MKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAK 610
           +KLQQEDIDEAI LFEE+A+LA++ EEKLQA TFAEAAK+Q+RIR+DP +  KI++T+ +
Sbjct: 543 LKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQ 602

Query: 611 LREQGLM 617
           +R Q  M
Sbjct: 603 MRSQMSM 609

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/535 (60%), Positives = 405/535 (75%), Gaps = 11/535 (2%)

Query: 82  PDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSAC 141
           PD +     + ++K  YA ALKDKGN  F+ K+++DAI++YN A++L EDPVF+SN+SAC
Sbjct: 76  PDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISAC 135

Query: 142 YVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDA 201
           YVS+GDL KVVE ST+ALELKPDYSK LLRRASA E +G + DAMFD+SVLSLNGDFN +
Sbjct: 136 YVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGS 195

Query: 202 SIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPSVTSMASFF 261
           SIEPMLERNLNKQA+  LKE  G IDA+         + P+ER++    LPS TS++SFF
Sbjct: 196 SIEPMLERNLNKQALRVLKEDMG-IDASVP-----QAEQPRERQE----LPSNTSLSSFF 245

Query: 262 GIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFEDQLXXXXX 321
           GIFKPE      DESNEAD  L+ GL  LY  + D Y  ADE F KA KL+ +QL     
Sbjct: 246 GIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNND 305

Query: 322 XXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDSTE 381
                   A +LE+ GIF FLKND   + +++ +A+ L PRVN+YIY+AL MADR  S +
Sbjct: 306 AAFKEKA-ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSED 364

Query: 382 YYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441
           Y++YF+KA+ LD NN++VYYHRGQM FI QNY++AG+DF K+KE DP+NIFPYIQLACLA
Sbjct: 365 YFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLA 424

Query: 442 YRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGI 501
           YRENK  +CE LF EA++ FP APEVPNF+AEIL DK D D+A+KQY++A  LE+  + I
Sbjct: 425 YRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484

Query: 502 YVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEA 561
           +VGIAPLVGKAT+L R PT ENF   + LLE A K DPRSEQAK+GLAQ++LQQE +DEA
Sbjct: 485 HVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEA 544

Query: 562 IALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLREQGL 616
           I LFEE+A +ART++EKLQAITFAEA KVQ+RIR+DPV++ K++ETLA  + Q +
Sbjct: 545 IELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/544 (58%), Positives = 403/544 (74%), Gaps = 15/544 (2%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YP   + +PD  +      EE+ K ++ LKDKGN+YF+ K Y +AIKYYN AL+L +DP+
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN+SACYVS+G L KV+E STKALEL P+YSK LLRRASANE L N++DA+FDLSVLS
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253
           LNGD++ ASIEP+LERNLNKQA+  L E+   +  +                 +Q+ LPS
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSN---------------KEQQLLPS 261

Query: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313
            TS+ SFFGIF PELTF N +E+++AD EL+ GL NL+KR+   Y  AD++F KA  LF 
Sbjct: 262 TTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFM 321

Query: 314 DQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373
           ++L             AI+LE+ GIF+FLKND LGA  DI KAI  FPRVNSY+Y+ALI 
Sbjct: 322 EELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALIS 381

Query: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD++ S EY  YFDKAL+L+ ++ SVYYHRGQ+ FI Q+Y +A  +F+KAKELD  NIFP
Sbjct: 382 ADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFP 441

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYREN FD C+ LF E ++KFP  PEVP F+AEIL DK DF  A+KQYD+A  
Sbjct: 442 YIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATR 501

Query: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE   + I+VGIAPLVGKAT+L R P + N  EAT L+EKA ++DPRSEQA +GLAQ+KL
Sbjct: 502 LEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKL 561

Query: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613
           Q E++D AI LFE++ADL+RTM+EK+QA+TFAEAAK+Q+RIR+DPV++ K+ E LA  R 
Sbjct: 562 QNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRS 621

Query: 614 QGLM 617
           QG++
Sbjct: 622 QGVI 625

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/554 (58%), Positives = 400/554 (72%), Gaps = 26/554 (4%)

Query: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P+YP+ A+GEPD S+   +T E+++ YALALKDKGN+ F+ K  ++AIKYY WALE K+D
Sbjct: 79  PVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD 138

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFY+N+SACYVS+ D +KV+E   KALELKPDYSKVLLRRA+  E + NFADAMFDLSV
Sbjct: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDK-QES 250
           LSLN DF+ ASIEPMLERNLNKQAM  LKE+  +                   +DK ++ 
Sbjct: 199 LSLNNDFSGASIEPMLERNLNKQAMKMLKERLENT------------------QDKFEQP 240

Query: 251 LPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAV- 309
           LPS TSMASFFGIFKPE  F   DE+ EAD+ L  GL  L+  +   + +AD  F +AV 
Sbjct: 241 LPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVN 300

Query: 310 ---KLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSY 366
              +LF                 AI+LE++GIFKFLKND +GA   + +AI LFPRVNSY
Sbjct: 301 QYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSY 360

Query: 367 IYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKEL 426
           IY+AL  AD  +S+EY   FDKAL+L+ N+S+ YYHRGQ+ FI Q+Y +A  DF KAKEL
Sbjct: 361 IYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKEL 420

Query: 427 DPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALK 486
           D +NIF YIQLACL YRE   D+C+ LF EA+ KFP APEVP F+AEIL DK DF  A K
Sbjct: 421 DNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAK 480

Query: 487 QYDLAIELENKLE---GIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQ 543
           QYD+A  LE  +    GI VG+APLVGKAT+L R P+ ENF EAT L E+A K DPRSEQ
Sbjct: 481 QYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQ 540

Query: 544 AKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATK 603
           AK+GLAQ+ LQQED+D AI +FEE+ADLART +EKLQA+TFAEAAKVQ++IR+DP++  K
Sbjct: 541 AKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAK 600

Query: 604 IQETLAKLREQGLM 617
           ++E LA+ R QG++
Sbjct: 601 VEEALAEYRAQGMI 614

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/544 (57%), Positives = 398/544 (73%), Gaps = 18/544 (3%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           +P   NGEPDF+   + TA++KDK+A+ LKDKGN+YF+ K Y++A+K+Y++AL LK+DPV
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN+SACYVS+ +L KV+EMSTKALELKPDYSK LLRRA+ANE L N++DAMFDLSVLS
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253
           LN DFN A+IEPMLERNLNKQA+  L +K              S  P K     +  LPS
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQK--------------SKNPSK----NESELPS 244

Query: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313
            TSMASFF IF PE++F + DE ++ADKEL+NGL  LY      Y+ A+ SF K+++L++
Sbjct: 245 NTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYK 304

Query: 314 DQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373
             L             AI+LE+ GIF FL+ND + A +   ++I   PRVNSYIY+ALI 
Sbjct: 305 ILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALIS 364

Query: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+N+  E   YFD+ALKLD N S +YYHRGQ+NF+ Q+Y  A  DF KAKELD  NIFP
Sbjct: 365 ADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFP 424

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACL+YRE  F+DC+  F  A++KFP APE+P F  EIL DK D D A KQY+  I 
Sbjct: 425 YIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIR 484

Query: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LEN  + I+VGIAPL+GKAT L R PT ENF EA+ LL+ A + DPRSEQA +GLAQ+KL
Sbjct: 485 LENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKL 544

Query: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613
           Q+ED+D AI LFE+++D +R+M+EKLQA TFAEAAKVQ+RIR+DPV+  K++ETLA+   
Sbjct: 545 QEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHA 604

Query: 614 QGLM 617
           QG M
Sbjct: 605 QGFM 608

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/537 (55%), Positives = 382/537 (71%), Gaps = 19/537 (3%)

Query: 79  NGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNL 138
           N EPD          EK++YA  LK +GN YF+ K Y++AI YY +AL+LK DPVFYSN+
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125

Query: 139 SACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDF 198
           +ACY+S+   K+ +E  +KALEL PDYSKVLL+RA+  E +G FADA+ DL+ +SLNGD+
Sbjct: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185

Query: 199 NDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPSVTSMA 258
           NDA+I+P++ER LNKQAM  LK+                     E  +K + LPS TSMA
Sbjct: 186 NDATIQPIVERVLNKQAMMALKDHL-------------------EASEKNKVLPSYTSMA 226

Query: 259 SFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFEDQLXX 318
           +FFG+F  E      D + E+DK L + L +LY ++ + YDR D  FTKA +L++ +L  
Sbjct: 227 AFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLEN 286

Query: 319 XXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRND 378
                      AI+ EHT I  FLKNDPL A E + +AI L PR  SYIY+ L+MAD+  
Sbjct: 287 DRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGL 346

Query: 379 STEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLA 438
             EYY+ F KA+ LD N +++YYHRGQMNFI+Q Y++AG+DFDKAKE DP NIFPYIQLA
Sbjct: 347 DEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLA 406

Query: 439 CLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKL 498
           C++YRE  FDDCETLFSEA+RKFP+APEVPNFFAEIL+DK + +KA  +YD AIELE+K 
Sbjct: 407 CMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKS 466

Query: 499 EGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDI 558
           E I+VGIAPLVGKAT L + PTVENFIEA +L E+A+  DPRSE+AK+GLAQ KLQQED+
Sbjct: 467 ENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDL 526

Query: 559 DEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLREQG 615
           D+AI LFEE+A L RT++EKLQA TFAEA KVQ R+R+D  L  K  + L ++R  G
Sbjct: 527 DDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/556 (52%), Positives = 374/556 (67%), Gaps = 29/556 (5%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132
           YP+ ++GEPD ++       ++ +YA+ LKDKGN +F +K +DDAIKYY  A+EL   DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDK-QESL 251
           SLNGDF+ ASIEPMLERNLNKQAM  L                      K   D+  E L
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLS-----------------KNSGDRGSEIL 262

Query: 252 PSVTSMASFFGIFKPELTFANCDESNEADKE---LMNGLANLYKRSPDSYDRADESFTKA 308
           PS TS+ASFFGIF P+L  +     +  D     L+  L  LY  + + Y  A+  FTKA
Sbjct: 263 PSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKA 322

Query: 309 VKLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIY 368
              +   L             A++  + GIF+FLKND L A   + ++I+L P  NSYI+
Sbjct: 323 TDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF 382

Query: 369 MALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           MAL +AD+ +S E++++F KA+ LD   S  YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 383 MALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488
            NI+PYIQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK D++ A+KQY
Sbjct: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502

Query: 489 DLAIELENKLEGIYVGIAPLVGKATLLTRNPTV-------ENFIEATNLLEKASKLDPRS 541
           D+A  L+     I+VGI PL+GKAT+L R  T        E F  A  LL +A  LDPRS
Sbjct: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562

Query: 542 EQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLA 601
           EQAKIGLAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++
Sbjct: 563 EQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 622

Query: 602 TKIQETLAKLREQGLM 617
            K+++TLA  R  G++
Sbjct: 623 AKMEQTLASYRANGMI 638

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/555 (52%), Positives = 380/555 (68%), Gaps = 28/555 (5%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132
           YP   NGEPD ++    +  ++  YA+ LK++GN +F  K +++AIKYY +A+EL   +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL+KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLP 252
           SLNGDF+ ASIEPMLERNLNKQAM  L E                    K+     + LP
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLS-----------------KDEGRGSQVLP 264

Query: 253 SVTSMASFFGIFKPELTFANCDESNEADKE---LMNGLANLYKRSPDSYDRADESFTKAV 309
           S TS+ASFFGIF   L  ++ + S+  D     L + L  LY  + + Y  A++  TK+ 
Sbjct: 265 SNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKST 324

Query: 310 KLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYM 369
            ++   L             A++L +TGIF FLKN+ L A   + ++I+L P  NSYI++
Sbjct: 325 DMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFL 384

Query: 370 ALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPE 429
           AL +AD+ +S E++ +F KA+ L+      YYHRGQM FILQ+Y  A +DF KA+ L+PE
Sbjct: 385 ALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPE 444

Query: 430 NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYD 489
           N++PYIQLACL Y++ KF + E  F+E K KFP  PEVP FFAEILTD+ DFD A+KQYD
Sbjct: 445 NVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYD 504

Query: 490 LAIELENKLEGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRSE 542
           +A  LE   E I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSE
Sbjct: 505 IAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSE 564

Query: 543 QAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAT 602
           QAKIGLAQ+KLQ E IDEAI LFE+SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++ 
Sbjct: 565 QAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISA 624

Query: 603 KIQETLAKLREQGLM 617
           K++ TLA+ R +G++
Sbjct: 625 KMELTLARYRAKGML 639

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/550 (54%), Positives = 371/550 (67%), Gaps = 29/550 (5%)

