Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4778.853ON96996951810.0
Smik_13.5038.853ON96996941470.0
YMR287C (DSS1)8.853ON96996941350.0
Skud_13.4608.853ON96996941230.0
SAKL0D01078g8.853ON93692623120.0
TDEL0B002208.853ON93596422870.0
ZYRO0C14938g8.853ON96698122710.0
CAGL0M07051g8.853ON92391221920.0
KAFR0L019708.853ON93296321570.0
NCAS0C003008.853ON94090521260.0
KNAG0E011408.853ON92990221140.0
Kwal_27.102138.853ON93693020850.0
KLTH0C03674g8.853ON94891520140.0
NDAI0K003208.853ON96293918980.0
Kpol_237.48.853ON91691918300.0
TBLA0B029208.853ON102998918100.0
TPHA0I003508.853ON94391317450.0
KLLA0C06314g8.853ON98395015960.0
AFR448W8.853ON81783215480.0
TPHA0A023201.367ON10154621362e-07
KNAG0C019501.367ON9964451272e-06
Skud_15.1371.367ON10304371255e-06
CAGL0H04411g1.367ON10074541221e-05
TBLA0D050701.367ON9974451202e-05
Suva_15.1471.367ON10014371202e-05
YOL021C (DIS3)1.367ON10014551192e-05
Kpol_1043.421.367ON9884571192e-05
ZYRO0G01166g1.367ON9934451183e-05
NDAI0H035601.367ON10124441174e-05
TDEL0D023801.367ON9974451174e-05
Smik_15.1451.367ON10014371165e-05
NCAS0D005901.367ON9984331166e-05
KLTH0H13420g1.367ON9864571121e-04
KAFR0C045301.367ON10004481121e-04
KLLA0A10835g1.367ON10084951093e-04
Ecym_27151.367ON9884351084e-04
SAKL0D10186g1.367ON9884531076e-04
Kwal_34.162451.367ON9864531068e-04
Kpol_513.285.9ON809124800.92
TDEL0B001808.849ON582173762.0
NDAI0C040505.307ON1260133753.5
ZYRO0A05962g8.742ON465140744.2
Suva_6.2661.150ON586116735.1
KLTH0A01958g3.218ON68846735.8
Kpol_380.123.574ON26548715.9
Kpol_1035.3singletonON1130240719.3
CAGL0M00462g4.364ON61192719.6
Kpol_1004.685.307ON125058719.7
Suva_2.4595.307ON125884719.7
Skud_4.5555.307ON125284719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.477
         (969 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...  2000   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...  1602   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...  1597   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...  1592   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   895   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   885   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   879   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   848   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   835   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   823   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   818   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   807   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   780   0.0  
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   735   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   709   0.0  
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   701   0.0  
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   676   0.0  
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   619   0.0  
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   600   0.0  
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    57   2e-07
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    54   2e-06
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    53   5e-06
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    52   1e-05
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    51   2e-05
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    51   2e-05
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    50   2e-05
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    50   2e-05
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    50   3e-05
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    50   4e-05
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    50   4e-05
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    49   5e-05
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    49   6e-05
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    48   1e-04
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    48   1e-04
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    47   3e-04
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    46   4e-04
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    46   6e-04
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    45   8e-04
Kpol_513.28 s513 complement(84409..86838) [2430 bp, 809 aa] {ON}...    35   0.92 
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...    34   2.0  
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    33   3.5  
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    33   4.2  
Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON...    33   5.1  
KLTH0A01958g Chr1 (172931..174997) [2067 bp, 688 aa] {ON} simila...    33   5.8  
Kpol_380.12 s380 complement(19992..20789) [798 bp, 265 aa] {ON} ...    32   5.9  
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    32   9.3  
CAGL0M00462g Chr13 (57126..58961) [1836 bp, 611 aa] {ON} similar...    32   9.6  
Kpol_1004.68 s1004 complement(143077..144804,144807..146831) [37...    32   9.7  
Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {O...    32   9.7  
Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {O...    32   9.9  

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 2000 bits (5181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 969/969 (100%), Positives = 969/969 (100%)

Query: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60
           MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI
Sbjct: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60

Query: 61  TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW 120
           TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW
Sbjct: 61  TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW 120

Query: 121 RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC 180
           RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC
Sbjct: 121 RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK 240
           VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK
Sbjct: 181 VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK 240

Query: 241 NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG 360
           LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG 360

Query: 361 KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY 420
           KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY
Sbjct: 361 KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP 480
           PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP 480

Query: 481 LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE 540
           LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE
Sbjct: 481 LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE 540

Query: 541 IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL 600
           IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL
Sbjct: 541 IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL 600

Query: 601 VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP 660
           VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP
Sbjct: 601 VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP 660

Query: 661 KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN 720
           KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN
Sbjct: 661 KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN 720

Query: 721 TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA 780
           TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA
Sbjct: 721 TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA 780

Query: 781 QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP 840
           QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP
Sbjct: 781 QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS 900
           DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS
Sbjct: 841 DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS 900

Query: 901 NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL 960
           NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL
Sbjct: 901 NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL 960

Query: 961 EGILELEKL 969
           EGILELEKL
Sbjct: 961 EGILELEKL 969

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1602 bits (4147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 759/969 (78%), Positives = 856/969 (88%)

Query: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60
           MV RGN   L IARSFH+  PCFRVT R +RQ+SK  Q+ KA FDYT L   ++V ++  
Sbjct: 1   MVARGNAHILLIARSFHSCGPCFRVTTRGKRQQSKKRQQAKAQFDYTQLLDNEQVIESGA 60

Query: 61  TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW 120
              V  EK+IESIN+DFL R KGLEPDIELKQL QIKEEFY+RY+DRY+ PSE+WY+N+W
Sbjct: 61  NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW 120

Query: 121 RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC 180
           RSLTKPKI  +KLIN D+  DTKL+    MEFQPAQLM+NPLNVGDLVLLK +PNELAMC
Sbjct: 121 RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC 180

Query: 181 VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK 240
           VSLPSSTMDPRYTF +IDG+M FATKNRVLLRIP KLP G++SL+QPE HHKHLPIGT+K
Sbjct: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240

Query: 241 NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           N SNQT+ILPIV RQ+ITS+ PAQISKLAWK LPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG 360
           LVGLVQKLDLNKALD K G++YL DLVN+Y +AD+V +NS TFVSTYWAI+QQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG 360

Query: 361 KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY 420
           +IHLNTALLSP SVTI+PLKS+HLYYAQVIEKLEA++YK+++ FVKLVNERKYRDIS+LY
Sbjct: 361 EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP 480
           PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKI  YK  DITRD+CQDL+NEI+PN + NP
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVPNSLSNP 480

Query: 481 LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE 540
           LLLNMDLALP+SSKL +SQQKLY LTNIE++QR+NS  + DRYDFGDL+VFCIDS+TAHE
Sbjct: 481 LLLNMDLALPSSSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE 540

Query: 541 IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL 600
           IDDGVS+ENH KDG+YTLHIHIADP S+FPEST I+S GI+TD+LN+A KRSFTTYLPD+
Sbjct: 541 IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV 600

Query: 601 VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP 660
           VVPMLP++IC LSDLGK G++T+T+SFSVDVKV  +  GK +EI+Y+S +IRKG VSNFP
Sbjct: 601 VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP 660

Query: 661 KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN 720
           KATY+DVD+ILS  D+E+ P K DLESLSMISKLLRE RIKKNNAVIFGEGFN+G+VTLN
Sbjct: 661 KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN 720

Query: 721 TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA 780
            N EGELTEVSFS+Q ETPSTVLVSEMMILANTL GR+FAEN I GVFRCYKQLPLD IA
Sbjct: 721 ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA 780

Query: 781 QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP 840
           QQQY+S+IT  KKG+FPKL DI KLSSLLNSSFYTG+PFRHEMIGA QYLTVTSPLRRFP
Sbjct: 781 QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS 900
           DLINHLQIHRHLQKKPLCF+Q QID LIW IQSRADILK ASR+SSTYWTLNYLK + KS
Sbjct: 841 DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS 900

Query: 901 NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL 960
           +P +TYDVMITSVPQNGFAGCVFP LSFARGTLKL P  ++YPMIGD VK CKI KIDCL
Sbjct: 901 DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL 960

Query: 961 EGILELEKL 969
           EG+LELEKL
Sbjct: 961 EGMLELEKL 969

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score = 1597 bits (4135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/969 (78%), Positives = 852/969 (87%)

Query: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60
           MVVR     L IARSFH+Y PCFRVT R +RQRSK+ Q+ K   D+T     D+  +T +
Sbjct: 1   MVVRRKVHVLLIARSFHSYTPCFRVTTRGKRQRSKSKQQAKVELDHTRELDNDQATETVV 60

Query: 61  TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW 120
            R V  EK+IESIN+DFL R KGLEPDIELKQL QIK+EF +RY+DRYV PSE WY NSW
Sbjct: 61  DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120

Query: 121 RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC 180
           RSLTKPKIP YKLIN D    TKL++   MEFQP QLM++PLNVGD VLLK RPNELAMC
Sbjct: 121 RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK 240
           VSLPSSTMDPRYTF +IDG+M FATKNRVLLRIP KLP GI SL+QPE HHKHLPIGTVK
Sbjct: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240

Query: 241 NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           NFSNQT+ILPIVARQ+ITS+ PAQISKLAWK LPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG 360
           LVGLVQKLDLNKALD+KNG+NYL  LVN+Y + + +P+NS TFVSTYWAI+QQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360

Query: 361 KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY 420
           +IHLNTALLSP SVTIIPLKS+HLYYAQVIEKLEA++Y+++++FVKLVNERKYRDIS+LY
Sbjct: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP 480
           PSVIQLLKDFAAGNFHNNGIIV LISKIFRKIE YK  DITRDICQDL+NEI PN + NP
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP 480

Query: 481 LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE 540
           LLLNMDLALPASSKL + QQKLY+LTNIE +Q K S  + DRYDFGDL+VFCIDSETAHE
Sbjct: 481 LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE 540

Query: 541 IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL 600
           IDDGVS++N+ +DGLYTL+IHIADP S+FPEST+++ +GI+TD+LNVALKRSFTTYLPD 
Sbjct: 541 IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT 600

Query: 601 VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP 660
           VVPMLP+SIC LSDLGKQGQ+T+T+SFSVDVK+  K +GK IEI+Y+S KIRKGIVSNFP
Sbjct: 601 VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP 660

Query: 661 KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN 720
           KATY DVDRIL   +SEA P K+DLESLSMISKLLRE RIK +NAVIFGEGFN+GLV LN
Sbjct: 661 KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720

Query: 721 TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA 780
            + EGELTEV+FSDQ ET ST+LVSEMMILANTL GR+FAENKI GVFRCYKQLPL  +A
Sbjct: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780

Query: 781 QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP 840
           QQQY+S+ITS KKG+FPKL+DI KLSSLLNSSFYTG+PFRHEMIGA QYLTVTSPLRRFP
Sbjct: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS 900
           DLINHLQIHRHLQKKPLCF+Q QID LIWPIQSRADILK ASRNSSTYWTLNYLK + K 
Sbjct: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900

Query: 901 NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL 960
            PE+T+DVM+TSVPQNGF GCVFPDLSFARGTLKL+PS+ HYPMIGD VK CKI KIDCL
Sbjct: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960

Query: 961 EGILELEKL 969
           EG+LELEKL
Sbjct: 961 EGMLELEKL 969

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1592 bits (4123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/969 (77%), Positives = 862/969 (88%)