Query: 79  NGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSN 137
           NGEPD S+    T  +K  YA+ LK+KGN +F  K + +AIKYY  A+EL   DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 138 LSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGD 197
           +SACY+S GDL KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVLSLNGD
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 198 FNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPSVTSM 257
           F+ ASIEPMLERNLNKQAM  L E     D   +                 + LPS TS+
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGS-----------------QLLPSNTSL 266

Query: 258 ASFFGIFKPELTFANCDESNEADKE---LMNGLANLYKRSPDSYDRADESFTKAVKLFED 314
            SFFGIF P+L  +  + S+  D     L + L  LY  + + Y  AD+ FT A   +  
Sbjct: 267 TSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHS 326

Query: 315 QLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMA 374
            L             A++  +TGIF FLKN+ LGA   + ++I+L P  NSYI++AL +A
Sbjct: 327 -LLASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLA 385

Query: 375 DRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D+ +S E++ YF KA+ LD      YYHRGQM FILQ+Y  A  DF KA+ L PENI+PY
Sbjct: 386 DKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPY 445

Query: 435 IQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIEL 494
           IQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK DF  A+KQYD+A  L
Sbjct: 446 IQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRL 505

Query: 495 ENKLEGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRSEQAKIG 547
           E   E I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSEQAKIG
Sbjct: 506 EEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIG 565

Query: 548 LAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQET 607
           LAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++ K++ T
Sbjct: 566 LAQLKLQMEKIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMT 625

Query: 608 LAKLREQGLM 617
           LA  R +G++
Sbjct: 626 LASYRAKGMI 635

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/556 (52%), Positives = 377/556 (67%), Gaps = 29/556 (5%)

Query: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132
           YP+  +GEPD  +    +A ++  +A+ LKDKGN +F  K + DAIKYY +A+EL   DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQ-ESL 251
           SLNGDF+  SIEPMLERNLNKQAM  L E                    K   DK  + L
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESL-----------------LKNGDDKSSQIL 268

Query: 252 PSVTSMASFFGIFKPELTFANCDES---NEADKELMNGLANLYKRSPDSYDRADESFTKA 308
           PS TS+ASFFGIF P+L  +  +     + A   L   L +LY  + + Y  AD+  TKA
Sbjct: 269 PSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKA 328

Query: 309 VKLFEDQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIY 368
              +   L             A++  + GIF+FLKND L A   + ++I+L P  NSY++
Sbjct: 329 TDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVF 388

Query: 369 MALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           MAL +AD+ +S E++ +F  A+ LD      YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 389 MALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNP 448

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488
            N++PYIQLACL Y+++KF + E+LF+EAK KFP  PEVP F+AEILTDK DF+ A+KQY
Sbjct: 449 GNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQY 508

Query: 489 DLAIELENKLEGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRS 541
           D+A  LE   + I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRS
Sbjct: 509 DIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRS 568

Query: 542 EQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLA 601
           EQAKIGLAQ++LQ E ID AI LF+ESA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++
Sbjct: 569 EQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 628

Query: 602 TKIQETLAKLREQGLM 617
            K+++TLA  R QG++
Sbjct: 629 AKMEQTLANYRAQGMI 644

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 377/555 (67%), Gaps = 27/555 (4%)

Query: 72  PIYPVAANGEPDFSKKADFTAEE---KDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL 128
           P YP+ +  +PDF++     A     K K+A  LK+KGNQYF++K  ++AIKYY +AL L
Sbjct: 128 PSYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRL 187

Query: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFD 188
            +DPVFYSN+SACY ++  L KV+E S KALELKPDYSK LLRRA+A E LGN  +A++D
Sbjct: 188 DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYD 247

Query: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQ 248
            S+LSL G+++   +EP+L R L+K +   L+ K  +                  +K   
Sbjct: 248 FSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDN------------------KKTDN 289

Query: 249 ESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKA 308
             L S +++ SFFGIF PE T  N +  +EADKEL+ GL  L K++ + +  AD+ F KA
Sbjct: 290 FILLSDSALVSFFGIFPPETTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKA 349

Query: 309 VKLFEDQLXXXXXXXXXXXXL---AISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNS 365
            +LF ++L            L   AI+LE++G+FKFLK D LG+  D+ KAIDL+PR NS
Sbjct: 350 NELFMEKLLSSEDNDENSGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNS 409

Query: 366 YIYMALIMADRNDST---EYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDK 422
           YIYMA+++AD+N+     +Y+ YFDKA  L+ N +  YYHRGQ+  + Q +D+A   F K
Sbjct: 410 YIYMAMLVADKNNDKNDLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLK 469

Query: 423 AKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFD 482
           AKELD  N++PYIQLAC+AY  + F  C+ LF EA+ KFP  PEVP F+AEIL DK + +
Sbjct: 470 AKELDDSNVYPYIQLACVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELE 529

Query: 483 KALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSE 542
            A+KQYD+A  LE   + I+VGIAPL+GKA  L R PT ENF   T LLEKA +LDPRSE
Sbjct: 530 AAMKQYDIAYRLETAYKYIHVGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSE 589

Query: 543 QAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAT 602
           QAKI LAQ+KLQ EDID AIALFEE+ADLART ++KLQA TFAEAAK+Q+RI+ +P+ A 
Sbjct: 590 QAKISLAQLKLQTEDIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAA 649

Query: 603 KIQETLAKLREQGLM 617
           KI+ETLA  R  G++
Sbjct: 650 KIEETLATYRADGII 664

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           KD+GN  F  K YD+AI+ +  A+E+ E P  V YSN SACY S     K +E + + ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ G+G+  +A
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 5/83 (6%)

Query: 91  TAEEKDKYAL-ALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLK 149
           T E++ K A  A K +GN+ ++  K+D+AI++YN A EL  D  + +N SA     GD +
Sbjct: 246 TPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITYLNNRSAAEFEKGDYQ 305

Query: 150 KVVEMSTKAL----ELKPDYSKV 168
             +E   +A+    E++ DY  V
Sbjct: 306 TAIETLHEAVEKGREMRADYKLV 328

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G +YF    + +A+K Y   +     D   YSN +A    +    + +     A+E  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   + +F  A+  L
Sbjct: 456 FIRAYIRKATAQIAIKDFVPAIETL 480

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 3/125 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK KGN  F +K +  AI+Y+  A+     P  V YSN SACY S+   ++ +  + + +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 160 ELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRL 219
           ++ PD+SK   R  +A+ GLG+  DA  +    +L  D N+ +    LE+    Q   + 
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDAESNYKK-ALELDSNNKAASEGLEQVHRVQESRKS 125

Query: 220 KEKFG 224
           +  FG
Sbjct: 126 RPDFG 130

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL----EL 161
           GN+ +++ K+D+AI  YN A +L +D  + +N SA     GD +  +    +A+    EL
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGREL 322

Query: 162 KPDY 165
           + DY
Sbjct: 323 RADY 326

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 2/144 (1%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVV 152
           E  + A+ LK++GN+Y + KKY  A++YY  A+EL     +F+SN +   + + + +  +
Sbjct: 8   EAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCL 67

Query: 153 EMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLN 212
           +    ALEL P   K   RR  +  GL +F  A  DLS++ L    +DA+ +  L+    
Sbjct: 68  DDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV-LKAKPSDATAKRALDMCEK 126

Query: 213 KQAMSRLKEKFGDIDAATATPTEL 236
                R K+  G  D     P ++
Sbjct: 127 VIREERFKKAIGGDDTDRVNPCQV 150

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 12/99 (12%)

Query: 355 KAIDLFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYD 414
           +AIDL    N YI            T+   Y+ KA++LD   S  + +R      L N+ 
Sbjct: 12  QAIDLKNEGNKYI-------KEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQ 64

Query: 415 QAGKDFDKAKELDPENIFPY-----IQLACLAYRENKFD 448
               D + A ELDP+NI  Y      QL  L +++ K D
Sbjct: 65  SCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKND 103

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K ++ AI+ +  A+E+ E P  V YSN SACY S+   ++ +  + + + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           +KPD+SK   R  +A+ GLG+  +A
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K KGN+ ++ +++D+AI  Y  A +L +D  + +N +A     GD +  ++   KA+   
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEG 317

Query: 160 -ELKPDY---SKVLLRRASANEGLGNFADAM 186
            EL+ DY   +K   R  +A+  L +   A+
Sbjct: 318 RELRADYKVIAKSFARLGNAHYKLADLKKAI 348

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +YF N  + +A+K Y   ++   ED   YSN +A    +      ++    A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  +A A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GNQ F +K Y  AI+ +  A+E+ E P  V +SN SACY S  D  K ++ + + +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P ++K   R  +A+ GLG+  +A
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 51/95 (53%), Gaps = 7/95 (7%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKA 158
           A A K +GN+ ++ +K+D+AI+ YN A E   D  + +N +A     GD +  +E  TKA
Sbjct: 255 AEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKA 314

Query: 159 L----ELKPDY---SKVLLRRASANEGLGNFADAM 186
           +    EL+ DY   SK   R  ++   LG+   A+
Sbjct: 315 VEQGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +YF    +  A++ Y   ++    D   YSN +A    +      +    KA+E  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+    + ++A A+  L
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETL 480

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 62/120 (51%), Gaps = 8/120 (6%)

Query: 80  GEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNL 138
           GEP  +      AEE  K A ALK +GN+    K Y+ AI+ Y  A+E L  D V+Y+N 
Sbjct: 77  GEPKVA------AEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 139 SACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS-VLSLNGD 197
           +A Y S+   +K VE + KA ++   YSK   R   A   LG   +A+     VL + GD
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K ++ A + ++ A+E  E P  V YSN SACY S+   K+ +E + + +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P +SK   R  +A  GLGN  DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 101 ALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL- 159
           A K +GN+Y++ +K+D+AI++YN A +L  D  + +N SA     GD ++ ++  T+A+ 
Sbjct: 269 AEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVD 328

Query: 160 ---ELKPDY 165
              E++ DY
Sbjct: 329 QGREMRADY 337

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G ++F    +  A+  Y   ++   ED   YSN +A    +      ++    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV-----LSLNGDFNDASIE 204
           ++ +  +R+ASA   +  FA AM  L       L +N   N   IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKK 150
           +E+K K A ALK +GN+    K Y  AI  Y+ A+E+   +P +YSN +A Y  + D   
Sbjct: 91  SEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTN 150

Query: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            V  +  A++L P YSK   R  +A    GN  DA+     VL L GD
Sbjct: 151 AVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y  AI  +  A+E+ E P  V YSN SACY S+      +  +T+ ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN++++ +++++AI++YN A EL  D  + +N +A     GD +  +   T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 160 -ELKPDY---SKVLLRRASANEGLGNF 182
            E++ DY   SK   R  +A   LG+ 
Sbjct: 323 REMRADYKVISKSFARIGNAYHKLGDL 349

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G +YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKF 223
           + +  +R+A+A   +  FA A+  L +  + + + N+ +    +++   K +  R +   
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKASQQRFQSGT 519

Query: 224 GD 225
           G+
Sbjct: 520 GN 521

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K ++ AI+ +  A+E+ E P  V YSN SACY S     K +E + + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 101 ALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL- 159
           A K +GN++++ +K+D+AI++Y+ A EL +D  + +N +A     G+ +  ++  T+A+ 
Sbjct: 261 AEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

Query: 160 ---ELKPDY 165
              EL+ DY
Sbjct: 321 QGRELRADY 329

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +YF    + +A+K Y   ++   ED   YSN +A    +    + ++    A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  F   +  L
Sbjct: 459 NFIRAYIRKATAQIAVREFVSVIETL 484

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ E P  V YSN SACY S+      +  + + ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN++++ +++D+AI++YN A EL +D  + +N +A     G+ +  +     A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 160 -ELKPDY---SKVLLRRASANEGLGNF 182
            E++ DY   SK   R  +A   LG+ 
Sbjct: 326 REMRADYKVISKSFARIGNAYHKLGDL 352

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G +YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDAS 202
           + +  +R+A+A   +  +A A+  L +  + + + N+ S
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGS 501

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ E P  V +SN SACY S+      +  + + ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLK 220
           + P +SK   R  +A+ GLG+  +A  D    +L  D N+ + +  LE+    Q   + +
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKK-ALELDANNKAAKDGLEQVHRTQQARQAQ 127

Query: 221 EKFG 224
              G
Sbjct: 128 PDLG 131

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE-- 160
           K +GN++++  ++D+AI++YN A EL +D  + +N +A     GD + V+     A+E  
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKG 325

Query: 161 --LKPDY---SKVLLRRASANEGLGNF 182
             ++ DY   SK   R  +A   LG+ 
Sbjct: 326 RDMRADYKVISKSFARIGNAYHKLGDL 352

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV 191
           ++ +  +R A+A   +  FA A+  L V
Sbjct: 462 NFVRAYIRMAAAQIAVKEFAAALETLDV 489

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y+ AI  ++ A+E+ E P  VFYSN SACY S+    + +  + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEMSTKALEL 161
           GN+ ++ +++D+AI +Y+ A  L +D  + +N SA     GD    LK + E   K  E+
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREM 322

Query: 162 KPDY---SKVLLRRASANEGLGNFADAM 186
           + DY   +K   R  + +    N   A+
Sbjct: 323 RTDYKLIAKSFARMGNVHHKTNNLKKAI 350

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G  YF    + +A+K Y   ++   ED   YSN +A    +    + +E   KA+E  P
Sbjct: 396 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDP 455

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  FA A+  L
Sbjct: 456 NFIRAYIRKATAQIAVKEFAAAIETL 481

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  KKYD+A+  +  A+E+ E P  V YSN SA Y S     + ++ + +  +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P ++K   R  +A+ G+GN  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVV----EMSTKA 158
           K +GN+ ++ + +D+AI  YN A EL  +  + +N SA     G+    +    E   K 
Sbjct: 255 KVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKG 314

Query: 159 LELKPDY---SKVLLRRASANEGLGNFADAM 186
            E++ DY   +K   R  +A   +GN  +A+
Sbjct: 315 REMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +YF    +  A+K Y   ++   ED   YSN +A    +      +    KA+E  P
Sbjct: 391 EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDP 450

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV-----LSLNGDFNDASIEPMLERNLNKQAMSR 218
           ++ +  +R+A+A   + +F+ A+  L         +NG  N   I+ +      K A  R
Sbjct: 451 NFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQL----YMKAAQQR 506

Query: 219 LKEKFGD 225
            +   GD
Sbjct: 507 FQPATGD 513

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLK 149
            +EE  + AL  K++GN + + KKY +A++YY+ A+EL +   +F+SN +   + + +  
Sbjct: 4   VSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFL 63

Query: 150 KVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             +E   K++EL P   K + RR  +  GL  F+ A  DL  +
Sbjct: 64  TALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 381 EYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           E   Y+ KA++LD   S  + +R      L N+  A +D +K+ ELDP+NI
Sbjct: 30  EAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNI 80

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ + P  V YSN SACY S+      +  + + + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 93  EEKDKYALALKDK--GNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKK 150
           +E D  A A K+K  GN++++ +++D+AI++YN A EL  D  + +N +A     G+ K 
Sbjct: 254 DEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKT 313

Query: 151 VVEMSTKAL----ELKPDY---SKVLLRRASANEGLGNF 182
            +     A+    E++ DY   S+   R  +A   LG+ 
Sbjct: 314 AIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDL 352

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 2/122 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKF 223
           + +  +R+A+A   +  +A A+  L +  + + D N+ +    +++   K +  R +   
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKASQQRFQPGT 522

Query: 224 GD 225
           G+
Sbjct: 523 GN 524

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI  ++ A+++ E P  V YSN SACY S+      ++ + + ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ G+G+  +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEMSTKALEL 161
           GN+ ++ +++D+A+  YN A E   D  + +N SA     GD    +K + E   K  E+
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREM 329

Query: 162 KPDYSKVLLRRASANEGLGNFADAMFDL 189
           + DY KV+   A +   +GN    + DL
Sbjct: 330 RADY-KVI---AKSFARMGNCYTKLNDL 353

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  YF    + +A+K Y   ++   ED   YSN +A    +    + ++   KA+E  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   +  F+ A+  L
Sbjct: 464 FVRAYIRKATAQIAVREFSSALETL 488

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K+Y+ A+  ++ A+E+  +P  V YSN SACY S+      +  + +  +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 60/118 (50%), Gaps = 11/118 (9%)

Query: 75  PVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVF 134
           PVAAN E      AD     + K A A KD+GN+ ++  K+D+AI++Y+ A EL  D  +
Sbjct: 238 PVAANPENMEVDDADV----QKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITY 293

Query: 135 YSNLSACYVSVGD----LKKVVEMSTKALELKPDY---SKVLLRRASANEGLGNFADA 185
            +N +A     GD    +K + +   K  EL+ DY   +K   R  +A E L +   A
Sbjct: 294 LNNKAAAQYEKGDYETTIKTLEDAIEKGRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 2/100 (2%)

Query: 105 KGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G  +F   ++ DA+K Y   +    +D   YSN +A    +    + +    KALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSVL-SLNGDFNDAS 202
           ++ K  +R+A+A   +  ++ A+  L +  S + + N+ S
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDIARSKDTELNNGS 497

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F +K ++ AI+ +  A+E+   P  V YSN SA Y S    ++ +  +T+ ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A  GLGN  +A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+ ++  K+D+AI+ YN A  L +D  + +N SA     GD +  +    +A+   
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 160 -ELKPDY 165
            EL+ DY
Sbjct: 319 RELRADY 325

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G +YF    + +A+K Y+  ++   ED   YSN +A    +    + ++    A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 165 YSKVLLRRASANEGLGNFADAM 186
           + +  +R+A+A   +  +A+A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLK 149
             +E  + AL  K++GN Y + KKY +A++YY+ A+EL +   +++SN +   + + +  
Sbjct: 2   VTQEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFL 61

Query: 150 KVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
              E   KA+ L P   K + RR  +  GL  F  A  DL V+
Sbjct: 62  TAQEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 381 EYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           E   Y+ KA++LD   S  + +R      L N+  A +D DKA  LDP+NI
Sbjct: 28  EAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNI 78

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y+ A + +  A+++ E P  V YSN SACY S+    + ++ + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A  GL N  DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 61/118 (51%), Gaps = 16/118 (13%)

Query: 75  PVAANGEPD---FSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P+  N EP+     +K    A E++K       +GN++++ +K+D+AI++YN A EL +D
Sbjct: 227 PLKENNEPEPMEVDEKGPQVAAEEEKA------EGNKFYKARKFDEAIEHYNKAWELHKD 280

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKAL----ELKPDY---SKVLLRRASANEGLGNF 182
             + +N +A     GD +  +   T A+    E++ DY   +K   R  +A   LG+ 
Sbjct: 281 ITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDL 338

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 2/99 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G +YF    + +A+K Y   ++   +D   YSN +A    +    + +    +A+E  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDAS 202
           + +  +R+ASA   +  FA A+  L +V + + + N+ +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGA 487

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query: 75  PVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPV 133
           P  ++ EP      D  A E  + A  LK +GN+ F  K ++ A+K Y  A+EL   + V
Sbjct: 73  PTLSSSEPT-GNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVL 192
           FY N +A Y S    ++ V  +  A+ + P YS+   R   A   LG   +AM     VL
Sbjct: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191

Query: 193 SLNGD 197
            + GD
Sbjct: 192 DIEGD 196

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN++  +K Y  AI+ Y  A+EL     +F+SN +   + +   +  +E S+K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A+EL     K   RR  A  GL +F  A  DL V+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 2/132 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN Y +++ Y  AI+ Y  A+EL     +FYSN +  ++ + + +  +     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS 217
           A++L  +  K   RR  A  GL  F  A  DL++L L    NDA+ +  LE   +     
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL-LKYKPNDATAKRGLEMCESFIREE 130

Query: 218 RLKEKFGDIDAA 229
           R K+  G  D  
Sbjct: 131 RFKKAIGGDDHG 142

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 89  DFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGD 147
           D   EE+   A  LK +GN+    K Y+ AIK Y+ A+E L  + V+Y+N +A Y S+  
Sbjct: 83  DAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKK 142

Query: 148 LKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
               V  +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 87  KADFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYV 143
           K +  AE+ +  A A  LK +GN+   +K ++ AIK Y  A+E L  + V+Y+N +A Y 
Sbjct: 83  KVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYS 142

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           S+   ++ V+ +  A+++ P YSK   R   A   LG   +A+    +VL + GD
Sbjct: 143 SLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 57/97 (58%), Gaps = 7/97 (7%)

Query: 97  KYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMST 156
           K A A K +GN++++ +K+D+AI++YN A +L +D  + +N SA     GD ++ ++  T
Sbjct: 265 KNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLT 324

Query: 157 KAL----ELKPDY---SKVLLRRASANEGLGNFADAM 186
           +A+    E++ DY   SK   R  +A   L +F  A+
Sbjct: 325 EAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K Y+ A + +  A+E  E P  V YSN SAC+ S+    + +  + + +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P +SK   R  +A  GLG   +A
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYN-WALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +YF    + +A+K Y        ED   YSN +A    +    + ++    A+   P
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  FA A+  L
Sbjct: 467 NFIRAYIRKATAQIAVREFASAIETL 492

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 82/194 (42%), Gaps = 29/194 (14%)

Query: 73  IYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KED 131
           +  VA +G P   ++   TA      AL  K++GN++ + K Y  A++ Y  A+E     
Sbjct: 16  VRTVAGSGHPSPPRRDSMTAAT----ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQ 71

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
            +F+SN +   + +   +  +E S +A+EL     K   RR  A+ GL  +  A  DL V
Sbjct: 72  SIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEV 131

Query: 192 LSLNGDFNDASIEPML---ERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQ 248
           + +     D ++   L   ER L ++   R     GD                    ++Q
Sbjct: 132 V-VRAKPGDEAVRRALEVCERMLRRERFERAIRADGD--------------------EEQ 170

Query: 249 ESLPSVTSMASFFG 262
             L    S+ASF G
Sbjct: 171 RRLCKTLSLASFAG 184

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K Y  AI  +  A+E+ E P  V YSN SACY S    ++ ++ + + +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P +SK   R  +A  GL    +A
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEM 154
           A A K +GN+ ++ +++++AI++YN A EL +D  + +N SA     GD    +K + + 
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDTAIKTLNDA 305

Query: 155 STKALELKPDYSKV 168
             +  EL+ DY  +
Sbjct: 306 VEQGRELRADYKTI 319

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G ++F    + +A+K Y   ++   +D   +SN +A    +    + +E   KA+ + P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV 191
           ++ +  +R+A+A   +  FA A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y  AI  +  A+E+ E P  V YSN SA Y S    ++ +  + + ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P ++K   R+ +A +GL  + +A
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+ ++ +++D+AI +YN A E  +D  + +N SA     GD +  ++  T+A+   
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVENA 314

Query: 160 -ELKPDYSKV 168
            EL+ DY  V
Sbjct: 315 RELRTDYKIV 324

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +YF    + +A+K Y   ++   +D   YSN +A    +      +    KA+E  P
Sbjct: 391 EGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDP 450

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV 191
            + +  LR+A+    +  FA A+  L +
Sbjct: 451 SFIRAYLRKATCQIAVKEFAGAIETLDL 478

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +GN+    KK+D+AI+ Y  A+E+   + V+YSN +A Y S+   ++ V+ + +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 164 DYSKVLLR 171
            YSK   R
Sbjct: 161 TYSKGFSR 168

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (53%), Gaps = 2/102 (1%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKK 150
           A + DK AL  K++GN   + + Y  AI+ Y+ A+EL +   V++SN + C++ + + + 
Sbjct: 3   ATDADK-ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQC 61

Query: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             +   KAL L P   K   RR  A  GL  F  A  DL+V+
Sbjct: 62  ASQDCDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           +DKA++LD   S  + +R   +  L N+  A +D DKA  LDP+N+  Y +  LAC+   
Sbjct: 32  YDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVGLL 91

Query: 444 ENK 446
           E K
Sbjct: 92  EFK 94

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K +  A++ +  A++  E+P  V YSN S  Y S+    + +  +T+ ++
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           +K D+SK   R  +A+ GLGN  +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEMSTKA 158
           K +GNQ ++ +K+D+AI  Y  A  L++D  + +N +A     GD    +K + E   + 
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQG 321

Query: 159 LELKPDYSKVLLR 171
            EL+ DY KV+ +
Sbjct: 322 RELRADY-KVIAK 333

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 106 GNQYFRNKKYDDAIKYYN-WALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G +YF    +  A+K Y+   +    D   YSN +A    +      ++   KA+E+ P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 165 YSKVLLRRASANEGLGNFADAMFDLSV 191
           + +  +R+A+A   +  ++ A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 1/113 (0%)

Query: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           NY  K+L++D N+S+ +YH G+++ I  +Y  A   F +A   D  N   +  +  L Y+
Sbjct: 293 NYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 352

Query: 444 ENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFDKALKQYDLAIELE 495
            +++ D    ++ A R  P   EV      +  T  N  + AL  Y  A  L+
Sbjct: 353 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 405

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKA 158
           A ALK +GN+     +Y++AIK Y  A++  ++  +YSN S  Y  +G  +  V  +T A
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141

Query: 159 LELKPDYSKVLLRRASANEGLGNFADAM 186
           + + P +SK   R   A        D M
Sbjct: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 66/143 (46%), Gaps = 11/143 (7%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN + + K +  A + Y+ A+EL     +++SN +  ++ + + +  +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS 217
           A+EL P   K   RR  +  GL  F  A  DL ++ L    N    EP+  R L+     
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-LRAKPN----EPVATRALDVCERV 126