Query: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60
           M+ RGN  AL IARSFH+Y+PCFRVTIR +RQRSK  Q+ KA  DYT L    KV +  +
Sbjct: 1   MIPRGNTHALLIARSFHSYKPCFRVTIRGKRQRSKTKQQGKAQEDYTQLLDNGKVSEVTV 60

Query: 61  TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW 120
              +++ K+IESIN+DFLHR KGLEP+IELKQL QIKEEF +RYRDRY+ PSE+WY+NSW
Sbjct: 61  NSSIKSAKDIESINKDFLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSW 120

Query: 121 RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC 180
           RSL KPKI S+ LIN +I  D +L+ S  +EFQP QLM+ PLNVGDLVLL+ RPNELAMC
Sbjct: 121 RSLAKPKISSHNLINSNIQLDAQLKFSNPLEFQPVQLMERPLNVGDLVLLRVRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK 240
           VSLPSSTMDPRYTF +IDGSM FATKNR+LLRIP +LP G++SL+QPE+ + HLPIGT+K
Sbjct: 181 VSLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGVNSLIQPEERYGHLPIGTIK 240

Query: 241 NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           NFSNQT+ILPI ARQ+ITS+ PAQISKLAW+ LP TTKKLQLLHRSLQ+Y GPWQIPFFT
Sbjct: 241 NFSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQLLHRSLQDYRGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG 360
           LVGLVQ+LDLN+ALD+K G  YLA+L+ ++++AD+VP++SATFVSTYWAI+QQQESN WG
Sbjct: 301 LVGLVQRLDLNEALDDKYGATYLANLLGTHQTADNVPISSATFVSTYWAIMQQQESNFWG 360

Query: 361 KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY 420
           +IHLNTALLSP SVT+IPLKSRHLYY QV+ KLEAD+Y +I+RFVKLVNERKYRDIS+LY
Sbjct: 361 EIHLNTALLSPISVTVIPLKSRHLYYEQVVGKLEADDYNEINRFVKLVNERKYRDISTLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP 480
           PSVIQ+LKDFAAGNFHNNGIIVTL+SKIFRKIE YK  DITRDICQDL+NEILPN M NP
Sbjct: 421 PSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIERYKDCDITRDICQDLINEILPNSMSNP 480

Query: 481 LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE 540
           LLLNMDLALPASSKL +SQQKLY+LTNIE++QRKNS+ + +RYDFGDLKVFCIDSETAHE
Sbjct: 481 LLLNMDLALPASSKLVRSQQKLYDLTNIEDLQRKNSDNSSERYDFGDLKVFCIDSETAHE 540

Query: 541 IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL 600
           IDDGVSIENH  DGLYTLHIHIADP S+FPEST+ +S+GI TD+LNVAL+RSFTTYLPD+
Sbjct: 541 IDDGVSIENHGTDGLYTLHIHIADPTSMFPESTNYDSEGIITDILNVALERSFTTYLPDV 600

Query: 601 VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP 660
           VVPMLP+SIC+LSDLGKQGQKT+T+SFSVDVKV+ K  G+ +EI+++S KIRKGIVSNFP
Sbjct: 601 VVPMLPKSICNLSDLGKQGQKTKTISFSVDVKVMSKGDGESLEIMFDSFKIRKGIVSNFP 660

Query: 661 KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN 720
           K TY+DVDRIL+  + EA P K+DLESLSM+S LLR+ RIK NNAVIFGEGFN+GLVTLN
Sbjct: 661 KVTYDDVDRILNTPNDEASPVKKDLESLSMVSNLLRDRRIKNNNAVIFGEGFNKGLVTLN 720

Query: 721 TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA 780
            N+EGELTE+SFSDQ ET STVLVSEMMILANTL G++FA+NKI GVFRCYKQLPLD IA
Sbjct: 721 ANEEGELTEISFSDQVETLSTVLVSEMMILANTLTGKYFADNKICGVFRCYKQLPLDIIA 780

Query: 781 QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP 840
           Q+QY+S+ITS KKG+FP+L+DI KLSSLLNSSFYTG+PFRHEMIGA QYLTVTSPLRRFP
Sbjct: 781 QEQYDSMITSTKKGLFPQLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS 900
           DLINHLQIHRHLQKKPLCFSQ QIDRLIWPIQSRADILK A RNSSTYWTLNYLK + K 
Sbjct: 841 DLINHLQIHRHLQKKPLCFSQVQIDRLIWPIQSRADILKRAGRNSSTYWTLNYLKKLKKL 900

Query: 901 NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL 960
           +PEKTYDVMIT+VPQNGF  CVFPDLSFARGTLKL+PS +HYPMIGD VK CKIL+IDCL
Sbjct: 901 DPEKTYDVMITAVPQNGFVSCVFPDLSFARGTLKLHPSAKHYPMIGDIVKNCKILRIDCL 960

Query: 961 EGILELEKL 969
           EG+LELE L
Sbjct: 961 EGMLELETL 969

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/926 (48%), Positives = 625/926 (67%), Gaps = 37/926 (3%)

Query: 66  NEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYS-NSWRSLT 124
            ++  +++ + F    K LEP++E+KQL Q++++   RY  RY  PS+ W++ N  R+ +
Sbjct: 20  GDRSKDNLEKIFFSHAKDLEPEVEIKQLSQVRQDSDNRYYHRYFTPSKIWFTQNVSRTQS 79

Query: 125 -------KPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNEL 177
                   P+  S K I   ++     + S      P+ LM  PL +GDLVLL+S P +L
Sbjct: 80  FKHFFNLDPQRSSDKYILPTLNERLYDKGSHTFYLSPSDLMNTPLKIGDLVLLRSNPTQL 139

Query: 178 AMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIG 237
           +MCV LP+  MDPRYTFAS+DG + FA +  ++LRIP      +D LVQ E  H + PIG
Sbjct: 140 SMCVDLPTDIMDPRYTFASMDGGLQFAARTMIMLRIPSCHKQELDGLVQLERKHSYEPIG 199

Query: 238 TVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIP 297
            VKN    T +LPI+ARQ+ITS  P +I+K AW  +PI +KKL+LLHR LQ   GPWQI 
Sbjct: 200 VVKNSPTHTYVLPILARQLITSYVPFEITKKAWNQVPIVSKKLELLHRFLQRSTGPWQIS 259

Query: 298 FFTLVGLVQKLDLNKALDNKNGV--NYLADLVNSYKSADSV--------------PMNSA 341
            FTL  LVQ LDL +AL  ++G   +Y++ L        ++               ++++
Sbjct: 260 IFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQKVGLDSNLYCLGEQNLHVNPPNKIDAS 319

Query: 342 TFVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDI 401
            F+STYW++V+QQE  +WG I  +  +L+P SVT++PL S HLYY  V+  L+ DNY+ +
Sbjct: 320 YFLSTYWSLVKQQELQIWGGIQTHRGILTPISVTVLPLNSEHLYYENVVSTLKQDNYRML 379

Query: 402 DRFVKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDIT 461
           D F +LVN++ Y+ I + +P +IQ+LK++AAGNF+NNG ++TL+SKIFRK+  YK  D T
Sbjct: 380 DEFAELVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGAMITLVSKIFRKLHTYKERDTT 439

Query: 462 RDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGD 521
           RD+C +L+ +I P+K+INPLLLN DL LP +S+    +Q +Y+++    +   +S +   
Sbjct: 440 RDMCHELLTQISPDKLINPLLLNKDLGLPMASQRSALEQVVYDISK-PPLTEDDSYV--- 495

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGIT 581
           R+DFGD+ V+CIDSETAHEIDDG+SIE   +   Y LHIHIADPAS F +STD E++   
Sbjct: 496 RHDFGDMPVYCIDSETAHEIDDGISIETLSEKK-YRLHIHIADPASSFAKSTDPEARD-- 552

Query: 582 TDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKP 641
            DVL++A +RSFTTYLPD+V+PMLPES C  +DLGK G KT+TLSFS+D+     +    
Sbjct: 553 -DVLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGNKTKTLSFSIDIYFHQGT---- 607

Query: 642 IEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIK 701
           + ++ ++ K+R G+VS FP+ TY  VD +L   + + P    DL+ +  ++K LR  R+K
Sbjct: 608 LRLLDDTFKMRLGLVSRFPRVTYEKVDILLQYPEKQ-PKEASDLKLMYEVAKSLRAKRVK 666

Query: 702 KNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAE 761
             +A+IFGEGFN+GLV L+ ++ GELT++SF DQ E+ STVLVSEMMILANTL G +F +
Sbjct: 667 NQDAIIFGEGFNKGLVKLSPDETGELTKISFEDQVESKSTVLVSEMMILANTLTGGYFKK 726

Query: 762 NKISGVFRCYKQLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRH 821
           NKI GVFRCY +L L   A ++Y  +    K G FP + DI  +SSLLNSSFYTG+P +H
Sbjct: 727 NKIPGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINTISSLLNSSFYTGKPKKH 786

Query: 822 EMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTA 881
           EMIGA++YLTVTSPLRRFPD+INHLQIHRHL+  PLCFSQ ++D + W IQSR  +LK A
Sbjct: 787 EMIGASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEVDGITWHIQSRDVVLKNA 846

Query: 882 SRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEH 941
           +R S+TYWTL +LK  ++   +  + VM+TSVP  G   C FP+L+ ARGTL L+P    
Sbjct: 847 ARMSATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFPNLNAARGTLNLDPKHTP 906

Query: 942 YPMIGDTVKTCKILKIDCLEGILELE 967
           YP IGD +  CK+ K+DCL+G++ELE
Sbjct: 907 YPAIGDLIHKCKLTKLDCLDGVIELE 932

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/964 (47%), Positives = 642/964 (66%), Gaps = 47/964 (4%)

Query: 14  RSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAITRPVENE------ 67
           RS H  R   R ++RN  +R +   +E  +               A+  PVE E      
Sbjct: 8   RSLHVSRTVLR-SVRNGGRRPRLPNEELVI--------------PAV--PVEQESAELSP 50

Query: 68  KEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPK 127
           ++IE IN  FL R K LEP +E+KQL QI  EF  R+  RY  PS+ W+  +W + TK  
Sbjct: 51  EDIERINLQFLSRTKDLEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFEKNWLNRTKF- 109

Query: 128 IPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMCVSLPSST 187
             S K++N       K ++ +  +++ + LM  PL+VGDLVLLKS P+EL+MC+ +PSST
Sbjct: 110 --SRKMLNA---VPRKEDTKEVFQYKASALMAKPLDVGDLVLLKSHPSELSMCIDVPSST 164

Query: 188 MDPRYTFASIDGSMSFATKNRVLLRIPQKLP---TGIDSLVQPEDHHKHLPIGTVKNFSN 244
            DPRY F ++DGS+ F +++ VL+RIP  LP   + + +L+  E  H   PIGT+KN +N
Sbjct: 165 KDPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEPIGTIKNQAN 224

Query: 245 QTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGL 304
           +T +LP++ARQ++TS    +ISK AW  LP+T KKL+LLHR LQ+  GP  +PFF LV +
Sbjct: 225 ETLVLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVPFFDLVMM 284

Query: 305 VQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWGKIHL 364
           +Q LD+ KA+ N++G  Y+ D++ + ++  +  ++S+  ++TYWAI  QQ+++L+G I +
Sbjct: 285 IQSLDITKAISNRDGEPYIRDVIENSRTGSTSTIDSSCALATYWAIEAQQKNHLFGDIQI 344

Query: 365 NTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVI 424
           + ALLSP SV I+P  S+HL+Y+++ E+L+++  + I  F KL N+ KY ++++ +P +I
Sbjct: 345 SGALLSPVSVLILPFASQHLFYSELKEQLKSNGQEAIQEFSKLANKGKYTELTTRFPHII 404