Query: 218 RLKEKF-----GDIDAATATPTE 235
             KEKF     G  DA T    E
Sbjct: 127 IRKEKFEKAISGGSDAVTVNVCE 149

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 351 EDITKAIDLFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFIL 410
           ED+ KA++   + N +I       + + + E Y+   KA++LD   S  + +R   +  L
Sbjct: 7   EDVNKALEFKNQGNVFIKGK----NFSKAAELYS---KAIELDGTQSIYFSNRAFAHLKL 59

Query: 411 QNYDQAGKDFDKAKELDPENIFPY 434
            N+  A  D +KA ELDP+N+  Y
Sbjct: 60  DNFQTALNDCNKAIELDPKNVKAY 83

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKK 150
           ++E    AL  K+KGN+Y +   YD AI++Y+ A+ L     +++SN +  ++   +   
Sbjct: 5   SQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYS 64

Query: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            V     AL+L P   K   RR  +  G+  F  A  DL+V+
Sbjct: 65  AVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 12/105 (11%)

Query: 349 AHEDITKAIDLFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNF 408
           + EDI  A+D   + N YI  +    D + + E+Y+   KA+ LD   S  + +R   + 
Sbjct: 5   SQEDIATALDFKNKGNEYIKKS----DYDSAIEFYS---KAIALDSTQSIYFSNRALAHL 57

Query: 409 ILQNYDQAGKDFDKAKELDPENIFPYIQ-----LACLAYRENKFD 448
              N+  A  D D A +LDP+NI  Y +     +  L +R+ K D
Sbjct: 58  KQDNFYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKND 102

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 6/105 (5%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP---VFYSNLSACYVSVGD 147
           TAE+  K A+  K++GN + + + Y  AI+ Y  A+EL  DP   +FYSN +   + + +
Sbjct: 5   TAEDIAK-AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDN 61

Query: 148 LKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            +       +AL L     K   RR  AN GL  F  A  DL+V+
Sbjct: 62  FQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query: 351 EDITKAIDLFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFIL 410
           EDI KA++     N +I          + ++    + KA++LD N S  Y +R      L
Sbjct: 7   EDIAKAVEFKNEGNVFI-------KEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKL 59

Query: 411 QNYDQAGKDFDKAKELDPENIFPY 434
            N+  A  D ++A  LD +N+  Y
Sbjct: 60  DNFQSAYNDCNEALTLDSKNVKAY 83

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYVSVGDLKKVV 152
           E  + A ALK +GN+    K Y+ AIK Y  A+  L  + V+++N +A Y S+    + V
Sbjct: 95  EASEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAV 154

Query: 153 EMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           E +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 155 EDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 71/137 (51%), Gaps = 7/137 (5%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           A + K +GN+    K Y  AI+ Y+ A++ L  + ++Y+N +A Y SV +    ++ + K
Sbjct: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAM-FDLSVLSLNGDFNDASIEPMLERNLNKQAM 216
           A+E+ P YSK   R A A   L    +A+ +   VL + GD       P ++R+  + A 
Sbjct: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD----KATPAMKRDF-EMAK 213

Query: 217 SRLKEKFGDIDAATATP 233
           +R++       ++T TP
Sbjct: 214 NRVESSMNLEKSSTTTP 230

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP---VFYSNLSACYVSVGDLKKVVEMS 155
           A+A K++GN Y + + Y  AI+ Y+ A+EL  DP   +F+SN +   + + + +  +   
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 156 TKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             AL L P   K   RR  ++ GL     A  DL V+
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 6/113 (5%)

Query: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFD 188
           KE  V + N    Y+   +  K +E+ ++A+EL P  S     RA A   L NF   M D
Sbjct: 9   KEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMND 68

Query: 189 LSV-LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAA-TATPTELSTQ 239
             V L L    +  +I+    R L+   + + K+   D+     A PT+ + +
Sbjct: 69  CDVALRL----DPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDATAK 117

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP-----VFYSNLSACYVSVGDL 148
           E  + A   K++GN+ ++ K+Y DA + YN  +E+K D        +SN +AC + + + 
Sbjct: 73  EPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNY 132

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ V    +AL+  P   K   R A A   L    DA   +    L  D   A+++ +L+
Sbjct: 133 RRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQ 191

Query: 209 RNLNKQ 214
           + + ++
Sbjct: 192 KVIKRE 197

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 93  EEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKV 151
           EE    A  LK +GN+    K +D AI  Y+ A+ +   + ++Y+N +A Y S+ D +K 
Sbjct: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKA 152

Query: 152 VEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            E +  A+ + P+YSK   R   A   L    +A+     VL L GD
Sbjct: 153 TEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 1/113 (0%)

Query: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           NY  ++L++D  +S+ +YH G+++ I  +Y+ A + F +A   D  N   +  +  L Y+
Sbjct: 273 NYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQ 332

Query: 444 ENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFDKALKQYDLAIELE 495
             ++ D    ++ A R  P   EV      +  T  N    AL  Y  A  LE
Sbjct: 333 IYQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLE 385

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP---VFYSNLSACYVSVGDLKKVVEMS 155
           A + KD+GN++ + + +  A + Y  A+E   DP   +FYSN +   + + +    +   
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 156 TKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           T A+EL     K   RR  AN GL NF  A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 55/130 (42%), Gaps = 26/130 (20%)

Query: 340 KFLKN-DPLGAHEDITKAIDLFP--------RVNSYIYMALIMADRNDSTEYYNYFDKAL 390
           KFLK  D   A+E  TKAI+  P        R  + + +   M   ND T        A+
Sbjct: 18  KFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCT-------NAI 70

Query: 391 KLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDC 450
           +L+ +N   Y+ RG  N  L N+  A  DF+   +  P +I            +N FD C
Sbjct: 71  ELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA----------KNGFDTC 120

Query: 451 ETLFSEAKRK 460
           E +  E + K
Sbjct: 121 EKVIREERFK 130

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query: 85  SKKADFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSAC 141
           S K +  AE+ +  A A  LK +GN+    K +D AIK Y+ A+E L  + V+Y+N +A 
Sbjct: 81  SIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAA 140

Query: 142 YVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           + S+   ++ ++ +  A++  P YSK   R   A   LG   DA+     VL + GD
Sbjct: 141 HSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-----FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA   Y  AL++K D +      Y NL+AC + + + 
Sbjct: 65  EPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNY 124

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186
           +  +    +AL+L     K   R   A   LG F D++
Sbjct: 125 RSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 2/111 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN   + + Y  AI+ Y  A++L +   +++SN +  ++ + + +  +    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ALE+ P   K   RR  +  GL  F +A  DL ++ L    NDA+ +  L+
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV-LASKPNDATAKRGLD 121

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           + +A+KLD   S  + +R   +  + N+     D DKA E+DP+NI  Y
Sbjct: 35  YTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPKNIKAY 83

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 85  SKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYV 143
           + K +F+ ++K + A   KD+GN+   ++ Y  AI+ Y  A+ +   DP++YSN S  Y+
Sbjct: 124 TSKNNFSDKDK-QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186
            V D +  +  +   + +  ++SK  +R A+       + DA+
Sbjct: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           A A K +GN+    K +  A++ Y  A++ L  + ++Y+N +A + S+ + ++ ++ +  
Sbjct: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           A+++ P YSK   R A A  GLG   +A+     VL + GD
Sbjct: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 71/141 (50%), Gaps = 14/141 (9%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK--EDPV---FYSNLSACYVSVGDL 148
           E  + A   K++ N  ++ K++ +A + Y   +E+K  +D V    ++NL+AC + + + 
Sbjct: 73  EPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNF 132

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA----MFDLSVLSLNGDFNDASIE 204
           ++ + +  KAL+  P   K   R A A   L    +A     F L++ S N      ++E
Sbjct: 133 RRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSLQ--TLE 190

Query: 205 PMLERN---LNKQAMSRLKEK 222
            +++R    L++  + RL+EK
Sbjct: 191 GVIDRKQQELHEAEVKRLEEK 211

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL LK++GN++ + K Y  A +YY  A+E   E+ + YSN +   + + + +  ++ + +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKR 72

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A+EL  +  K   RRA +  GL  F  A  DL ++
Sbjct: 73  AIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKK 150
           AE K K A ALK +GN+   +K YD A++ Y  A++ L  + V+++N +A Y +  +  +
Sbjct: 95  AETKAK-AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDE 153

Query: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            V+ + +A++L P YSK   R A A     NF +++     VL + GD
Sbjct: 154 AVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+K+   N+  + +R       QNYD+A KD ++A +LDP     Y +LA   Y + 
Sbjct: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183

Query: 446 KFDDC 450
            F++ 
Sbjct: 184 NFEES 188

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 3/127 (2%)

Query: 378 DSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D  +  NY  K+L++D ++++ +YH G+++ +  +Y  A   F +A   D  N   +  +
Sbjct: 296 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSI 355

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFDKALKQYDLAIELEN 496
             L Y+ +++ D    ++ A R  P   EV      +  T  N    AL  Y  A  L+ 
Sbjct: 356 GVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP 415

Query: 497 KLEGIYV 503
             E I++
Sbjct: 416 --ENIHI 420

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 34/128 (26%)

Query: 103 KDKGNQYFRNKKYDDAIKYY---------NWALELKEDPVFYSNLSACYVSVGDLKKVVE 153
           KD+G ++F+   Y  A + Y         N AL +    V YSNL+A    VG+ K+ + 
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332

Query: 154 MSTKALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVL 192
               ALE+ P                      + K++ RRA A E + N+  A+ D   L
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

Query: 193 SLNGDFND 200
               +FND
Sbjct: 393 IEKNNFND 400

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%)

Query: 378 DSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D  +  NY  K+L++D ++++ +YH G+++ I  +Y  A   F +A   D  N   +  +
Sbjct: 285 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEV 467
             L Y+ +++ D    ++ A R  P   EV
Sbjct: 345 GVLYYQISQYRDALDAYTRAIRLNPYISEV 374

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 74/184 (40%), Gaps = 13/184 (7%)

Query: 368 YMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELD 427
           Y +LI     D  E    F+KA  LD   +  Y  +G  +   + YD A   + KA   D
Sbjct: 530 YFSLI----KDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACD 585

Query: 428 PENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQ 487
           P++   Y  L   A R  K+D     F +A+   P    +       L   N  D+AL  
Sbjct: 586 PQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILICCCGHSLEKLNLPDQALTY 645

Query: 488 YDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIG 547
           Y+LA +L+ ++        P   KA LL    ++  F  A  + E  +KL P        
Sbjct: 646 YELAEKLQPEM------TIPKYKKAQLLF---SLGKFSSAMYIFESLTKLSPEEVTVHFM 696

Query: 548 LAQM 551
           L Q+
Sbjct: 697 LGQI 700

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 73/178 (41%), Gaps = 34/178 (19%)

Query: 404 GQMNFILQNYDQAGK------DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS-- 455
           G++++ + NY    +       F   +   P N F  +    L +  +KF    TLF+  
Sbjct: 459 GKLHYEISNYGIVAEILPELTKFPTYENEGPGNFFQLL----LWHLRDKF----TLFNLS 510

Query: 456 -EAKRKFPEAPE----VPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVG 510
            E    FPEAPE    V N+F+ I     D  +A+K ++ A  L+ K    Y     L G
Sbjct: 511 DELMNSFPEAPETWCVVGNYFSLI----KDHGEAIKAFEKATSLDRKFAYAYT----LQG 562

Query: 511 KATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEES 568
                  +   E +  A  +  KA   DP+   A  GL     +    D+A+  FE++
Sbjct: 563 H-----EHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKA 615

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%)

Query: 385 YFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRE 444
           YF+KA  ++  N+ +    G     L   DQA   ++ A++L PE   P  + A L +  
Sbjct: 611 YFEKARVINPVNAILICCCGHSLEKLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSL 670

Query: 445 NKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
            KF     +F    +  PE   V     +I         A+K+Y +A+ L+
Sbjct: 671 GKFSSAMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIKEYTIALNLD 721

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F L NYD +   F   ++L P  +      + L +  +       L +E     P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
           AP+        L+ + D + A+K ++ A +++      Y     L G       + + ++
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYT----LQGH-----EHSSNDS 584

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
           F  A N   KA   DP+   A  GL    ++    DEA+  FE++  +
Sbjct: 585 FDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 12/110 (10%)

Query: 337 GIFKFLKNDPLGAHEDITKAIDLFPRVN-SYIYMALIMADRNDSTEYY----NYFDKALK 391
           G F  L+ D    HED  KA +   +V+ ++ Y   +    + S + +    N + KAL 
Sbjct: 542 GNFLSLQKD----HEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALA 597

Query: 392 LDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441
            D  + + YY  G     L  YD+A   F+KA+ ++P N+   I + C  
Sbjct: 598 CDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV---ILICCCG 644

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%)

Query: 365 SYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAK 424
           ++  M   ++ + D  +    F+KA ++D N +  Y  +G  +    ++D A   + KA 
Sbjct: 537 TWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKAL 596

Query: 425 ELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKA 484
             DP++   Y  L     +  ++D+    F +A+   P    +       L      +KA
Sbjct: 597 ACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKA 656

Query: 485 LKQYDLAIELE 495
           L  Y+LA EL+
Sbjct: 657 LSYYELACELQ 667

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA + YN A+++K D        Y+N +AC + + + 
Sbjct: 69  EPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNY 128

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA 185
           ++ +     AL L P   K   R A A   +  F D 
Sbjct: 129 RRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 378 DSTEYYN-YFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ 436
           D+ E YN   D     D  N S+Y +R      L+NY +   D   A  L+P+NI  Y +
Sbjct: 92  DARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFR 151

Query: 437 LACLAYRENKFDDC 450
           +A       KFDDC
Sbjct: 152 MAKAFLAIEKFDDC 165

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 79/180 (43%), Gaps = 17/180 (9%)

Query: 81  EPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE------DPVF 134
           EP  S+K      E+   A+ LK +GN+    + Y DAI  Y  A++L +      D  +
Sbjct: 69  EPKLSEKERELVNEQ---AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125

Query: 135 YSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLS 193
            SN S      G  ++  + +   +++ P +SK   R A A  G   + DAM     VL 
Sbjct: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFG-DIDAATATPTELSTQ--PPKERKDKQES 250
           L G  N A+     +  + KQ    L   F   ID+ +ATP   +    PPK+ + +  S
Sbjct: 186 LEG--NKATDTMKRDFEITKQKFETL--NFSTHIDSGSATPISEAANKYPPKDEEIRTRS 241

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K++GN+ F+   Y  A + Y   ++++ E+P+ YSN +   + +G   +VVE+  K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 162 KPDYSKVLLRR 172
            P+ +  + ++
Sbjct: 67  TPNTTDTVYKK 77

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN + + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           AL+L P   K   RRA +   L  F  A  DL+VL
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LD   S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKK 150
           AE K K A ALK +GN+    K ++ AI  Y+ A+E L  + ++Y+N +A + S+    +
Sbjct: 87  AETKAK-AEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDE 145

Query: 151 VVEMSTKALELKPDYSKVLLR 171
            V  + KA+E+ P YSK   R
Sbjct: 146 AVVDAEKAIEIDPAYSKGYSR 166

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+++   N+  Y +R   +  L+ YD+A  D +KA E+DP     Y +L    Y +N
Sbjct: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175

Query: 446 K 446
           K
Sbjct: 176 K 176

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ +QNY  A   F++ + + P  +      + L +  +       L +E    FPE
Sbjct: 433 GKLHYEIQNYKMALSHFERLRIIQPTRLNDLEIFSTLLWHLHDKVKLSNLANELIDNFPE 492

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
           A +         + + D D+A+K ++ A EL+ +    Y     L G         + E+
Sbjct: 493 AAQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYT----LQGHEY-----ASNES 543

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEES 568
           F  A     KA   D +   A  GL     Q  + D ++  FE++
Sbjct: 544 FDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKA 588

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 101 ALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
            +K++GN  FRN  +  A +YY   + L+ E+P+ YSN +   + +    + ++   + L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 160 -------ELKPDYSKVLLRRASANEGLGNF 182
                  + +P   K+L R   A E L  F
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK KGN +F+N  Y+ AI YY  A  L   +P+++SN++   + +   ++ V    K L
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK+ GN+ ++ K Y+ A+ Y+  AL        + YSN +A ++ +    + +E     +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           EL P++ K   R   A  GL    +A
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G Q+F N++Y  A+K Y   ++     PV + N +A +  +    +V++   KA+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 165 YSKVLLRRASA 175
           Y K  +R+  A
Sbjct: 496 YIKAYVRKGFA 506

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 82  PDFSKKADFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNL 138
           P  S K +   E+ +  A A  LK +GN+    K ++ A+  Y+ A++ L  + V+Y+N 
Sbjct: 78  PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANR 137

Query: 139 SACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186
           +A + S+   ++ V+ +  A+++ P YSK   R   A   LG   +A+
Sbjct: 138 AAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKK 150
           AE K K A  LK +GN+   NK+Y+ AIK Y  A++ L  + ++Y+N +A + S+ +  +
Sbjct: 96  AETKAK-AEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDE 154

Query: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            ++ +  A+ + P Y +   R   A    G   +A+     VL + GD
Sbjct: 155 AIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 2/103 (1%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLK 149
           TA ++ K AL  K++GN + + K +  AI+ Y  A++L     +++SN +  +  V + +
Sbjct: 5   TAADRAK-ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQ 63

Query: 150 KVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             +    +A++L P   K   RRA +   L  F  A  DL+VL
Sbjct: 64  SALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LD   S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 531

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D D A+K ++ A +L+      Y     L G       + + ++
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 582

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
              A     KA   DP+   A  GL    ++    +EA+  FE++  +
Sbjct: 583 SDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 375 DRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D +DS +    + KAL  D  + + YY  G  +  L  Y++A   F+KA+ ++P N+   
Sbjct: 581 DSSDSAK--TCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV--- 635

Query: 435 IQLAC-------LAYRE 444
           + + C       L Y+E
Sbjct: 636 VLICCCGGSLEKLGYKE 652

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 68/168 (40%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ + NY+ A   F +  EL P  I      + L +    +    +L       +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            PE        L+ K D + A++ ++ A +++ K    Y     L G         + ++
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYT----LQGHEC-----SSNDS 600

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
           F  A     KA   DPR   A  G+    ++    DEA+  FE++  +
Sbjct: 601 FDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA K+D   +  Y  +G       ++D A K F KA   DP +   Y  +   + +  
Sbjct: 574 FEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLG 633

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
            +D+    F +A++ +P    +       L      DKAL+ Y+LA  L+
Sbjct: 634 HYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKALEYYELACTLQ 683

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 77/200 (38%), Gaps = 41/200 (20%)

Query: 336 TGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDSTEYYN----YFDKALK 391
            G +  LK D   A E   KA  + P+   + Y   +      S + ++     F KA+ 
Sbjct: 557 VGNYLSLKKDHEDAIEAFEKATKIDPK---FAYAYTLQGHECSSNDSFDAAKKCFRKAIA 613

Query: 392 LDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI-------------------F 432
            D  + + YY  G  +  L +YD+A   F+KA+++ P N                     
Sbjct: 614 CDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKAL 673

Query: 433 PYIQLAC---------------LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
            Y +LAC               L Y   +++     F E  +  PE P V     ++   
Sbjct: 674 EYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQI 733

Query: 478 KNDFDKALKQYDLAIELENK 497
               ++A++++ +A+ L+ K
Sbjct: 734 MGRKNEAIREFTVAMNLDPK 753

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 86/202 (42%), Gaps = 22/202 (10%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  +R ++Y DA + YN  +E+  D        + N +AC + + + 
Sbjct: 75  EPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNH 134

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ +    +AL   P   K   R   A   L    +A   +    L  D N+A++  +L+
Sbjct: 135 RRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLD 193

Query: 209 RNLNK-----------QAMSRLKEKFGDIDAATATPTELS----TQPPKERKDKQESLPS 253
           + + K           +   + KE+ G I  A      +S    +QPP+  KD + SL +
Sbjct: 194 KIVKKDEEIKAYEAKKENEKKEKERLGAILQAAVVVRNISIVNTSQPPELVKDAKISLEN 253

Query: 254 VTSMASFFGIFKPELTFANCDE 275
              + S   IF   + +   DE
Sbjct: 254 EEDIESQL-IFPSMVMYPTTDE 274

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 479 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 538

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D D A+K ++ A +L+      Y     L G       + + ++
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 589

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
              A     KA   DP+   A  GL    ++    +EA+  FE++  +
Sbjct: 590 SDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA +LD N +  Y  +G  +    + D A   + KA   DP++   Y  L   A +  
Sbjct: 563 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLG 622

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
           ++++    F +A+   P    +       L      +KAL+ Y+LA  L+
Sbjct: 623 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 672

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 5/84 (5%)

Query: 93  EEKDK----YALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGD 147
           EE+DK     A ALK +GN+    K Y+ A++ YN A++L     V+Y+N +A Y S   
Sbjct: 93  EEEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEK 152

Query: 148 LKKVVEMSTKALELKPDYSKVLLR 171
             + ++ +  A++++P++SK   R
Sbjct: 153 YDEAIKDAESAIKVEPNWSKGYSR 176

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 6/126 (4%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-----FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA + YN  +E+K D        Y+N +AC + + + 
Sbjct: 73  EPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNY 132

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ +     AL+  P   K   R   A   L    +A   +    L  D ++  ++ +L+
Sbjct: 133 RRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLD 191

Query: 209 RNLNKQ 214
             L KQ
Sbjct: 192 IVLKKQ 197

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            KD+G +YF+   Y  A + Y  +L    K  P   +  SNL A  +  GD   ++ +ST
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            AL+L P                      +SK++ RRA A E + N+  A     +L  N
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIEN 519

Query: 196 GDFND 200
             FN+
Sbjct: 520 NIFNE 524

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 4/126 (3%)

Query: 354 TKAIDLFPRVNSYIYMALIMA--DRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQ 411
           T+AI +  R  ++ Y  + +A  +R   +E   +F  AL++D N+   +   GQ  F   
Sbjct: 674 TEAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACG 733

Query: 412 NYDQAGKDFDKAKELDPENIFP-YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNF 470
             + + K F+KA E+DP +++  Y     LA     F++C  +     +  PE       
Sbjct: 734 RVEASTKVFEKAIEIDPLHLYAQYFNSLSLA-EMGCFEECIEILKNITQLNPEELAFQVS 792

Query: 471 FAEILT 476
           ++ IL 
Sbjct: 793 YSSILV 798

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 484 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIYSTLLWHLHDKVKSSNLANGLMDTMPN 543

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D D A+K ++ A +L+      Y     L G       + + ++
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 594

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
              A     KA   DP+   A  GL    ++    +EA+  FE++  +
Sbjct: 595 SDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC------ 439
           + KAL  D  + + YY  G  +  L  Y++A   F+KA+ ++P N+   + + C      
Sbjct: 602 YRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 658

Query: 440 -LAYRE 444
            L Y+E
Sbjct: 659 KLGYKE 664

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN++++ K+Y DA + Y   +++K D        Y+N +AC + + + 
Sbjct: 69  EPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNF 128

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASA 175
           +K +E   KAL       K   R   A
Sbjct: 129 RKCIEDCKKALSFNVKNIKCYYRMGKA 155

>YLR072W Chr12 (278862..280943) [2082 bp, 693 aa] {ON} Protein of
           unknown function; green fluorescent protein (GFP)-fusion
           protein localizes to the cytoplasm in a punctate
           pattern; YLR072W is not an esssential gene
          Length = 693

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQES 250
           +S   D+N +S I+PM+E N     +S  K+    ++       ELS    KE+ D  + 
Sbjct: 533 ISFWVDWNASSWIKPMVESNCKNGQISATKDLVKLVEEFVEKYVELS----KEKADTLKP 588

Query: 251 LPSVTSMASFFGIFKPELTFANCDESNEADKEL 283
           LPSVTS  S   +  PELT    +   EA+ E+
Sbjct: 589 LPSVTSFGSPRKVAAPELTMVQPESKPEAEAEI 621

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 26/122 (21%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKAL 159
           +G+ +F+N  Y  A++ Y  +L    +  P   + YSN++A  + +G+   +V+ + KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 160 ELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDF 198
           +L P                      +SK++LR+A A E L NF  A      L  N  F
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482

Query: 199 ND 200
           +D
Sbjct: 483 SD 484

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  +R K+Y DA + YN  +++K D        +SN +AC + + + 
Sbjct: 73  EPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNY 132

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA 185
           ++ V    +AL+      K   R A A   L    DA
Sbjct: 133 RRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN + + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A++L P   K   RRA +   L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LD   S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ L P  S+V     +  E   N      D  
Sbjct: 329 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 388

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPP 241
             +   D N+  I   LE      A+++  E  G+I+ +   PT  S  PP
Sbjct: 389 KQAARLDVNNVHIRERLE------ALTKQLENPGNINKSNGAPTNASPAPP 433

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVF-----YSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y   L ++ +  F     ++N +AC + + + 
Sbjct: 78  EPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNY 137

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASA 175
           ++ +E  +KAL + P  +K   R + A
Sbjct: 138 RRCIEDCSKALSINPKNTKCYYRTSKA 164

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYN--WALELKEDPV---FYSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y+   A+E ++  +    Y+N +AC + + + 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNY 137