Query: 425 QLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMI-NPLLL 483
           Q+LK +AAGN HN+  IV+LI+ IFRKI+ +K +DITRD C+ L++  LP   + NP+  
Sbjct: 405 QVLKGYAAGNLHNDEGIVSLIAAIFRKIDEFKDNDITRDACEKLLSRTLPQGTVENPIYA 464

Query: 484 NMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDD 543
           N  L LP SS   ++QQ++Y+L+   + Q        +R+DF  L+V+CIDSE AHEIDD
Sbjct: 465 NFTLGLPDSSARSRTQQQVYDLSKPASAQSTE-----NRHDFKHLRVYCIDSEEAHEIDD 519

Query: 544 GVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVP 603
           G+SIE+   +G YTLHIHIADPASLFPES   E  GI  +VL VA +R FTTYLPD+V P
Sbjct: 520 GISIEDCG-NGKYTLHIHIADPASLFPESESSEQSGINDEVLKVAAERCFTTYLPDVVSP 578

Query: 604 MLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKAT 663
           MLP++   + DLG QG+KT+T++FSVDV V        I+I ++S KIR G+VSNFPK T
Sbjct: 579 MLPQTFTTVCDLGHQGKKTKTITFSVDVLV----KDGAIKIFFDSYKIRLGLVSNFPKVT 634

Query: 664 YNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNK 723
           Y  VDR LS   +       DL+ +  I+++LRE RI+K+ A++FG GFN+GLV ++   
Sbjct: 635 YETVDRYLSEPKNVNEEILYDLKLMHKIAEILREARIQKDGAIVFGSGFNQGLVAVSPVD 694

Query: 724 EGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQ 783
           +    E+SF DQ E+ ST+LVSE MILAN+L GRFFAE +I G+FR Y+ L L   A Q+
Sbjct: 695 Q----EISFFDQKESKSTLLVSEFMILANSLAGRFFAEKEIPGIFRTYQPLTLRGQADQE 750

Query: 784 YNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLI 843
           Y  +  S KKG+ P  +DI  LSSLLNSSFY   P  H MIGA+QYLTVTSPLRRFPD+I
Sbjct: 751 YERMKKSVKKGILPTTKDINMLSSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRRFPDII 810

Query: 844 NHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPE 903
           NHLQIHR L+  PLCF++  + +++W IQ R   LK AS + ++YWTL Y+K +++  P 
Sbjct: 811 NHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKKASAHQASYWTLKYIKNLIRDTPH 870

Query: 904 KTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGI 963
           + +DV ITSVPQ   A CV  +   ARG LKL PS  + P +GDTVK CK+ KIDCL+ +
Sbjct: 871 QRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSATNIPTVGDTVKGCKVSKIDCLDSL 930

Query: 964 LELE 967
           LELE
Sbjct: 931 LELE 934

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/981 (47%), Positives = 640/981 (65%), Gaps = 42/981 (4%)

Query: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60
           +  RG  Q    AR  H  + C R   + +R    +N++    F          + + A+
Sbjct: 13  LACRGMSQIF--ARRLHLSQRCLRQVKKPKRASRTSNKEFGDAF---------SIPNRAM 61

Query: 61  TRPVE--NEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSN 118
             P    ++++I+ IN  FL R K LEP +E+K L +IK+EFY RY  RY+ P  SW+  
Sbjct: 62  LDPPTPLSQEDIDRINYMFLSRTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNSWFQR 121

Query: 119 SWRSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELA 178
           S +++      S  LIN D      +++ + ++F P +LM  PL +GDLVLLK +  +L 
Sbjct: 122 SEQNILGKSF-SRSLINADPE-ALGIKNKRFLKFDPKELMSRPLQIGDLVLLKHQSPQLC 179

Query: 179 MCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGT 238
           MC+ +PSST DPRYTF ++DG++ F+T+N+VL+RIP  LP     L+  E  H   P+G 
Sbjct: 180 MCIDVPSSTRDPRYTFTTVDGTIIFSTRNKVLMRIPHHLPNV--PLLMKEMKHGFEPVGC 237

Query: 239 VKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPF 298
           VKN + +T ILPIV RQ ITS    QISK AW+ +P T KKL+LLHR LQ+  GPWQ+PF
Sbjct: 238 VKNTTTETFILPIVPRQQITSPISHQISKRAWEEMPFTLKKLELLHRHLQDARGPWQVPF 297

Query: 299 FTLVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNL 358
             LV +V+KLD+  A  +  G  Y+ DL+ +        ++SA F+S Y AI  QQ+S+L
Sbjct: 298 MNLVSMVEKLDMQLASASNTGAAYVEDLIRTCTFEPQAKLDSAIFLSVYCAIENQQQSHL 357

Query: 359 WGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISS 418
           WG IH + ALLSP SVT++PL+S+HLY+  V++ L+  NY+ + +F +LV+  KY +   
Sbjct: 358 WGNIHSSRALLSPVSVTVMPLRSQHLYHRSVLQNLKVRNYEAVSKFARLVDTGKYNEAIM 417

Query: 419 LYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMI 478
            YP +++LL+D+AAGNF+N+   ++++SKIFRKI+ ++  DITRDIC  L+ E+  ++  
Sbjct: 418 EYPEIVKLLQDYAAGNFYNDATAISVVSKIFRKIQRFQEEDITRDICHQLLKELDSSQTT 477

Query: 479 -NPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSET 537
            NPL  N+DL LP+SS    S+Q +Y L +    + ++ N+   R+DFGD+KV+CIDSET
Sbjct: 478 RNPLHYNLDLGLPSSSLRSSSEQDIYNLAHPVTFEGQDKNL---RHDFGDMKVYCIDSET 534

Query: 538 AHEIDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYL 597
           AHEIDDGVSIE+H  D   TLHIHIADPAS F E  +  + GI +++L +AL +SFTTYL
Sbjct: 535 AHEIDDGVSIESHS-DVKRTLHIHIADPASFFRECQE-GTHGIESEILQIALNKSFTTYL 592

Query: 598 PDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVS 657
           PDL+ PMLP S    +DLGKQGQK +T++FSVD   +        ++   S +I+ G+VS
Sbjct: 593 PDLMSPMLPGSYSKAADLGKQGQKAKTITFSVDGSWIKNGQ---FQLQPESFRIKLGLVS 649

Query: 658 NFPKATYNDVDRILS-----------ITDSEAPPFKEDLESLSMISKLLRELRIKKNNAV 706
           NFP+ TYN VD +L+           +TD +      +L+ L  IS+ LR  RI    AV
Sbjct: 650 NFPQVTYNTVDSMLAQASEVKNGSANLTDDQ-----RNLKELYAISQNLRANRINTQQAV 704

Query: 707 IFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISG 766
           +FG  FN+G V L+ ++ G L +VSF DQ ETPS+VLVSEMMILANTL G+FF +N + G
Sbjct: 705 VFGSEFNKGQVALSPDENGVLQKVSFKDQLETPSSVLVSEMMILANTLSGQFFKDNNLPG 764

Query: 767 VFRCYKQLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGA 826
           VFRCY+ L L   AQ +Y  L +  K+G     +DI  +S++LNSSFY+   +RHEMIGA
Sbjct: 765 VFRCYQPLALGPQAQNEYELLKSKIKEGKSLTFKDICMISTILNSSFYSSDGYRHEMIGA 824

Query: 827 NQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSS 886
             YLTVTSPLRRFPD+INHLQIHR L+  PLCF++  +DR +W IQSR  ILK ASR S+
Sbjct: 825 PHYLTVTSPLRRFPDMINHLQIHRLLKGLPLCFNKDDVDRFVWHIQSRDSILKDASRCSN 884

Query: 887 TYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIG 946
           TYWTL YLK +++++  K + VMI SVPQ GF  CV PD S AR TLKL P+   +P+IG
Sbjct: 885 TYWTLKYLKQLVENDKNKKFSVMINSVPQVGFVRCVLPDYSSARATLKLKPNEISHPVIG 944

Query: 947 DTVKTCKILKIDCLEGILELE 967
           D ++ C+I KID LEG+LE+E
Sbjct: 945 DIIENCRITKIDALEGLLEME 965

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/912 (48%), Positives = 621/912 (68%), Gaps = 30/912 (3%)

Query: 70  IESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRS------- 122
           +E+  +++L R KGLEPD E++QL QI   F KRYR RY+ PS+ W+   W++       
Sbjct: 21  LENSVKNYLARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFKADWKASDHGEDK 80

Query: 123 ---LTKPKIPSYKLINLDIHFDT--KLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNEL 177
              L +P++    +IN D H     + + ++++ F PA+L++  LNVGD+VLLK   +EL
Sbjct: 81  ATRLLRPEVFDKFIINSDFHRGNMEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSEL 140

Query: 178 AMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIG 237
            MCV+LP ST DPRYTFA  DG++ +A KN V+LRIP+ LP  ++ L++ E +H +  IG
Sbjct: 141 TMCVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIG 200

Query: 238 TVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIP 297
           T+KN SN+T ILP++ RQ+I S + A  +K AW  LPI  KKL+L+HR LQ+  G   + 
Sbjct: 201 TIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVN 260

Query: 298 FFTLVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESN 357
           F +LV +++ L++ +A D  NG  Y+  +++   S  +  ++  T ++TYW + +QQ++N
Sbjct: 261 FMSLVRIIKNLNIKEATDAINGDAYVRKVIDESMSVVNKSIDPTTLLATYWGVREQQQNN 320

Query: 358 LWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDIS 417
           LWG ++ NTALLSPT+V ++PLK  HL+Y +VI +LE+++Y++I  F KLVN++ Y  I+
Sbjct: 321 LWGSVYTNTALLSPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIA 380

Query: 418 SLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILP-NK 476
             Y  +  LL D+AAGN   N ++ T+ISKIFR I++Y+  D+TR +C  L+ EI P + 
Sbjct: 381 KRYDYIRTLLNDYAAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSN 440

Query: 477 MINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSE 536
             N +L N DL +P SS +   +QKLY+ T +  +       + DRYDFGD+ VFCIDSE
Sbjct: 441 SSNFILGNWDLNIPKSSGISSVEQKLYD-TAMPTIVS-----DTDRYDFGDMPVFCIDSE 494

Query: 537 TAHEIDDGVSIENHKKDGLYT-LHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTT 595
            AHEIDDG+SIE  + DG+ + +HIHIADPA LFPES D    GI+ DVL V+LKR+FTT
Sbjct: 495 DAHEIDDGISIE--ELDGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTT 552

Query: 596 YLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGI 655
           YLPDLVVPMLP+S C+ +DLGK  +KT T+SFS +  ++ K  G  + + Y++ ++R GI
Sbjct: 553 YLPDLVVPMLPKSFCNRADLGKHDRKTETISFSFE--LVNKEDGG-LHVDYDTFQVRLGI 609

Query: 656 VSNFPKATYNDVDRILSITDSEAPPF-KEDLESLSMISKLLRELRIKKNNAVIFGEGFNR 714
           VSNFPK TY+ VD IL+  D+  P   K+ LE L  ++  L   RI  +NAV+FG+GFN+
Sbjct: 610 VSNFPKVTYDKVDSILNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNK 669

Query: 715 GLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQL 774
           GLV+L+ + +GEL   +F DQ++T ST+LVSE MIL N L   FF ENKI GV+RCY  L
Sbjct: 670 GLVSLSPDDDGELCIPTFYDQSQTKSTLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGL 729

Query: 775 PLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTS 834
            L   A+ Q+  L  + K G  P L+DITK+SS L+SSFY+  P  H+MIG   YLTVTS
Sbjct: 730 NLGNQAKAQFELLKENIKLGKLPSLKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTS 789