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASA 175
           ++ +E  +KAL + P   K   R + A
Sbjct: 138 RRCIEDCSKALTINPKNVKCYYRTSKA 164

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 396 NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS 455
           N S+Y +R      L+NY +  +D  KA  ++P+N+  Y + +   ++ NK ++ ++  +
Sbjct: 120 NESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAAT 179

Query: 456 EAKRKF-PEAPEVPNFFAEILTDKNDFD-KALKQYDLAIELENK 497
            A ++  PE   + N  + I   + +   K  KQ   A E ENK
Sbjct: 180 FANQRIDPENKSILNMLSVIDRKEQELKAKEEKQQREAQERENK 223

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK KGN  F+N  Y +AI +YN  + +   +P+ YSN +   +      + +    K L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 161 L 161
           L
Sbjct: 66  L 66

>Smik_12.132 Chr12 (258696..260786) [2091 bp, 696 aa] {ON} YLR072W
           (REAL)
          Length = 696

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (51%), Gaps = 5/93 (5%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQES 250
           +S   D+N +S I+PM+E N     +S  K+    ++       ELS    KE+ D  ++
Sbjct: 536 ISFWVDWNASSWIKPMVESNCKNGQISATKDLVKLVEEFVEKYVELS----KEKADALKT 591

Query: 251 LPSVTSMASFFGIFKPELTFANCDESNEADKEL 283
           LPSVTS  S   +  P+LT A  +   EA+ E+
Sbjct: 592 LPSVTSFGSPRKVAVPQLTSAQPESKPEAEIEI 624

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            +++G QYF+N  Y  + + Y  +L       P   + YSN+ A  + +G+  K ++ S+
Sbjct: 406 FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSS 465

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            ALE+ PD                     + KV LR+A A E + +F  A+     L   
Sbjct: 466 SALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAALSSYQELIEK 525

Query: 196 GDFND 200
           G  ND
Sbjct: 526 GFAND 530

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+    + VE +  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 161 LKPDY 165
           + P Y
Sbjct: 165 IDPTY 169

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+K+   N+  Y +R   +  L+ YD+A +D + A  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           A ALK +GN+    K ++ AI  Y+ A+  L  + V+++N +A Y S+    + VE +  
Sbjct: 98  AEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEA 157

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAM 186
           A+++ P YSK   R   A   LG   +A+
Sbjct: 158 AIKVNPSYSKGYSRLGFAQYALGRPEEAL 186

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 73/162 (45%), Gaps = 30/162 (18%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            K KG+ +F+N  Y ++++ Y  +L       P   +  SN+ A  + VG+  K +E S+
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            AL L P                      + K+++RRA + E L +F++A+     L +N
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQEL-IN 495

Query: 196 GDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATAT--PTE 235
            +F D  I     R  N      +K KF  +  AT+T  PTE
Sbjct: 496 KNFFDEKIMQGKRRCQNFINPPPVK-KFSPVKKATSTQSPTE 536

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSN 137
            K +GNQYF+   Y  AIK Y   +E+  E+P+ YSN
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSN 42

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-----FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA + Y   +E+K D        Y+N +AC + + + 
Sbjct: 73  EPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNF 132

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA 185
           +  +     AL   P   K   R   A   +  F  A
Sbjct: 133 RSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 70/169 (41%), Gaps = 27/169 (15%)

Query: 378 DSTEYYN------YFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           ++ E+YN      +  K+L+LD  +S+ +Y+ G+++   +++  A +   +A   D  N 
Sbjct: 389 ENVEFYNLDIAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNP 448

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND-FDKALKQYDL 490
             +  +  L Y+  +  D    ++ A R  P   EV      +    ND    AL  Y+ 
Sbjct: 449 IFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYER 508

Query: 491 AIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDP 539
           A+ L+                      NP ++  + A  + +K S+ DP
Sbjct: 509 ALSLD--------------------PENPVIQGRLNALKIQDKKSEYDP 537

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 79/175 (45%), Gaps = 18/175 (10%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYY--NWALELKEDPV---FYSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y    A+E ++  +    ++N +AC + + + 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNY 137

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ +E  +KAL + P   K   R + A   L    +A            F + SIEP  +
Sbjct: 138 RRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA-------KSAAIFANQSIEPENK 190

Query: 209 RNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPSVTSMASFFGI 263
             LN  ++   KE+   I        +   Q  +ER++K+  L S  ++ +   I
Sbjct: 191 SILNMLSVIERKEQELKIKE------QKKQQEAQERENKKIMLESAMTLRNITNI 239

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ L P  S+V     +  E   N      D  
Sbjct: 331 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 390

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPP 241
             +   D N+  I   LE      A+++  E  G+++ +   PT  S  PP
Sbjct: 391 KQAARLDVNNVHIRERLE------ALTKQLENPGNMNKSNGAPTNASPAPP 435

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN + + + +  A + Y  A+EL +   +F+SN +  ++   + +  +    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           ALEL     K   RR  +  GL  F  A  DL  +
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164

Query: 161 LKPDY 165
           + P Y
Sbjct: 165 IDPSY 169

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+K+   N+  Y +R   +  L+ YDQA KD + A  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 68/168 (40%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ L NY+ + + F   K L P  +      + L +  N       L SE     P 
Sbjct: 467 GKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPR 526

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            PE        L+ + +  +A+K ++ A +++ K    Y     L G         + ++
Sbjct: 527 IPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYT----LQGH-----EYTSSDS 577

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
           F  A     KA   DP    A  GL  + ++    +EA+  FE++  +
Sbjct: 578 FDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 56/146 (38%), Gaps = 34/146 (23%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI-------------- 431
           + KA+  D  + + YY  G ++  L  Y++A   F+KA+ ++P N+              
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLS 644

Query: 432 -----FPYIQLAC---------------LAYRENKFDDCETLFSEAKRKFPEAPEVPNFF 471
                  Y +LAC               L Y   ++      F E K   P+   V    
Sbjct: 645 YQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLL 704

Query: 472 AEILTDKNDFDKALKQYDLAIELENK 497
            +I +       A+K+Y +A+ L+ K
Sbjct: 705 GQIYSILGRKKDAIKEYTIALNLDPK 730

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-----DPVFYSNLSACYVSVGDL 148
           E  + A   K +GN  ++ K++ DA + Y+  +++K      +   Y+N +AC + + + 
Sbjct: 76  EPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNY 135

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186
           ++ +    +AL+L P   K   R A A   L    +A+
Sbjct: 136 RRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 378 DSTEYYNY-FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ 436
           D+ E Y+   D   +++  N S+Y +R      ++NY +   D  +A +L+P+NI  Y +
Sbjct: 99  DARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYR 158

Query: 437 LA 438
           +A
Sbjct: 159 IA 160

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNL-----SACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA   YN  +E+K D    S L     +AC + + + 
Sbjct: 72  EPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNY 131

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASA 175
           ++ +    +AL+L P   K   R   A
Sbjct: 132 RRCINDCREALKLNPKNPKAFFRIGKA 158

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 93/214 (43%), Gaps = 14/214 (6%)

Query: 363 VNSYIYM-ALIM--ADRNDSTEYYNYFDKALKLDLNNSSVYYHR--GQMNFILQNYDQAG 417
           +N  +Y+ ALI+  A + DS +    FD  L   + N+  +     G+++F + NY  + 
Sbjct: 483 LNDILYIFALILKSASQFDSYKAIRLFDSKLPKQIKNNMPWCQAQLGKLHFEIVNYKTSL 542

Query: 418 KDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
           K F K + L P  I      + L +  +   +   L +    +F + PE       + + 
Sbjct: 543 KYFKKLRLLQPTRIKDLETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLFSL 602

Query: 478 KNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKL 537
           + D D+A++ +D A     KL+  +V    L G   L     +++++  A     KA   
Sbjct: 603 QKDHDEAIRAFDKA----TKLDPNFVYAYTLQGHEYL-----SMDSYDTAKTFYRKAISN 653

Query: 538 DPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
           D     A  G+    ++  + ++A+  FE++  +
Sbjct: 654 DLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSI 687

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 8/107 (7%)

Query: 350 HEDITKAIDLFPRVN-SYIYMALIMADRNDSTEYYN----YFDKALKLDLNNSSVYYHRG 404
           H++  +A D   +++ +++Y   +      S + Y+    ++ KA+  DL++ + YY  G
Sbjct: 606 HDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMG 665

Query: 405 QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCE 451
             +  L  Y+QA   F+KA+ ++P N    I + C      K  + E
Sbjct: 666 MCSMKLGEYEQALVYFEKARSINPSNA---ILICCCGVTMEKLGNQE 709

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 49/118 (41%)

Query: 378 DSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D  E    FDKA KLD N    Y  +G     + +YD A   + KA   D  +   Y  +
Sbjct: 605 DHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGM 664

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
              + +  +++     F +A+   P    +       +    + +KAL  Y+LA +++
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQ 722

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  ++ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164

Query: 161 LKPDY 165
           + P Y
Sbjct: 165 IDPSY 169

>Skud_12.137 Chr12 (263617..265713) [2097 bp, 698 aa] {ON} YLR072W
           (REAL)
          Length = 698

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQES 250
           +S   D+N +S I+PM+E N     ++  K+    ID       ELS    KER D  ++
Sbjct: 537 ISFWVDWNASSWIKPMVESNCKNGQITATKDLVKLIDDFVDKHVELS----KERADALKA 592

Query: 251 LPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYK 292
           LPSV S  S   +   EL     +   EA+ E+     N ++
Sbjct: 593 LPSVASFGSPRKVVAAELAVTQPETKPEAEVEVSQTGGNRWR 634

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K++GN   + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +A++L
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 162 KPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            P   K   RRA +   L  F  A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LD   +  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 34.7 bits (78), Expect = 0.17,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K++GN  F+   Y +A+  Y+  +  + ++PV YSN +   + +G+  + ++M  + L  
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 162 KPDYSKVLLR 171
                 V +R
Sbjct: 68  TSTAEHVAIR 77

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDSTEYY----NY 385
           +IS    G +  L ND   A + + KA  + PR   + Y   +      S + +    N 
Sbjct: 618 SISWCFIGNYFSLINDHDKAIKYLKKATTINPR---FTYAYTLEGHEQASIDAFDTAKNC 674

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441
           + KA+  D N+ + YY  G     L  YDQA   F+KAK ++P N    I L C  
Sbjct: 675 YRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCCCG 727

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 73/197 (37%), Gaps = 26/197 (13%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPEN-----IFPYIQLACLAYRENKFDDCETLFSEAK 458
           G++ F + NY  +   F K  +L P       IF  + L  L  + N     +TL     
Sbjct: 557 GKLQFEIVNYKLSINYFKKLYDLQPTRLKDFEIFSTV-LWHLKDKINLSQISKTLIDNYP 615

Query: 459 RKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRN 518
                   + N+F+ I    ND DKA+K    A  +  +    Y     L G        
Sbjct: 616 NNSISWCFIGNYFSLI----NDHDKAIKYLKKATTINPRFTYAYT----LEGH-----EQ 662

Query: 519 PTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEES-------ADL 571
            +++ F  A N   KA   DP    A  GL    ++    D+A+  FE++       A L
Sbjct: 663 ASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNAIL 722

Query: 572 ARTMEEKLQAITFAEAA 588
                  L+ + F E A
Sbjct: 723 LCCCGSALEKLNFNEKA 739

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKK 150
           AE K K A +LK +GN+    K Y+ AIK Y+ A+ +   + V+Y+N +A + S+ +  +
Sbjct: 87  AELKSK-AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDE 145

Query: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            ++ +  A+++   YSK   R   A    G   +A+     VL + GD
Sbjct: 146 AIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441
           NYF KA+  D  + + YY  G  +  L  ++ A   F+KA+ ++P N+   I + C  
Sbjct: 620 NYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNV---ILICCCG 674

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G ++F + NY+ + K F+K ++L P  +      + L +  +       L +E  ++F  
Sbjct: 504 GMLHFEIVNYEMSLKYFEKLRKLQPTRLKDLETYSTLLWHLHDKIKLTVLSNELLKEFKN 563

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            P+       + + + D  +A+K    A E   KL+  +     L     L     + ++
Sbjct: 564 EPQTWCCLGNLFSLQKDHKEAIK----AFEKVTKLDPTFTYGYTLQAHEYL-----SDDS 614

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
           F  A N   KA   D +   A  G+    ++  + + A+  FE++  +
Sbjct: 615 FDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSI 662

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 69/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 490 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDIMPN 549

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D D A+K ++ A +L+      Y     L G       + + ++
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 600

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
              A     KA   D +   A  GL    ++    +EA+  FE++  +
Sbjct: 601 SDSAKTCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 648

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 375 DRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D +DS +    + KAL  D  + + YY  G  +  L  Y++A   F+KA+ ++P N+   
Sbjct: 599 DSSDSAK--TCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV--- 653