Query: 835 PLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYL 894
           P+RR PDLINHLQ+HR L+K PLCF Q  +D+ +W  Q+RADILK   R+SSTYWTL +L
Sbjct: 790 PMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHL 849

Query: 895 KTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKI 954
               + +  KT+DV++TSVPQNG   C+FP+ S+ARGTLKL+P+ +  P IGDT++ CK+
Sbjct: 850 ----EQSGTKTHDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKV 905

Query: 955 LKIDCLEGILEL 966
             I  L+GIL L
Sbjct: 906 ESIHPLDGILTL 917

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/963 (45%), Positives = 620/963 (64%), Gaps = 38/963 (3%)

Query: 9   ALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAITRPVENEK 68
            L   R  H+ R  FR   +  R R+KN + E   F  T L K+                
Sbjct: 3   VLCATRRLHSSRLSFRALQKQRRSRTKN-KNENPSFGTTPLKKE---------------- 45

Query: 69  EIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPKI 128
           EI+ IN+ FL R  GLEPD+E+K+L  I++++ +RY  R + PS+ WY + W+  +  KI
Sbjct: 46  EIKLINKLFLSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRST-KI 104

Query: 129 PSYKLINLDIHFDTKLESSKQME---FQPAQLMKNPLNVGDLVLLKSRPNELAMCVSLPS 185
              +  + ++    K   +K+ E   F   +L+++PL VGD+VLLKS   EL+MCV+LP 
Sbjct: 105 LGMERFSKNLINGAKPNFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPE 164

Query: 186 STMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSNQ 245
           S  DPRYTFA+I G++ F+T++ + LRIP  +P GI +L+  E  H   PIG +K+  N+
Sbjct: 165 SADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINE 224

Query: 246 TSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLV 305
           T ILP V RQ ITS  P  +S +AW+ LP+T KKL++LHR LQN +G +QIPFF LV LV
Sbjct: 225 TFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLV 284

Query: 306 QKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWGKIHLN 365
             +D++   D K    Y+  L+++ K+     ++++  +STYWAI++QQE+N+WG I  N
Sbjct: 285 DTIDMSSCNDRK----YMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRN 340

Query: 366 TALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQ 425
           +  +SP SVT+ PLK+   +   ++   +  +   I +  +L+NE+ Y  I   YP  + 
Sbjct: 341 SCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMS 400

Query: 426 LLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMI-NPLLLN 484
           +LKD+A+GN + N  +  LIS   RK+  YK  D+++ +C  L+ EI P +   N LL N
Sbjct: 401 MLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNILLFN 460

Query: 485 MDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDG 544
            DL L  SS LGQS ++LY L   +       + + DR DFG+L+V+CIDSETAHEIDDG
Sbjct: 461 HDLNLSNSSNLGQSNKQLYALCGPQ------ISADADRVDFGNLRVYCIDSETAHEIDDG 514

Query: 545 VSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPM 604
           +SI N K +G+Y+L IHIADP+ LF  +++I+   +  DV  +A+++SFTTYLPD+V P+
Sbjct: 515 ISIIN-KGNGIYSLSIHIADPSILFSGASEIQGP-LNDDVFKLAMEKSFTTYLPDIVEPL 572

Query: 605 LPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATY 664
           LP +  + +DLGK GQ T  ++F+V+VK LP  T   + ++Y++  I+   + NFPK TY
Sbjct: 573 LPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDET---LHVLYDTFDIKLSKIRNFPKVTY 629

Query: 665 NDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKE 724
           + V++IL  +D   P  K+DLE L  I++ LR  R+K   AV+FGEGFN+G++      +
Sbjct: 630 SRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQ 689

Query: 725 GELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQY 784
            E+  V F DQ ETP+T+LVSE+MIL NTL G FF +N I G++R Y +L L + A  +Y
Sbjct: 690 AEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEY 749

Query: 785 NSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLIN 844
            SL +S K GV P ++D+T++SSL+NSS YT +P  HEMIGA QYLTVTSPLRRFPDL+N
Sbjct: 750 MSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLN 809

Query: 845 HLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEK 904
           H QIHR L+K P  F+  ++  LIW IQSRADILK  SR  +TYWTL YL+  +  NP K
Sbjct: 810 HFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNK 869

Query: 905 TYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGIL 964
            +DVMITSVP NG   C+FPD+SFARG LKL      YP+IGDTV  C+I+K++ L+GIL
Sbjct: 870 RFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMP-YPVIGDTVTNCRIVKLESLDGIL 928

Query: 965 ELE 967
            LE
Sbjct: 929 YLE 931

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/905 (47%), Positives = 598/905 (66%), Gaps = 15/905 (1%)

Query: 69  EIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPKI 128
           +I+ I E FL R   LEP+I+LK L QI  E+ KR+  RY+ PS+ WY   W  L     
Sbjct: 46  DIKFIRESFLKRTNWLEPNIQLKSLPQIYREYEKRFLSRYIRPSKFWYETLW--LNNDTK 103

Query: 129 PSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMCVSLPSSTM 188
           P +  + L+      +   + + F    L K PL + DL +L++ P+EL+MCV LP S  
Sbjct: 104 PPFNKLFLNNPLPDSISKKQLLNFDYNDLAKTPLKIRDLAILRATPSELSMCVQLPESVE 163

Query: 189 DPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSNQTSI 248
           DPRYTFAS  G + F  ++ + +RIP ++P GI  L+  E  H+  PIGT+K+ +  T I
Sbjct: 164 DPRYTFASRSGKLYFVYRSMIKIRIPYQVPKGIQGLILKELQHEFSPIGTLKSNTKDTFI 223

Query: 249 LPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKL 308
           LP +AR +++    + I+K A    PI  KKL+LLHR LQN  GP  IPF  L+ LV KL
Sbjct: 224 LPYLARNLLSRTGLSDINKAASYQRPIVMKKLELLHRYLQNDKGPTSIPFTHLINLVNKL 283

Query: 309 DLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWGKIHLNTAL 368
           DL++AL  + G +Y+ +L+       S+ MN++  ++ YW++V+  E+ LW  I+ N+A 
Sbjct: 284 DLSQALHLQAGNDYIINLIKEANDPPSI-MNASLTIAVYWSLVELSETFLWDGINRNSAS 342

Query: 369 LSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQLLK 428
           L PT+VT++PL S  ++Y ++IE LE +NYK +++F  LVN++ Y++I   +  +I LL+
Sbjct: 343 LFPTTVTVLPLLSYRVHYTELIEDLERNNYKQLNKFSNLVNDKNYQEIEQSFSKIINLLQ 402

Query: 429 DFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNE---ILPNKMINPLLLNM 485
           ++ AGN  NN  I TLISK+FR I+ Y+  DITRD+C +L+ +   I PN   NPLL N 
Sbjct: 403 EYTAGNLQNNPKITTLISKLFRGIKEYQRCDITRDLCNELLMKFPSIKPNS--NPLLKNH 460

Query: 486 DLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDGV 545
           DLA  A S+ GQ QQ LY+     ++  + S    DR+DFGDL+V+CIDSETAHEIDDG+
Sbjct: 461 DLATRADSQHGQRQQILYDYVKPNDLLIQESL--RDRFDFGDLRVYCIDSETAHEIDDGI 518

Query: 546 SIENHKKDGLYTLHIHIADPASLFPESTDIESQ-GITTDVLNVALKRSFTTYLPDLVVPM 604
           SIE  K +G +TLHIHIADPA  FPE  + +   G+  DVL +A + SFTTYLPD VVPM
Sbjct: 519 SIEK-KFNGKFTLHIHIADPAIFFPECNNEKGVLGLQDDVLKIAYENSFTTYLPDTVVPM 577

Query: 605 LPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATY 664
           LP+S C ++DLG  G+KT ++SFSVDV +L K     ++I Y++ +IR G+VSNFPKATY
Sbjct: 578 LPKSYCKMADLGINGKKTPSISFSVDV-ILNKEKSN-LKICYDTFQIRLGLVSNFPKATY 635

Query: 665 NDVDRILSI-TDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNK 723
           ++VD ILS   +SE    ++DL  LSMI+ +LR  R ++N A+ FGEGFNRG    + + 
Sbjct: 636 DNVDDILSSEVNSEQKLLQDDLRQLSMIAGILRNKRTQENGAITFGEGFNRGTPKYSEDS 695

Query: 724 EGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQ 783
           E E   +SF DQ  T S  LV+E+MILANTL GR+F ENKI GV+RCY  L L+  A+ Q
Sbjct: 696 ETESDVISFVDQKNTKSNELVTELMILANTLCGRYFKENKIFGVYRCYNDLNLEPKAKMQ 755

Query: 784 YNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLI 843
           YN L    K G  P LEDI K+ SLLNSS+Y+  P RH+MIG+ QYLTVTSPLRRF DL+
Sbjct: 756 YNKLREECKNGKLPTLEDIVKVQSLLNSSYYSEHPSRHDMIGSEQYLTVTSPLRRFTDLV 815

Query: 844 NHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPE 903
           +H+Q+H HL+  PL F+Q  I   +  IQSRAD L+  S  S+   TL+YLK ++K+ P+
Sbjct: 816 SHIQLHNHLKGHPLPFNQKAIRNFVPHIQSRADKLRKISTESNVCMTLSYLKNLLKTKPD 875

Query: 904 KTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGI 963
             +DV ITSVP  G A C+ P+ SFARG ++L+PS + YP +GDTV +CK++KI C++GI
Sbjct: 876 TMFDVKITSVPSEGRARCLIPEYSFARGEIRLSPSLKVYPKVGDTVNSCKVVKISCVDGI 935

Query: 964 LELEK 968
           LE  K
Sbjct: 936 LEFNK 940

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/902 (47%), Positives = 588/902 (65%), Gaps = 30/902 (3%)

Query: 69  EIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPKI 128
           +IE INE FL R K LEP +E+K+L QIK+EF  R+ +RY  PS+ W+ ++W        
Sbjct: 51  DIERINEMFLSRTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQDNWVVE----- 105

Query: 129 PSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMCVSLPSSTM 188
           PS          ++    +K   F+ ++ + + L +GDLVL    PNELAMCV LP S  
Sbjct: 106 PSTNTAGKSSSQNSMTGKNKHYTFKLSEFISSVLQMGDLVLTTPYPNELAMCVGLPESAE 165

Query: 189 DPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSNQTSI 248
           DPRYTF ++ G M F TK+ V LRIP +LP  +  L+  E  H   P+GT+K   + T I
Sbjct: 166 DPRYTFVTVSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYI 225

Query: 249 LPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKL 308
           LP +ARQ++TS+ P+QI+KLAW+ LP   K+L+LL R L+ Y G WQ+PF  LV  VQ+L
Sbjct: 226 LPYLARQLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRL 285

Query: 309 DLNKALDNKNG---VNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWGKIHLN 365
           +       K G     Y+  L           +++AT+++TYWAI +QQ  N+WGKIH+N
Sbjct: 286 E------EKGGPGEFEYIKSLFERPSLGSRRSIHAATYLATYWAIKEQQNFNIWGKIHVN 339

Query: 366 TALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQ 425
            A L+P S +++P  S   ++ ++I   +    K +++   L+N + Y  +   YP  +Q
Sbjct: 340 KAFLAPISTSVVPAASLRSFHDELINDPKR---KHVNKITDLINTKDYELVRERYPEFLQ 396

Query: 426 LLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMI-NPLLLN 484
           LL DF AGNF NN  +VTLIS+IFR +++Y+  ++TRD C DL+ EI  +    NP+L N
Sbjct: 397 LLSDFTAGNFDNNCEVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISEDNFCENPILSN 456