Query: 435 IQLAC-------LAYRE 444
           + + C       L Y+E
Sbjct: 654 VLICCCGGSLEKLGYKE 670

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  F  K++ +A   YN  +E+K +        ++N +AC + + + 
Sbjct: 75  EPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNY 134

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA 185
           +  +     AL L P   K   R   A   L N  +A
Sbjct: 135 RSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 55/125 (44%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            + KG + F+   Y  A+  Y  +L    ++ P   +  SN+   Y+ +G+  K ++++ 
Sbjct: 293 FRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAP 352

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            ALEL P+                     +SK+++R A A E   N+  A  +  +L  N
Sbjct: 353 LALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVAN 412

Query: 196 GDFND 200
           G  N+
Sbjct: 413 GITNE 417

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN +F+   Y  A  YY+  ++L+  +P+ YSN +   +  G+    VE   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 161 LKPDYSK 167
                +K
Sbjct: 66  YTSSSTK 72

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYY--NWALELKEDPV---FYSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y    A+E ++  +    ++N +AC + + + 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNY 137

Query: 149 KKVVEMSTKALELKPDYSKVLLR 171
           +K VE   KAL + P   K   R
Sbjct: 138 RKCVEDCGKALTINPKNIKCYYR 160

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  ++ N  YD  +  +  AL +K +D + ++ L A   +    ++ ++   KAL+LKP 
Sbjct: 426 GILFYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 485

Query: 165 YSKVLLRRASANEGLGNFADAM-FDLSVLSLN 195
           + +     A +   +G F +A  + L+ LS++
Sbjct: 486 FVRARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171
           N+ ACY  + DLK  + +S K+L+L PD +K  +R
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIR 117

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 33.1 bits (74), Expect = 0.53,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K++GN+ ++   Y DAI  Y+  +  + ++PV +SN +   + +G+  + +E   + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 162 KPDYSKVLLR 171
                   LR
Sbjct: 68  AASPQHAALR 77

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           NL+AC+  + DLK+ +  S K ++L+P   K  +RR    + LG
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLG 115

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/168 (17%), Positives = 71/168 (42%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ + NY+++   F++ + + P         + L +  +       L +E     P 
Sbjct: 421 GKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPN 480

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
            P+       + + + D + A+K ++ A +++      Y     L G     + N +++ 
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYT----LQGHEH--SSNDSIDT 534

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
              A N   +A   DP+   A  GL    ++    D+A+  FE++ ++
Sbjct: 535 ---AKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNI 579

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 57/131 (43%)

Query: 365 SYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAK 424
           ++  +  + + + D  +   YF+KA K+D N +  Y  +G  +    + D A   + +A 
Sbjct: 484 TWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRAL 543

Query: 425 ELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKA 484
             DP++   Y  L     +  ++D     F +A+   P    +       L   +  +KA
Sbjct: 544 ACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQEKA 603

Query: 485 LKQYDLAIELE 495
           L+ Y+ A EL+
Sbjct: 604 LQYYEQACELQ 614

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK--EDP---VFYSNLSACYVSVGDLKKVVEMST 156
            K KG   F+N  Y ++++ Y  +L       P   +  SN+ A  + +G+  K +E S+
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186
            ALEL P                      + K+++RRA + E L +F  A+
Sbjct: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 2/98 (2%)

Query: 381 EYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP-YIQLAC 439
           E   +F  AL++D N+   +   GQ  +     + + K F+KA EL P+++F  Y +   
Sbjct: 696 ESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDHLFAGYFKAIS 755

Query: 440 LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
           LA    +++ C  + +    K P           IL D
Sbjct: 756 LA-GIGEYEQCIEIIAALLEKLPNEESFQVSMVNILID 792

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELKEDPV-FYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  Y   +K  ++I+++  AL +  + V  +  L   Y + G L+  +++  KA EL PD
Sbjct: 685 GVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPD 744

Query: 165 YSKVLLRRASANEGLGNFADAM 186
           +      +A +  G+G +   +
Sbjct: 745 HLFAGYFKAISLAGIGEYEQCI 766

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K  GN YF++  Y  A++YY   +E++ E+P+ YSN +   + +    + +E     L+ 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 162 KPD 164
             D
Sbjct: 67  VND 69

>NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3.5
           YOL145C
          Length = 1087

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 83/187 (44%), Gaps = 35/187 (18%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACL---------------AYREN--- 445
           G   + L++Y  A K +++A +LD  +      + CL                ++EN   
Sbjct: 229 GACFWHLKDYKMAIKSWERATQLDANS---SASILCLLGKFHNSLTESENDTQFKENYTA 285

Query: 446 KFDDCETLFSEAKRKFPEAPEVP---NFFAEILTDKNDFDKALKQYDLAIELENKLEGIY 502
              D  TL+++     PE  E P            KNDF+  LK YD       K++ I 
Sbjct: 286 SLMDLNTLYNDTNH--PENKENPVLLTLLQSYFYYKNDFENVLKIYD------EKIKPIS 337

Query: 503 VGIA-PLVGKATLLTRNP--TVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDID 559
             +A  ++ ++TL        ++++ +A  + +++ K +  +  AK+GL Q +L+   ++
Sbjct: 338 TLVADSILSESTLWCGRAYYALDDYRKAFAMFQESLKTNEENLLAKLGLGQAQLKTNLLE 397

Query: 560 EAIALFE 566
           E+I  FE
Sbjct: 398 ESILTFE 404

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 61/131 (46%), Gaps = 4/131 (3%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELKEDPV-FYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  Y   ++  D+I+++  A+ + +  V  +  L   Y S G ++  +++  K LEL P 
Sbjct: 682 GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 165 YSKVLLRRASANEGLGNFADAMFDLSVLS-LNGDFNDASIEPMLERNLNKQAMSRLKEKF 223
           +   L  +A     +G F +++  L  ++ LN   N+ + +  L + L K A     + F
Sbjct: 742 HPHALYFKALGLSDVGQFVESIEILEYITDLNP--NNEAFKICLAKILVKYATDLFTQGF 799

Query: 224 GDIDAATATPT 234
                ATAT +
Sbjct: 800 LMKAIATATKS 810

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPV----FYSNLSACYVSVGDL 148
           E  + A   K++ N  ++ K++ DA + Y   +++  ED       ++N +AC + + + 
Sbjct: 80  EPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNY 139

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA 185
           +  V    KA+E+ P   K   R   A   LG F +A
Sbjct: 140 RSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>Suva_10.156 Chr10 (280461..282542) [2082 bp, 693 aa] {ON} YLR072W
           (REAL)
          Length = 693

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQES 250
           +S   D+N +S I+PM+E N     ++  K+    ID       ELS    KER D   +
Sbjct: 534 ISFWVDWNASSWIKPMVESNCKNGQITATKDLVELIDEFVGEYVELS----KERTDALNA 589

Query: 251 LPSVTSMASFFGIFKPELTFA 271
           LPSV S  S   I  PEL  A
Sbjct: 590 LPSVASFGSPRKI-APELALA 609

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1430

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 106 GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  +   ++  ++I+++  AL + KED   +  L   YV  G ++  +++  KA+EL  +
Sbjct: 705 GISHLERQQEAESIEWFQSALRIDKEDIESWVGLGQAYVGCGRIEASIKVFEKAIELDSN 764

Query: 165 --YSKVLLRRASANEGLGNFADAMFDLSVLSLNG 196
             Y+K+ L  + +N  +G + D++  L  L+L+ 
Sbjct: 765 HLYAKLFLAESLSN--IGEYEDSILLLKELTLSS 796

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 69/163 (42%), Gaps = 16/163 (9%)

Query: 350 HEDITKAIDLFPRVN-SYIYMALIMADRNDSTEYYN----YFDKALKLDLNNSSVYYHRG 404
           HE+  KA     +++ S+ Y   +      S + ++     + KAL  +  + + YY  G
Sbjct: 426 HEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLG 485

Query: 405 QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEA 464
             +  L  Y++    F+KA+ ++P N+   I + C      K    E     A + +  A
Sbjct: 486 MCSLKLGQYEECLLHFEKARSINPVNV---ILICCCGVALEKLSHQE----RALQNYDLA 538

Query: 465 PEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAP 507
            E+    +  L  +     A+ +Y+ A+E   KL    V IAP
Sbjct: 539 CELQPMSSLALFKRAQLLLAMGKYNYALESFEKL----VKIAP 577

>SAKL0D03564g Chr4 (287287..290013) [2727 bp, 908 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 908

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 73/169 (43%), Gaps = 27/169 (15%)

Query: 405 QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEA 464
           +M  ILQ+Y ++          DP+    +I  A L  +  KF   ++L  +  ++ P  
Sbjct: 245 KMRTILQSYRRS----------DPKKPHGWIASARLEEKAKKFQLAKSLVDQGCQECPRN 294

Query: 465 PEVP-----------NFFAEILTDKNDF-DKALKQYDLAIELE----NKLEGIYVGIAPL 508
            E+            ++   ++T+   F D++L  +  AIELE    NK+  I   +  L
Sbjct: 295 QEIWLENIRLNSSNLHYCKVLVTNAIKFNDQSLDLWLKAIELESEDFNKIRVIRKALQHL 354

Query: 509 VGKATLLTRNPTVEN-FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQE 556
               TL       EN  IEA  +L KA++L P+S    + L  ++   E
Sbjct: 355 PESETLWKLAVQYENDKIEAVKILVKATELVPKSMDLWMALVSLQSHSE 403

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 29/132 (21%)

Query: 100 LALKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEM 154
           +  K +G++ F+N  Y  A++ Y  +L    +  P   + YSN+ A  + +G+  K +E 
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 155 STKALELKPD-----------------------YSKVLLRRASANEGLGNFADAMFDLSV 191
              AL L P                        +SK+++R+A + E L N+  A+     
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534

Query: 192 LSLNGDFNDASI 203
           L  NG F ++ I
Sbjct: 535 LIENG-FTNSKI 545

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK--EDPV---FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K+Y DA   Y+  +E+K  +D +    Y N +AC + + + 
Sbjct: 74  EPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNF 133

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASA 175
           +  +    KAL       K   R   A
Sbjct: 134 RSCINDCKKALNFNAKCVKAFYRMGQA 160

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 75/176 (42%), Gaps = 48/176 (27%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            K++G + F+   Y  A++ Y  +L     + P   +  SN+ A     G+ +K +E+ST
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEIST 456

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            ALE  P                      + K++L+RA A E + ++ +A+         
Sbjct: 457 SALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL--------- 507

Query: 196 GDFNDASIEPMLERN-LNKQAMS---RLKEKFGDIDA----ATATPTELSTQPPKE 243
                 + + M+E+N  N + MS   R +     +      ++A P + +T+P KE
Sbjct: 508 -----ETYQQMIEKNFFNDKVMSGKRRCQHVINPVKPTKSNSSALPRQTNTKPKKE 558

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 18/97 (18%)

Query: 110 FRNKKYDDAIKYYNWALE----LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD- 164
           FR K +  ++K +   L     LK DP     + AC+  + D K  +    ++LEL P  
Sbjct: 208 FRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPTN 265

Query: 165 -----------YSKVLLRRASANEGLGNFADAMFDLS 190
                      + K L+   + +E   NF DAM DLS
Sbjct: 266 KNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080W
           (REAL)
          Length = 750

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171
           N+ ACY  + DLK  +++S ++L+L PD  K  +R
Sbjct: 92  NICACYEKLDDLKSCLKISRRSLKLDPDNVKCYIR 126

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 65/168 (38%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F L NY+ + K F   +EL P  I      + L +  N       L  E       
Sbjct: 348 GKLHFELVNYEMSKKYFAALRELQPFRIPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRL 407

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVEN 523
           APE       + + K D ++++K +  + +L+      Y     L G         + + 
Sbjct: 408 APETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYT----LQGH-----EYSSNDA 458

Query: 524 FIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADL 571
           F  A     KA   +P+   A  GL    L+    +E +  FE++  +
Sbjct: 459 FDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSI 506

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 101 ALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
            LK KGN +F+   Y+ A+ YY  A+     +P+ YSN +   + +    + V+   K L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 160 EL 161
           ++
Sbjct: 66  KM 67

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 396 NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS 455
           +S  ++  G   F + N  +A K F KA  LDP   + ++  A     E + +   + +S
Sbjct: 421 SSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS 480

Query: 456 EAKRKFPEAPEVPNFF 471
            A R FP    +P+ +
Sbjct: 481 TAARFFP-GTHLPHLY 495

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 44/120 (36%)

Query: 377 NDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ 436
           N+ TE   YF KA  LD N    +        +   ++QA   +  A    P    P++ 
Sbjct: 436 NNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLY 495

Query: 437 LACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELEN 496
           L     R +     E  F  A    P  P + N    +   K D+ +A K +  A E  N
Sbjct: 496 LGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAIN 555