Query: 485 MDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDG 544
            DLAL  SS+    Q+ +Y +    ++Q    +    R+DF D+ V+CIDSETAHEIDDG
Sbjct: 457 SDLALAQSSERSALQKCVYSVVQ-PDIQL---DTKTKRHDFLDMPVYCIDSETAHEIDDG 512

Query: 545 VSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPM 604
           VSIE + K G YTLH+HIADPAS FPES   ES  ++ DVL +A  +SFTTYLPD+V  M
Sbjct: 513 VSIEKNGK-GSYTLHVHIADPASFFPESY-TESTKLS-DVLKIAFDKSFTTYLPDVVEAM 569

Query: 605 LPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATY 664
           LPES C  +DLGKQ +KTRT++FSV VK + +  G  + I  ++ + R G+VSNFPK TY
Sbjct: 570 LPESFCRAADLGKQDKKTRTITFSVRVK-MDEHGG--LHIQSDTFRARLGLVSNFPKVTY 626

Query: 665 NDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKE 724
           N VD +L+ + S +P  ++DL +L  I+  LR  R+K N AV+FGEGFN G V L  +  
Sbjct: 627 NIVDSVLNDSSSNSP-LRQDLLTLYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLIRDSA 685

Query: 725 GELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQY 784
            ++ +++F +  ETPSTVLVSE+MILANTL G FF ENKI G+FRCY +L LD  A   Y
Sbjct: 686 NKVKDITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCYNELKLDGKALSDY 745

Query: 785 NSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLIN 844
            S+  + ++G  P L+DI K++SL+NSSFY+G+P  H+MIGA QYLTVTSPLRR+PDLIN
Sbjct: 746 RSIQDNVQRGKNPTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDLIN 805

Query: 845 HLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEK 904
           H+Q+H+HL  KPL FSQ  ID++IW +QSRADILK+ S   S YWTL YLK  ++ +   
Sbjct: 806 HIQLHKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWTLTYLKKRIEKDSSA 865

Query: 905 TYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGIL 964
            +DVM+TS PQ+G   C+FP+ S+ARG LKL       P IGD VK C+I  IDCL+  L
Sbjct: 866 RFDVMVTSFPQDGMVNCLFPNHSYARGKLKLKVD-RLPPQIGDIVKDCQITSIDCLDSNL 924

Query: 965 EL 966
           +L
Sbjct: 925 QL 926

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/930 (44%), Positives = 592/930 (63%), Gaps = 40/930 (4%)

Query: 63  PVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNS--- 119
           PV + + +    +    R   LEP +E+KQL +I+     RY ++Y++PS+ W  ++   
Sbjct: 20  PVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTK 79

Query: 120 WRSLTK------PKIPSYKLINLDIHFDTKL--ESSKQMEFQPAQLMKNPLNVGDLVLLK 171
           W  +          +   +  ++D   + K+  ++S+     P +L+K+PL +GDLVLL+
Sbjct: 80  WGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLR 139

Query: 172 SRPNELAMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHH 231
           S P +L  CV +P+  M+P Y FA+IDG + +A ++ +LLRIP         L++ E  +
Sbjct: 140 SNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKPY 199

Query: 232 KHLPIGTVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYM 291
               IGTVK+   +T ILPI+ARQ+ TS +P +I+K AW  + I T+KL+LLHR LQ   
Sbjct: 200 LDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSS 259

Query: 292 GPWQIPFFTLVGLVQKLDLNKALDNKNGVNYLADLV---------NSYKSADS-----VP 337
           GPWQ+  F L  +   LDL K   + +  +Y+ +L          NS++           
Sbjct: 260 GPWQVSIFKLCQMAVMLDLEK-FRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIES 318

Query: 338 MNSATFVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADN 397
           +++A +++T+WA+ QQQE+NLWG+   + A+L+P SVT++PL SRHLYY  V++ L+ DN
Sbjct: 319 VDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDN 378

Query: 398 YKDIDRFVKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKG 457
           ++ I +F  LVN   +    S  P   Q+LKD+AAGNFHNNG + T++SK+FR I+++KG
Sbjct: 379 HRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKG 438

Query: 458 SDITRDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSN 517
            DITRD+C +L+ ++     +NPLLL+ DLALP+SS     ++K+YE+      Q     
Sbjct: 439 RDITRDLCHELMEKLSHRNTLNPLLLSDDLALPSSSANTALEEKIYEMA-----QPSTKE 493

Query: 518 INGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIES 577
               R+DF  + V+CIDSE+AHEIDDG+SIE   ++  +TLHIHIADP SLF E    + 
Sbjct: 494 DIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNA-FTLHIHIADPVSLFTEDGGTK- 551

Query: 578 QGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKS 637
                +V N+A +R FTTYLPDLV+PMLP+S C    LG    K++T+SFSV++K+    
Sbjct: 552 --FNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGG 609

Query: 638 TGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRE 697
               + I   S K+R G  + FPK TY+ VDRIL   + +    KE L +L  IS LL+ 
Sbjct: 610 ----LRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKE-LRTLYQISLLLQS 664

Query: 698 LRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGR 757
            RI +  A+IFGEGFNRGLV LN  + G L ++ F DQ++TPSTVLVSEMMILANTL GR
Sbjct: 665 KRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGR 724

Query: 758 FFAENKISGVFRCYKQLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQ 817
           +F  NKI GVFRCYK+L L + A++ Y SL    +    P +EDI KLSSLLNSSFYTG 
Sbjct: 725 YFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGT 784

Query: 818 PFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADI 877
           P RH MIGA  YLTVTSPLRRFPDLINHLQI +HL + PL FS+  ID +IW +QSR  +
Sbjct: 785 PDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLV 844

Query: 878 LKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNP 937
           ++ A+R+S+++WTL +LK++  S+P++   VM+TS+P+ GF  CV PDLS ARG LKL P
Sbjct: 845 IRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKP 904

Query: 938 STEHYPMIGDTVKTCKILKIDCLEGILELE 967
                  IGD +  C I K+DCL+ ++EL+
Sbjct: 905 EVSADVAIGDLMHNCVITKLDCLDAVMELK 934

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/915 (44%), Positives = 589/915 (64%), Gaps = 39/915 (4%)

Query: 77  FLHRIKG-LEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNS---WRSLTK------P 126
           F+++  G LEP +E+KQL  I++   +R+ +++ +PS++W  ++   W ++         
Sbjct: 47  FVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLT 106

Query: 127 KIPSYKLINLDIHFDTKLESSKQMEFQ--PAQLMKNPLNVGDLVLLKSRPNELAMCVSLP 184
            + S +  +++     ++  S+   F+  P+ L+ + L +GDLVLL+S P++L MCV +P
Sbjct: 107 SLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVP 166

Query: 185 SSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSN 244
           +   +P Y FA+IDG + F  +N +LLRIP         L++ E    +  IG VK+   
Sbjct: 167 TEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPE 226

Query: 245 QTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGL 304
           +T +L IVARQ+ TS  P +I+K AW  + +TTKKL+LLHR LQ   GPWQ+  F L  L
Sbjct: 227 KTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCEL 286

Query: 305 VQKLDLNKALDNKNGVNYL------------ADLVNSYKSADSVPMNSATFVSTYWAIVQ 352
           V  LD++K   +  G +Y+            A  + S+       ++++ F++TYW++VQ
Sbjct: 287 VALLDIDKCQSSSTG-SYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQ 345

Query: 353 QQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERK 412
           QQE NLWG+IH + A+L+P SVT++PL S HLYY +V+++L+ DNY  ++ F KL+N  +
Sbjct: 346 QQEHNLWGQIHSHRAMLTPISVTVLPLTSHHLYYKEVLKELKKDNYAALESFAKLINTGE 405

Query: 413 YRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEI 472
                  YP + +LL+D+AAGNFHNNG I+T++SK+FRK++ Y+ +DITRD+C + + E+
Sbjct: 406 RNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQEL 465

Query: 473 LPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFC 532
               + NP LL+ ++  P++S+    +QK+Y+L     +  +N +I+  R+DFG + V+C
Sbjct: 466 TCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLA----LPNQNDDIS-RRHDFGKMNVYC 520

Query: 533 IDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRS 592
           IDSETAHEIDDG+SIE   ++  YTLHIHIADP SLF  S   +    + ++ N+AL+R 
Sbjct: 521 IDSETAHEIDDGISIEATGENA-YTLHIHIADPVSLFSNS---QEGSFSKEIWNIALQRG 576

Query: 593 FTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIR 652
           FT+YLPD V PMLP+S     DLGK G  ++TLSFSVD++    +    +EI+  +  ++
Sbjct: 577 FTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNN----VEILEETFSVK 632

Query: 653 KGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGF 712
            G+VS FP+ TY  VDRIL + + +A    ++L +L  I+ LLR  R+K+ NA+IFGEGF
Sbjct: 633 LGLVSQFPRVTYKVVDRILGL-EQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGF 691

Query: 713 NRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYK 772
           NRGLV L   +    T +SF DQ ET STVLVSE+MILANT+ G+FF +  I GVFRCYK
Sbjct: 692 NRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYK 751

Query: 773 QLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTV 832
            L L   A+Q YNSL        FP  +DI KLSSLLNSSFY+ +  +HEMIGA  YL V
Sbjct: 752 GLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPV 811

Query: 833 TSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLN 892
           TSPLRRF DL+NH Q+H +L   PL FS+ Q+  L W IQSR  +L+ A+R+S+++WTL 
Sbjct: 812 TSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLV 871

Query: 893 YLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTC 952
           +LK+  + NP +   VM+TSVP+ G   CV P+LS ARG LKL P       IGD V  C
Sbjct: 872 HLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNC 931

Query: 953 KILKIDCLEGILELE 967
           +I ++DCL+ I+ELE
Sbjct: 932 RITRLDCLDSIMELE 946

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/939 (42%), Positives = 588/939 (62%), Gaps = 34/939 (3%)

Query: 46  YTALFKKDKVKDTAITRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYR 105
           Y +L  K   KDT   +P+  E +I+ I  +FL R   LEPDI LK   QI  E  KR+ 
Sbjct: 33  YVSLTAKLPTKDT--NKPLSRE-DIQLIQANFLKRTNDLEPDIRLKTTAQIHYELDKRFN 89

Query: 106 DRYVVPSESWYSNSWRSLTKPKI--PSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLN 163
            RY+ PS+SWY ++W  L + ++     +LIN D   + K    K ++F    + + PL 
Sbjct: 90  ARYLQPSKSWYESNWEKLNEKRLTLSIRELINKD-PAEFKFNYYKNLKFNIEDVTE-PLK 147

Query: 164 VGDLVLLKSRPNELAMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDS 223
           +GD+VLLK+  +E +MC+ LP S  DPRYTF S  G + F  ++ +LL+IP KLP  I+ 
Sbjct: 148 IGDIVLLKTNTSEFSMCIDLPQSLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNIER 207

Query: 224 LVQPEDHHKHLPIGTVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLL 283
           L+  E  HK+ PIGT+K+  ++T ++P++ARQ++ +  PAQISK A K LP+  KKL+LL
Sbjct: 208 LIIKEPAHKYNPIGTIKSSLDETVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLELL 267

Query: 284 HRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDNKNGVNYLADLV-----NSYKSADSVPM 338
           HR LQ++ GP QI F  L+ +++ L+L++A D + G  Y+ +L+     N Y       +
Sbjct: 268 HRYLQDFSGPQQIHFHKLINIIEALNLDRATDYEKGNEYVNELLKQKYYNDYTDLSLSSL 327

Query: 339 NSATFVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNY 398
           ++   +STYWAI++QQ+  LWG+I  N++ L PT+VTI+P  S H+YY ++I+ L  +N+
Sbjct: 328 DATVALSTYWAIIEQQDLFLWGEIKRNSSSLFPTTVTILPF-SHHVYYTKLIKSLRKNNF 386