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 5/117 (4%)

Query: 366 YIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425
           Y  M +   +  + T+   +F  AL++D N+   +   GQ  F     + + K F+KA E
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 426 LDPE-NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDF 481
           L P+ N   Y     LA    + D+ E      +    + PE   F  E+ T   D+
Sbjct: 747 LSPDHNYAKYFNSVALA----QMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDY 799

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYV 143
            KD GN++F+  +YD AI+ Y   + L+  + V YSNL+  Y+
Sbjct: 38  FKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYL 80

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC------ 439
           + KAL ++ N+ + +Y  G     L  YD+A   F+KA+ ++P N+   +   C      
Sbjct: 514 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI--LNCCCGVALER 571

Query: 440 LAYRENKFD 448
           L  RE   D
Sbjct: 572 LGRREKALD 580

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC------ 439
           + KAL ++ N+ + +Y  G     L  YD+A   F+KA+ ++P N+   +   C      
Sbjct: 495 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI--LNCCCGVALER 552

Query: 440 LAYRENKFD 448
           L  RE   D
Sbjct: 553 LGRREKALD 561

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 21/126 (16%)

Query: 511 KATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIAL------ 564
           K  +L R  ++ NF   TN L+ A  ++P S +  IG+++  + Q  ++    L      
Sbjct: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68

Query: 565 ----FEESADLARTMEEKL--------QAITFAEAAKVQQR---IRSDPVLATKIQETLA 609
                  + D+AR+ E+++        +  T   A+KV      + SD VL  K+ +   
Sbjct: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128

Query: 610 KLREQG 615
            +   G
Sbjct: 129 GVHVNG 134

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 94/254 (37%), Gaps = 20/254 (7%)

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           ++    D T       + L LD  N   +   G ++ + +++D+A   F KA +LDP   
Sbjct: 467 VLWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFA 526

Query: 432 FPYIQLACLAYREN-KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDL 490
           + Y  L    Y  N  FD+ ++ F +A                       F++AL    L
Sbjct: 527 YAYT-LQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEAL----L 581

Query: 491 AIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQ 550
             E    L  + V +    G A    + P       A N  E A++L P S  A    +Q
Sbjct: 582 FFEKARALNPVNVILNCCCGVALERLQQPE-----RALNFYELATELQPNSSLALFKKSQ 636

Query: 551 MKLQQEDIDEAIALFE-------ESADLARTMEEKLQAITFAEAAKVQQRIRS--DPVLA 601
           + L       A+  FE       + A +   +    Q +   + A  Q  I    DP  +
Sbjct: 637 LLLNMGQYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGS 696

Query: 602 TKIQETLAKLREQG 615
             I+E + K  EQG
Sbjct: 697 QLIKEAMEKCHEQG 710

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 109 YFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSK 167
           ++ N  YD  +  +  AL ++ +D + ++ L A   +    ++ ++   KAL+LKP + +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 168 VLLRRASANEGLGNFADAM-FDLSVLSLN 195
                A +   +G + +A  + L+ LS++
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 31/58 (53%)

Query: 375 DRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           +R   ++   +F  AL+++ NN   +   GQ        + + + F+KA ELDP++++
Sbjct: 680 ERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLY 737

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYY-NWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           L+ KGN  +   +Y+ A+ YY N +L    +PV  +N+S   + +   +  +    +ALE
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 161 L 161
           +
Sbjct: 71  I 71

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 396 NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS 455
           +S  ++  G   F + N  +A K F KA  LDP   + ++  A     E + +   + +S
Sbjct: 431 SSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS 490

Query: 456 EAKRKFPEAPEVPNFF 471
            A R FP    +P+ +
Sbjct: 491 TAARFFP-GTHLPHLY 505

>NDAI0G04870 Chr7 complement(1173964..1175148) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 366 YIYMALIMADR---NDSTEYYNYF-DKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFD 421
           Y+ ++L++ +    +D+  Y NY  D      L+ +  YY RG  NF  ++Y+ + KD+ 
Sbjct: 296 YLNLSLVLFNLKKLDDAILYCNYLLDMENVPSLDKAKAYYRRGNCNFSKKHYEVSLKDYK 355

Query: 422 KAKELDPEN 430
             KE +P++
Sbjct: 356 TCKEYNPDD 364

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 10/100 (10%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYY--------NWALELKEDPVFYSNLSACYVSV 145
           E  + A   K++GN  ++ K++ DA   Y        N  +++KE    ++N +AC + +
Sbjct: 71  EPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKES--LFANKAACELEL 128

Query: 146 GDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA 185
            + ++ +     AL+L P   K   R   A   L    +A
Sbjct: 129 KNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1059

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 79/178 (44%), Gaps = 21/178 (11%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKF-DDCETLFSEAKRK-- 460
           G   + L++Y  A   + +A EL+P N    I +    + E+    + +T+F E   K  
Sbjct: 225 GLCFWQLKDYKIAIASWKRAHELNPNNQSAAILVLLGDFHESLVTSENDTVFQETYSKVL 284

Query: 461 ------FPEAPEVPNFFAEI---LTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGK 511
                 F E  E P     +      K D++K +  Y      E+K++GI   +   V  
Sbjct: 285 QNLNGLFSEDRENPVLLTLLEVYFYLKGDYNKVIDIY------ESKIKGISTTVTSTVLS 338

Query: 512 ATLLTRNPT---VENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFE 566
            +L         +E++ +A  + +++ K +  +  AK G+ Q +++ + ++E+I  FE
Sbjct: 339 ESLFWCGRAYYALEDYRKAFTMFQQSLKQNEDNMLAKFGVGQTQVKNKLVEESILTFE 396

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE---LKEDP---VFYSNLSACYVSVGDLKKVVEMS 155
            K KG   F+N  Y ++++ Y  +L    LK  P   +  SN+ A  + +G+  K +E S
Sbjct: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431

Query: 156 TKALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186
             AL L P                      + K+++RRA + E L +F +A+
Sbjct: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 26/121 (21%)

Query: 106 GNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           G ++F+   YD A+  Y  +L    ++ P   + YSN+ A  + VG+  + V+    ALE
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 161 LKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199
           L P                      + K++LR+A A E +  +  A     +L     FN
Sbjct: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672

Query: 200 D 200
           D
Sbjct: 673 D 673

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 54/120 (45%)

Query: 376 RNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYI 435
           + D  E   YF+KA ++D + +  Y  +G  +    + D A   + KA   DP++   Y 
Sbjct: 522 QRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYY 581

Query: 436 QLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
            L     +  ++++    F +A+   P    +       L   +  +KAL+ Y+LA EL+
Sbjct: 582 GLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQEKALQYYELASELQ 641

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           I   + D T+  + + KA+ LD   S  + +R   +  L N+  +  D D+A +LDP+N 
Sbjct: 21  IFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNA 80

Query: 432 FPY 434
             Y
Sbjct: 81  KAY 83

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL-----KEDPVFYSNLSACYVSVGDLKKVVEMST 156
            K +GN+ ++ K+Y +A   Y   +E+     K + + + N +AC + + + +  +    
Sbjct: 77  FKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCK 136

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQ 214
           KAL   P   K   R A A   +  + ++   +    L  D  ++S+  +L+  + KQ
Sbjct: 137 KALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE-FGLKVDSRNSSLLNLLKTIIKKQ 193

>CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047c TFC4
          Length = 1062

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 111 RNKKYDDAIKYYNWALELKEDPV--FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKV 168
           +++KY +AI ++   L + E      Y  L+ CY  + D +K  E   K LE+ P     
Sbjct: 492 KSEKYKEAIDFFTPLLSIPEWCTIELYEPLTKCYKEIEDYEKAKEYGDKVLEMDPKSMDA 551

Query: 169 LLRRASANEGLGN 181
            L  A  N  LG+
Sbjct: 552 KLNVAEINYYLGD 564

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 109 YFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSK 167
           ++ N ++D  I  +  AL +  ED + ++ L A   +    ++ ++   KAL+LKP + +
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR 500

Query: 168 VLLRRASANEGLGNFADA 185
                A ++  +G + +A
Sbjct: 501 ARYNLAVSSINIGCYKEA 518

>YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}
           DIA2Origin-binding F-box protein; forms an SCF ubiquitin
           ligase complex with Skp1p and Cdc53p; plays a role in
           DNA replication; plays a role in transcription; required
           for correct assembly of RSC complex, correct
           RSC-mediated transcription regulation, and correct
           nucleosome positioning; involved in invasive and
           pseudohyphal growth
          Length = 732

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171
           N+ ACY  + DLK  +++S + L+L+P   K  +R
Sbjct: 83  NICACYEKLNDLKSCLDVSQRLLKLEPGNIKCYIR 117

>YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subunit
           of the membrane-associated retromer complex essential
           for endosome-to-Golgi retrograde protein transport;
           peripheral membrane protein that assembles onto the
           membrane with Vps5p to promote vesicle formation
          Length = 551

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%), Gaps = 9/113 (7%)

Query: 471 FAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNL 530
           + +ILT   D D  +   D+A         +Y G+  +V  A  +    T  +FI   NL
Sbjct: 313 YGKILTAVGDIDSIIATMDMAT--------LYDGLEWIVRDAYAVKEALTNRHFI-MRNL 363

Query: 531 LEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAIT 583
           ++       + EQA+   ++  +    IDEA+   + +A   + +  KLQ IT
Sbjct: 364 VQAQQNSKAKQEQARRFRSRRDINPMKIDEALRQLKAAAKNEQVLTLKLQRIT 416

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  ++ N+++   I  +  ALE+   D + ++ L A   +    ++ ++   KAL LKP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 165 YSKVLLRRASANEGLGNFADAMFD-LSVLSLN 195
           + +     A ++  +G + +A    LS LS++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>Kwal_26.7268 s26 (288292..290904) [2613 bp, 870 aa] {ON} YPR104C
           (FHL1) - Protein with a domain similar to the fork head
           DNA-binding domain found in the developmental fork head
           protein of Drosophila melanogaster and in the HNF-3
           family of hepatocyte mammalian transcription factors.
           [contig 47] FULL
          Length = 870

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDI 226
           NF    F+LS++  NG F D +    +ER +  Q  +R K + G I
Sbjct: 338 NFGTGRFELSIMGKNGAFVDDT---FVERGITVQLKNRAKVQIGQI 380

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 79/182 (43%), Gaps = 29/182 (15%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCE------------ 451
           G   + L++Y  A + +++A +LDP N    I L  L    N   + E            
Sbjct: 224 GMCFWQLKDYKLAIQAWERALQLDPNNKQASI-LVLLGKFHNSLTEAENDEDFKEKYAAA 282

Query: 452 -----TLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKL--EGIYVG 504
                T+++ +K    E+P +          K D++K +  +D  I   + L  E +Y  
Sbjct: 283 LADLNTVYTNSK----ESPVLLVLLQTFFFFKGDYEKVITIHDQKISKLSFLAPESVYSE 338

Query: 505 IAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIAL 564
                G+A+       + ++ +A  + +++ K D  +  A++GL Q +++   ++E+I  
Sbjct: 339 SLFWCGRASY-----AMGDYRKAFTMFQESLKRDENNLLARLGLGQTQIKNSLVEESILT 393

Query: 565 FE 566
           FE
Sbjct: 394 FE 395

>KLTH0F15202g Chr6 complement(1247894..1249558) [1665 bp, 554 aa]
           {ON} similar to uniprot|P32913 Saccharomyces cerevisiae
           YOR132W VPS17 Peripheral membrane protein required for
           vacuolar protein sorting
          Length = 554

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 63/145 (43%), Gaps = 11/145 (7%)

Query: 469 NFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEAT 528
           N F + L+   D D  +   D+A         +Y G+  LV +   +    T  +F+   
Sbjct: 314 NKFGKTLSAVGDIDSVMATLDIAT--------LYDGLEWLVQETYSVKEALTNRHFL-MR 364

Query: 529 NLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAA 588
           +LL+       R EQA+   A+  +    +DEAI   + +     T+  KL+ +T     
Sbjct: 365 DLLQAQQTSSSRQEQARKLRARRDVSPLKVDEAIRALKAATTAEHTLTLKLRRVTANMLL 424

Query: 589 KVQQRIR-SDPVLATKIQE-TLAKL 611
           + Q+ +   D  L T I+E TL K+
Sbjct: 425 EKQRWLEWCDHQLQTSIKEYTLRKI 449

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ L P  S+V     +  E   N      D  
Sbjct: 323 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 382

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDID 227
             +   D N+  I   LE      A+++  E  G+I+
Sbjct: 383 KQAARLDVNNVHIRERLE------ALTKQLENPGNIN 413

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,596,498
Number of extensions: 2707746
Number of successful extensions: 8930
Number of sequences better than 10.0: 266
Number of HSP's gapped: 8887
Number of HSP's successfully gapped: 397
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)