Query: 399 KDIDRFVKLVNERKYR----DISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIEL 454
           +  + F   +NE        +I   +P  + LLK++ AGN  +N  I+T++SKIFR +  
Sbjct: 387 RRTNEFSAFINEHNLNTSSPEIQFKFPEFLHLLKEYCAGNLLDNPKIITILSKIFRNLND 446

Query: 455 YKGSDITRDICQDLVNEILP--NKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQ 512
           +K  DIT+D+  +L+ +++P  N + NPLL N DL+LP +S  G++Q KLYEL     ++
Sbjct: 447 FKERDITKDLAYELLTKLIPTSNLLANPLLANHDLSLPTNSGRGENQSKLYELATPTKIE 506

Query: 513 RKNSNINGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKK-DGLYTLHIHIADPASLFPE 571
              +     R++F DL V+CIDSETAHEIDDG+SI+ + K D LY+  +      S+  +
Sbjct: 507 SGETTTK--RHNFNDLNVYCIDSETAHEIDDGISIKKYLKIDLLYSFILLTLQFISM-KD 563

Query: 572 STDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDV 631
           S   +  GI  D+L +A  RSFTTYLPD VVPMLP   C++SDLGK  Q   TL+FSVD+
Sbjct: 564 SNKEKKTGIDDDILKIAYYRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETLTFSVDI 623

Query: 632 KVLPKSTGKP-IEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAP--PFKEDLESL 688
            +   S  +  ++I+Y++ KI+ G+VSNFPK TY+ VD+IL    ++ P     EDL  L
Sbjct: 624 TIFDGSNNEETLKILYDTFKIQFGLVSNFPKVTYDTVDKILD-NSTKIPDTSITEDLRQL 682

Query: 689 SMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMM 748
           S I+KLLR+ RI +NNA++FGEGFNRG+  L + ++    E+ F+DQ  + S  LVSEMM
Sbjct: 683 SRIAKLLRKYRINENNAIVFGEGFNRGIPDLQSTED----EIIFTDQKNSDSNELVSEMM 738

Query: 749 ILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQYNSLITSAKK-GVFPKLEDITKLSS 807
           ILANTL G++  ++KI  ++RCY   PLD   + Q   +I  +K     P   D+ K+SS
Sbjct: 739 ILANTLTGKYCKDHKIPVIYRCYS--PLDIGPEAQQECIILRSKNIDRLPSNIDMAKMSS 796

Query: 808 LLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRL 867
            LNSS+Y+G P RH M+G+++Y TVTSPLRRFPDL+NH+Q+H HL+   L F+   +   
Sbjct: 797 FLNSSYYSGTPSRHSMLGSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNHVAHY 856

Query: 868 IWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLS 927
           +  IQSR+D LK       T  TLNY+K ++   P K +DV++TSVP  G A C      
Sbjct: 857 LTTIQSRSDTLKNIGNAVYTEMTLNYIKLLINKEPTKAFDVLVTSVPIEGSARCAIVGYE 916

Query: 928 FARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGILEL 966
           +ARGT+KL       P+IGD +  CK+ KI  +EG LEL
Sbjct: 917 YARGTIKLKAEINPVPIIGDIITKCKVTKIFPIEGALEL 955

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/919 (44%), Positives = 580/919 (63%), Gaps = 44/919 (4%)

Query: 71  ESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWY---SNSWRSLTKPK 127
           ++I + FL+R  GLE       + +IK    KR+   Y  PS +WY     S    + P 
Sbjct: 20  DTIIKKFLNRTSGLETISIPHSIQKIKSNSIKRFNLTYNQPSNTWYKSLLISSPPPSLPC 79

Query: 128 IPSYKLINLDIHFDTKLESSKQMEFQPA--------QLMKNPLNVGDLVLLKSRPNELAM 179
            PS           +   S K + F P         QL K   N GD+VLL    + L M
Sbjct: 80  SPSTSTSTSATTATSTSNSPKWLSFIPKNNHTFNINQLNKK-FNRGDIVLLSQDLSNLYM 138

Query: 180 CVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGI---DSLVQPEDHHKHLPI 236
           C+ LP ST DPRY+FA+ +G + FA ++ VLLRIP +LPT +   D  +QPE       +
Sbjct: 139 CIELPQSTADPRYSFANSNGDIIFANRSSVLLRIPLQLPTNLLLSDDFLQPEPTQG---V 195

Query: 237 GTVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQI 296
           GTVKN  +   +LP++ RQ++ S S + IS  A   LPI  KKLQLLHR+LQ +     I
Sbjct: 196 GTVKNSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLKKLQLLHRNLQAFK---II 252

Query: 297 PFFTLVGLVQKLDLNKALDNKNGVNYLADLV-NSYKSADSVPMNSATFVSTYWAIVQQQE 355
           P   L  LVQ LDL KA  N +G +Y+++ + NS ++     +NS+  ++T+WAI QQQ+
Sbjct: 253 PLVQLSSLVQNLDLTKATSN-DGESYISNFIANSNENYSIESINSSNLIATFWAIRQQQQ 311

Query: 356 SNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRD 415
            +LWG IH + ALL P +V+I+PL+S ++YY +++  +E D+   I+RF K        +
Sbjct: 312 DHLWGDIHYSKALLFPLAVSILPLQSNYMYYKEILPAIELDH--SIERFTK----NGIPN 365

Query: 416 ISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILP- 474
             + +P ++ LLK +A+G    +  IVT+ISKIFR ++ YK  D++RD+CQ L NE++P 
Sbjct: 366 TPNEFPQLLNLLKQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVSRDLCQKLYNELVPK 425

Query: 475 -NKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCI 533
             K+ N LL N DLALP +S   + Q+K+Y++ N   +Q  N   N +R+DFGDL+VFCI
Sbjct: 426 EQKIQNSLLYNTDLALPLASNRTEEQEKVYQMYN--PIQTSN---NSNRHDFGDLRVFCI 480

Query: 534 DSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSF 593
           D +TAHEIDDGVSIE +K++ +YTLH+HIADP+S F    D        ++L +AL+RSF
Sbjct: 481 DEKTAHEIDDGVSIE-YKQNNVYTLHVHIADPSSYFKICNDHNVNIENDEILKIALQRSF 539

Query: 594 TTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRK 653
           TTYLPD V+PMLP+ +C  +DLGK G+KT+T++FSVDVK+  K     ++++ N+ ++R 
Sbjct: 540 TTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFSVDVKLNKKDMT--VKVLDNTFQVRL 597

Query: 654 GIVSNFPK-ATYNDVDRILSITDSEA--PPFKEDLESLSMISKLLRELRIKKNNAVIFGE 710
           G VSNF K  TY+DVD IL+ +         ++DL+S+ +I+K L   RI  NNAVIF +
Sbjct: 598 GYVSNFVKDMTYSDVDSILNDSKESGRDKKVEKDLKSMFLIAKGLNNSRIM-NNAVIFSD 656

Query: 711 GFNRGLVTLNTNK-EGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFR 769
             N G + L  ++  GE+T+++F     T S +LVSE+MILAN+L G+FFAEN I  ++R
Sbjct: 657 EINNGKIELTKDEITGEVTQINFKGGKFTDSNILVSELMILANSLAGKFFAENGIPAIYR 716

Query: 770 CYKQLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQY 829
            Y  L L   AQ +YN+++++ K G  P L+DI K+SSL N+S +T  P  H MI    Y
Sbjct: 717 SYSDLLLGKDAQSEYNAMLSNLKLGKRPTLKDINKISSLFNTSKFTTYPSPHSMIATKYY 776

Query: 830 LTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYW 889
            TVTSPLRRFPD+INHLQIHR L K+PLCF+Q  ++ + W IQ++  IL+++SR  +TYW
Sbjct: 777 ATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRDLENMNWNIQTKDVILRSSSRMINTYW 836

Query: 890 TLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTV 949
           TL ++K  +  +P+K +DVMITSV QNG A C+    SFA+G L  +P+ E +P+IGDTV
Sbjct: 837 TLRHIKDQLSEDPDKKFDVMITSVQQNGVAHCILAQFSFAKGKLVFDPNDESHPLIGDTV 896

Query: 950 KTCKILKIDCLEGILELEK 968
             CKI KIDCL  +LE  K
Sbjct: 897 SNCKITKIDCLGNVLEFSK 915

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/989 (42%), Positives = 595/989 (60%), Gaps = 105/989 (10%)

Query: 68   KEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSN-SWRSLT-K 125
            ++IE I + FL RIK L+P I +K+L +I  E+ KR+  R+++PS  W+++  W S T  
Sbjct: 53   EDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTIT 112

Query: 126  PKIPSYKL---INLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMCVS 182
            PK   Y L    + D  +   + +S  + F    L  +PLN+GDL+LL    N L MCV 
Sbjct: 113  PKFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSN-LLMCVD 171

Query: 183  LPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGI-DS-LVQPEDHHKHLPIGTVK 240
            +P +T DPRYTFAS DG + F T++ + LRIP KLP  + DS L+  E  H +  IGT+K
Sbjct: 172  IPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIK 231

Query: 241  NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
            N  N   +LPI+ARQ++       ++K A   L I  KKL+L+HR +QN  GP+QI FF 
Sbjct: 232  NTQNIKILLPIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQISFFK 291

Query: 301  LVGLVQKLDLNKALDNKN---GVNYLADLV-NSYKSADS-VPMNSATFVSTYWAIVQQQE 355
            L+ L+  L+LN   ++K     +N+   L  N  +S +S   ++++TF++TYWAI  QQ+
Sbjct: 292  LIKLIDILNLNDFDNSKKFDINLNFSKLLSSNEIESLNSSTEIDASTFLATYWAIRLQQQ 351

Query: 356  SNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLE--ADNYKDI-DRFVKLVNERK 412
              LWGKI +N ALLSP SVT++PL   H YY   +++      N K + D F+  +N + 
Sbjct: 352  DFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDINNQS 411

Query: 413  Y--------------------------RDISSLYPSVIQLLKDFAAGNFHNNGIIVTLIS 446
                                       ++IS  YP  I + +++ AGNF +N  I+ LIS
Sbjct: 412  TTNTTNNNNNTTIITTTTTNNNKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALIS 471

Query: 447  KIFRKIELYKGSDITRDICQDLVN--------------------------------EILP 474
            KI R++  +K SD+T+D C++L++                                +  P
Sbjct: 472  KILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTP 531

Query: 475  NKM------INPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDL 528
            N +       N L  N+++ALP SSKL + Q   Y L  IE    K +  +   +DF DL
Sbjct: 532  NGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNL--IE--PPKLTQFSKFHHDFNDL 587

Query: 529  KVFCIDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLF---PESTDIESQGITTDVL 585
            KV+CIDSETAHEIDDG+SIE    + L+TLHIHIADP+S+F    +++DI+      ++L
Sbjct: 588  KVYCIDSETAHEIDDGISIE-KLNNNLFTLHIHIADPSSIFLNHEKNSDIQ------NLL 640

Query: 586  NVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEII 645
            N+AL +SFTTYLPDLV PMLP+S C LSDLG   QKT T+SFSV+V+V   S  + I+I+
Sbjct: 641  NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEV--DSNNESIKIL 698

Query: 646  YNSLKIRKGIVSNFP-KATYNDVDRILSITDSE------APPFKEDLESLSMISKLLREL 698
            +N+ K+R GIVS FP   TY++VDRILS +  E          + DL +LS IS LL++ 
Sbjct: 699  HNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKN 758

Query: 699  RIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRF 758
            RI+  NAVIFGEGFN+GLVTL+ +K+G    ++F DQ +T S  LV+EMMILAN+L  R 
Sbjct: 759  RIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQNDTKSVTLVTEMMILANSLAARL 817

Query: 759  FAENKISGVFRCYKQLPLDAIAQQQYNSLITSAK-KGVFPKLEDITKLSSLLNSSFYTGQ 817
            F ENKI G+FRCY +L L   AQ +++ L  + K     P +++I+K  SLLNSSFYT  
Sbjct: 818  FKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDL 877

Query: 818  PFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADI 877
            P  H+MIGA  YLTVTSPLRRFPDL+NH+QI   ++KKP  +S   I +++  IQSR  I
Sbjct: 878  PLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDII 937

Query: 878  LKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNP 937
            ++  S   + Y+ LNYLK  +K NP +T+DV+ITSV   GF  C+ P+ S + G LKL P
Sbjct: 938  IRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKP 997

Query: 938  STEHYPMIGDTVKTCKILKIDCLEGILEL 966
              +  P IGD ++ CKI KID L+G L+ 
Sbjct: 998  DLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/913 (41%), Positives = 574/913 (62%), Gaps = 37/913 (4%)

Query: 70  IESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPKIP 129
           +E +   FL R KGLE   E+K++ +I+ +    + + Y+VPS+ W+     ++T     
Sbjct: 37  LELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFD----TVTSSGSF 92

Query: 130 SYKLINLDI------HF-DTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMCVS 182
           S  LIN  +       F D  ++ +    F   QL    L++GDLVLL++   EL MCV 
Sbjct: 93  SNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVD 152

Query: 183 LPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNF 242
           +P S  DPR+TFA  DG++ F+TK  V LRI   LP  I +    ++ ++   I   +N 
Sbjct: 153 IPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKENN 212

Query: 243 SNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLV 302
           + +   LP+VARQ+ TS  P++IS++A + L +  KKL++LHR + + +    I F  LV
Sbjct: 213 AIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKLV 272

Query: 303 GLVQKLDLNKALDNK--NGVNYLADLVNSYKSADS--VPMNSATFVSTYWAIVQQQESNL 358
            LVQ +DLNK   N+  +  N++++++ + K        +++ T +STYWA++QQQ+S L
Sbjct: 273 HLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQQQSQL 332

Query: 359 WGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISS 418
           WG I +++ALL P SV+++P  +  +Y  + I ++  D  ++I++F + +N+     I+ 
Sbjct: 333 WGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAINKHNLEKINE 389

Query: 419 LYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILP-NKM 477
            +P  + +LK++  G ++ N  I T+ISK+FR+IE YK  +++RD CQ L NE+ P NK+
Sbjct: 390 KFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNELNPSNKI 449

Query: 478 INPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSET 537
           +N LLL+ DL LP  S   +++Q +Y LT ++N    ++ I+  R+DF DLKVFCID +T
Sbjct: 450 LNSLLLSKDLCLPEISGTTRTEQLIYSLTEVDN----HAIIDQRRHDFKDLKVFCIDEKT 505

Query: 538 AHEIDDGVSIENHKKDGLYT-LHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTY 596
           AHEIDDGVS+   +KDG  T L IHIADPASLFP    IE+   + ++LN+A +R+FTTY
Sbjct: 506 AHEIDDGVSV--LRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTY 563

Query: 597 LPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIV 656
           LP+ V+PMLP+S C  SDLG  G+ T T++FSVD     KS+     I+ ++ +I+ G V
Sbjct: 564 LPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVD---FDKSS---CSILEDTFEIQLGKV 617

Query: 657 SNFPK-ATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRG 715
           +NFPK  TY +VD+IL+ +       + DL  +  I+  LR+ RI  N+AVIFGEGFN+G
Sbjct: 618 NNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRID-NSAVIFGEGFNKG 676

Query: 716 LVTLNTNKE-GELT-EVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQ 773
            V L   K+ GE + +V+F D   TPS ++VSE MILAN+L G++F  +KI  +++ YK 
Sbjct: 677 AVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKG 736

Query: 774 LPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVT 833
           L +   A  Q+  ++   KK + P +++I+K+ SLL+SS ++ +P  HEMIG +QY TVT
Sbjct: 737 LNMKPKASSQFKKILNVNKKRL-PSIKEISKIGSLLSSSTFSSKPSIHEMIGTDQYATVT 795

Query: 834 SPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNY 893
           SPLRRFPDLINH Q+HR+L  +PLCFSQ ++D ++W +  R  IL+  SR  + YWTL Y
Sbjct: 796 SPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855

Query: 894 LKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCK 953
           L   ++ NP   +DVM+ SV +NG   C+ P LS+A GTLKL PS    P IG+ +K CK
Sbjct: 856 LNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCK 915

Query: 954 ILKIDCLEGILEL 966
           I  IDCL   LE 
Sbjct: 916 IANIDCLGNSLEF 928

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/950 (37%), Positives = 559/950 (58%), Gaps = 75/950 (7%)

Query: 71  ESINED----FLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTK- 125
           ES+ ED    F  + K + P++E+K   + K E   R+ DR+V PS  WY    +S  + 
Sbjct: 45  ESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGEN 104

Query: 126 -PKIPSYKLINLDIHFDTKLES---------------------SKQME--FQPAQLMKNP 161
             K     L+  DI   T  E                      ++++E  F P+ ++ + 
Sbjct: 105 TDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSST 164

Query: 162 LNVGDLVLLKSRPNELAMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGI 221
           L  GD+ +LK+ P EL +CV  PS  MD R+TFA+ DG++ +A K  V LR P    T  
Sbjct: 165 LMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTE 224

Query: 222 DSLVQPEDHHKHLPIGTVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQ 281
             ++Q E  H + P+G+VKN  + T ++P + R+M+ S    +I+  A + LPI  KKL+
Sbjct: 225 LEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLE 284

Query: 282 LLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDN-------KNGV--NYLADLVNS-YK 331
           L+HR LQ+   PWQIP   LV +   L+L+  ++        K+G+  + L  L NS ++
Sbjct: 285 LIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFE 344

Query: 332 SADSVP--MNSATFVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQV 389
            +  VP  +  +  ++ YWA++ QQ + +WG++ ++  +  P++VT++PL  +HL+Y  +
Sbjct: 345 LSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNI 404

Query: 390 IEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIF 449
           I KL       I+R   L+NE     ++  +P ++ LL+D+AAGN  +N  I +LIS +F
Sbjct: 405 IHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLF 464

Query: 450 RKIELYKGSDITRDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIE 509
           RK++ YK  +I+RD+C DL+  I P++  NPLL+N +L LP +++  + +QK+Y+L    
Sbjct: 465 RKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPP 524

Query: 510 NMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLF 569
            ++  ++ I   R ++ DL  +CIDS  AHEIDD VSI++      Y ++IH+ADPASLF
Sbjct: 525 KIEH-SAEI---RTEYKDLICYCIDSPDAHEIDDAVSIKS-LGGAKYRIYIHVADPASLF 579

Query: 570 PESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSV 629
           PE+ + +   I + VL++A +R+FTTYLPD V PMLP +    SDLG+ G+ T+ ++FSV
Sbjct: 580 PEANE-DGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSV 638

Query: 630 DVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFK-EDLESL 688
           D      S  K + ++ +SLK+   ++    + TY  VD +L    ++    K EDL++L
Sbjct: 639 DCTF---SKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTL 695

Query: 689 SMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMM 748
             I+K LR  RI    AV+F E  + G+V+L+ +   EL EVSF DQ ET ST+LVSE+M
Sbjct: 696 FYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELM 754

Query: 749 ILANTLVGRFFAENKISGVFRCYKQLPLDAI-----------AQQQYNSLITSAKKGVFP 797
           ILAN+L   +F EN+I G++R Y+  PL+ +           A+ Q N +I+ A      
Sbjct: 755 ILANSLTASYFEENQIPGIYRGYR--PLNVVEDATSVPEWVKAKTQENKIISKA------ 806

Query: 798 KLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPL 857
              DI K+ S L SSFY+  P  H+M+G + YLT+TSPLRRFPDL+NHLQ+HR L+  PL
Sbjct: 807 ---DIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863

Query: 858 CFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNG 917
            + Q+Q+D ++W I +R   LK AS ++  YWTL +LK  ++   +  + + ITS+  NG
Sbjct: 864 LYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNG 923

Query: 918 FAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGILELE 967
           +A CV  D +FA G LK+N + ++ P++GD +  C+I  I CL+GIL+ E
Sbjct: 924 YAHCVILDKAFAVGQLKINLN-KNPPLVGDQISDCEISNIQCLDGILQFE 972

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/832 (39%), Positives = 495/832 (59%), Gaps = 34/832 (4%)

Query: 152 FQPAQLMKNPLNVGDLVLLKSRPNELAMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLL 211
            +P  L    L +GDL +L + P +L +CV  P+   D RY FA  DG++ +ATK+ V L
Sbjct: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRL 60

Query: 212 RIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSNQTSILPIVARQMITSKSPAQISKLAWK 271
           R+P      +  L+  E  H + P+GTVKN  ++T +LP+  R++  +    +IS+ A  
Sbjct: 61  RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120

Query: 272 HLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDL--NKALDNKNGVNYLADL--- 326
            LP    KL+LLHR LQ+++GPWQ+  F LV LV +L+L  +    ++     LA+L   
Sbjct: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIG 180

Query: 327 VNSYKSADSVPMNSAT--------FVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIP 378
             SY SA  + +  A         +++TYW ++QQQ   +WG I  + AL SP SVT++P
Sbjct: 181 QGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLP 240

Query: 379 LKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNN 438
           L+ + L+Y  ++  ++ D+Y  +D F  LVN+ KY++  S Y SV+QLL+D+ AGN ++N
Sbjct: 241 LRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSN 300

Query: 439 GIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQS 498
             ++ L++++FR+++ YK  ++TR I   L+ ++ P    NPL  N  L LP S+     
Sbjct: 301 AALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTAL 360

Query: 499 QQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKKDGLYTL 558
           +QK+Y+L +    Q +     G R +F  +  +CIDS  AHEIDDGVSIE   K   Y L
Sbjct: 361 EQKVYDLASPPLDQEEP----GPRKEFSGV-CYCIDSPDAHEIDDGVSIER-LKGSRYRL 414

Query: 559 HIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQ 618
           H+HIA P SLF +S       I   V+++A +R+FTTYLPDLV PM+P+S    SDLG+ 
Sbjct: 415 HVHIAYPYSLFKKSYTPGEVPIDP-VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQW 473

Query: 619 GQKTRTLSFSVDVKVLPKSTGKPIEIIYNS-LKIRKGIVSNFPKATYNDVDRILSI--TD 675
            + T+T++ SVDV +      K + ++  + L+I  G      + TY+ VD +L     D
Sbjct: 474 DKPTKTITISVDVDL-----SKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQD 528

Query: 676 SEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQ 735
           +EA     DL  L  +++ LRE R    +A++FG+  N GL++L  N++G+L  V   D 
Sbjct: 529 AEA----SDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDS 583

Query: 736 AETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQYNSLITSAKKGV 795
             T S  LVSE+MI+AN+L GR+F EN I GV+R   +L L   A  QY SL  + ++  
Sbjct: 584 KSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKG 643

Query: 796 FPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKK 855
                D+ K+++ L +S Y+  P RH M+G  +YLT+TSPLRR PD+INH+Q+HRHL+  
Sbjct: 644 SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSL 703

Query: 856 PLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQ 915
           P CFSQ QID L W I +R   LK AS+ SS +WTL YLK  + + P+K +D+++TS+P 
Sbjct: 704 PPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPL 763

Query: 916 NGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGILELE 967
           NGF  C  P + ++ G LK+ PS  + P +G TV  C I ++D L+G L  E
Sbjct: 764 NGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFE 814

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 107/462 (23%), Positives = 185/462 (40%), Gaps = 81/462 (17%)

Query: 506 TNIENMQRKNSN-INGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIH 561
           TNI + Q +  + +  +R D  D  +  ID     +IDD +    H K   +G + + +H
Sbjct: 528 TNINDPQEQAKDPLLKNRQDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVH 583

Query: 562 IADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQK 621
           IAD        T ++++G +         R  + YL D  + MLP  +   +DL      
Sbjct: 584 IADVTHFVKPGTALDAEGAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPY 632

Query: 622 TRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPF 681
               +FSV  ++   +     EII   +K  K ++ +    +Y      L I D      
Sbjct: 633 VDRFAFSVIWELDDNA-----EII--DVKFTKSVIRSREAFSYEQAQ--LRIDD------ 677

Query: 682 KEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAET 738
           K   + L+   + L EL +K     +     N     +  + + E +   EV       T
Sbjct: 678 KNQTDELTKGMRALLELSVKLKQKRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLAT 737

Query: 739 PSTVLVSEMMILANTLVGR-FFAENKISGVFRCYKQLP------LDAIAQQQYN------ 785
            S  LV E M+LAN  V R  F     + + R +   P      L+ + Q++ N      
Sbjct: 738 NS--LVEEFMLLANISVARKIFDAFPQTAMLRRHASPPSTNFAILNEMLQKRKNLSISLE 795

Query: 786 ---SLITSAKKGVFPKLEDITKLSSLLNSS-------FYTG----QPFRHEMIGANQYLT 831
              +L  S  + + PK      L  ++++        FY+G      FRH  +  + Y  
Sbjct: 796 SSKALADSLDRCIDPKDPYFNTLIRIMSTRCMMAAQYFYSGAYQYSDFRHYGLAVDIYTH 855

Query: 832 VTSPLRRFPDLINHLQIHRHLQKKPLCF---SQAQIDRLIWPIQSRADILKTASRNSSTY 888
            TSP+RRF D+I H Q+   +  +PL      + +++ +   I  +    + A R S  Y
Sbjct: 856 FTSPIRRFCDVIAHRQLAGAIGYEPLALMHRDKNKMEMICKNINKKHRNAQFAGRASIEY 915

Query: 889 WTLNYLKTMMKSNP--EKTYDV------MITSVPQNGFAGCV 922
               Y+  +M++N   E  Y +      ++  VP+ G  G +
Sbjct: 916 ----YVGQVMRNNECTETGYVIKVLNNGIVVLVPKFGVEGLI 953

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 102/445 (22%), Positives = 178/445 (40%), Gaps = 80/445 (17%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 526 RKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGHWEVGVHIADVTHFVKPGTALDAE 581

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 582 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWEL----- 625

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
            +  +II  +++  K ++ +     Y      L I D    P ++D  +L M  + L +L
Sbjct: 626 DENADII--NVEFHKSVIRSREAFAYEQAQ--LRIDD----PKQQDELTLGM--RALLQL 675

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 676 SIKLKQKRLEAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISV 733

Query: 756 GR-FFAENKISGVFRCYKQLP------LDAIAQQQYN---------SLITSAKKGVFPKL 799
            R  +     + + R +   P      L+ + Q++ N         +L  S  +   PK 
Sbjct: 734 ARKIYDSFPQTAMLRRHAPPPATNFEILNEMLQRRKNMSISVESSKALADSLDRCEDPKD 793

Query: 800 EDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 794 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDIVAHRQL 853

Query: 849 HRHLQKKPLCF---SQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNP--E 903
              +  +PL      + ++D +   I  +    + A R S  Y    Y+  +MK+N   E
Sbjct: 854 AGAIDYEPLSLDHRDKHKMDMICRNINRKHRNAQFAGRASIEY----YVGQVMKNNESLE 909

Query: 904 KTYDV------MITSVPQNGFAGCV 922
             Y +      ++  VP+ G  G +
Sbjct: 910 SGYVIKVFNNGIVVLVPKFGVEGLI 934

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 100/437 (22%), Positives = 171/437 (39%), Gaps = 73/437 (16%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H +   +G + + +HIAD       ST ++++
Sbjct: 560 RKDLRDKVICSIDPPGCVDIDDAL----HARKLPNGNWEVGVHIADVTHFVKPSTALDAE 615

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G           R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 616 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVMWELDDNAD 664

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              +E + + +K R+    ++ +A        L I D      K   + L++  + L +L
Sbjct: 665 IVNVEFMKSVIKSREAF--SYEQAQ-------LRIDD------KNQDDELTLGMRALLKL 709

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 710 SIKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 767

Query: 756 GR-FFAENKISGVFRCYKQLPLD---------------AIAQQQYNSLITSAKKGV---- 795
            R  +     + + R +   P                 +I+ +   +L  S  + V    
Sbjct: 768 ARKIYDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDSED 827

Query: 796 --FPKLEDITKLSSLLNSS-FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
             F  L  I     ++ +  FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 828 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 887

Query: 849 HRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKT 905
              +  +PL  +   + ++D +   I  +    + A R S  Y    Y+  +M+SN E T
Sbjct: 888 AGAIGYEPLSLAHRDKNKMDMICRNINRKHRNAQFAGRASIEY----YVGQVMRSN-EST 942

Query: 906 YDVMITSVPQNGFAGCV 922
               I  V  NG    V
Sbjct: 943 ETGYIIKVFNNGIVVLV 959

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 91/454 (20%), Positives = 177/454 (38%), Gaps = 98/454 (21%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 537 RRDLRDKLICSIDPPNCVDIDDAL----HAKMLENGNWEVGVHIADVTHFVKPGTALDAE 592

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 593 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDQDAN 641

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++   + ++ R+       +   +D ++   +T        + + +L  +SK L++ 
Sbjct: 642 IVNVDFTKSVIRSREAFSYEQAQIRIDDPNQTDELT--------QGMRALLQLSKKLKQK 693

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRF 758
           R+            + G + L + +     +V    +   P+ V + +++   N+LV  F
Sbjct: 694 RL------------DAGALNLASPE----VKVHMDSETSDPNEVEIKKLLA-TNSLVEEF 736

Query: 759 FAENKISGVFRCYKQLPLDAIAQQQ----------YNSLITSAKKGVFPKLEDITKLSSL 808
                IS   + Y   P  A+ ++            N ++ + KKG+   LE    L+  
Sbjct: 737 MLLANISVARKIYDSFPQTAMLRRHAAPPSTNFEILNEMLQT-KKGLTISLESSKALADS 795

Query: 809 LNSS-------------------------FYTG----QPFRHEMIGANQYLTVTSPLRRF 839
           L+                           FY+G      FRH  +  + Y   TSP+RR+
Sbjct: 796 LDRCVDKNDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRY 855

Query: 840 PDLINHLQIHRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKT 896
            D++ H Q+   +  +PL  +   + ++D +   I  +    + A R S  Y    Y+  
Sbjct: 856 CDVVAHRQLAAAIGYEPLSLTHRDKTKMDMICKNINRKHRNAQFAGRASIEY----YVGQ 911

Query: 897 MMKSNP--EKTYDV------MITSVPQNGFAGCV 922
           +M++N   E  Y +      ++  VP+ G  G +
Sbjct: 912 VMRNNESVETGYVIKVFNNGIVVLVPKFGVEGLI 945

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 99/445 (22%), Positives = 172/445 (38%), Gaps = 80/445 (17%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD       +T ++++
Sbjct: 527 RKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKPNTPLDAE 582

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 583 GAS---------RGTSVYLVDKRIDMLPLLLG--TDLCSLKPYVDRYAFSVLWEL--DDN 629

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              +++ +    IR     ++ +A        + I D      K   + L+   + L +L
Sbjct: 630 ANIVDVNFTKSVIRSREAFSYEQAQ-------IRIDD------KSQTDELTQGMRALLKL 676

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 677 SIKLKQKRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 734

Query: 756 GR-FFAENKISGVFRCYKQLPLD---------------AIAQQQYNSLITSAKKGVFPKL 799
            R  F     + + R +   P                  I+ +   +L  S  + V PK 
Sbjct: 735 ARKIFESFPQTAMLRRHGVPPSTNFETLNEMLHQRKQMTISLESSKALADSLDRCVDPKD 794

Query: 800 EDITKLSSLLNSS-------FYTG----QPFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 795 PYFNTLIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 854

Query: 849 HRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNP--E 903
              +  +PL  S   + ++D +   I  R    + A R S  Y    Y+  +M++N   E
Sbjct: 855 AGAIGYEPLDLSHRDKNKMDMICRNINKRHRNAQFAGRASIEY----YVGQVMRNNESVE 910

Query: 904 KTYDV------MITSVPQNGFAGCV 922
             Y +      ++  VP+ G  G +
Sbjct: 911 TGYVIKVLNNGIVVLVPRFGVEGLI 935

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 95/437 (21%), Positives = 170/437 (38%), Gaps = 73/437 (16%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD       +T ++++
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPNTALDAE 586

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G           R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 587 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDDAN 635

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++ + + +K R+    ++ +A +   D             K   + L+   + L EL
Sbjct: 636 IVNVDFMKSVIKSREAF--SYEQAQFRIDD-------------KNQNDELTSGMRALLEL 680

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 681 SIKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 738

Query: 756 GR-FFAENKISGVFRCYKQLPLD---------------AIAQQQYNSLITSAKKGVFPKL 799
            R  +     + + R +   P                 +I+ +   +L  S  + V P+ 
Sbjct: 739 ARKIYDAFPQTAMLRRHAAPPSTNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPED 798

Query: 800 EDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 799 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

Query: 849 HRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKT 905
              +  +PL  +   + ++D +   I  +    + A R S  Y    Y+  +M++N E T
Sbjct: 859 AGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEY----YVGQVMRNN-EST 913

Query: 906 YDVMITSVPQNGFAGCV 922
               +  V  NG    V
Sbjct: 914 ETGYVIKVFNNGIVVLV 930

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 101/455 (22%), Positives = 176/455 (38%), Gaps = 75/455 (16%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKPGTALDAE 586

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G           R  + YL D  + MLP  +   +DL          +FSV  ++    +
Sbjct: 587 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWEL--DDS 633

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              + + +    IR     ++ +A        L I D      K   + L+M  + L +L
Sbjct: 634 ANIVNVNFMKSVIRSREAFSYEQAQ-------LRIDD------KTQNDELTMGMRALLKL 680

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            +K     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 681 SVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 738

Query: 756 GR-FFAENKISGVFRCYKQLPLD---------------AIAQQQYNSLITSAKKGVFPKL 799
            R  +     + + R +   P                 +I+ +   +L  S  + V P+ 
Sbjct: 739 ARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPED 798

Query: 800 EDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 799 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

Query: 849 HRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKT 905
              +  +PL  +   + ++D +   I  +    + A R S  Y    Y+  +M++N E T
Sbjct: 859 AGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEY----YVGQVMRNN-EST 913

Query: 906 YDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTE 940
               +  V  NG    V P      G ++L+  TE
Sbjct: 914 ETGYVIKVFNNGIVVLV-PKFG-VEGLIRLDNLTE 946

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 99/457 (21%), Positives = 172/457 (37%), Gaps = 104/457 (22%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 518 RVDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGHFEVGVHIADVTHFVKAGTPLDAE 573

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 574 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWEL--DEN 620

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              +++ ++   IR     ++ +A        L I D      K   + L++  + L +L
Sbjct: 621 ADIVKVDFSKSVIRSREAFSYEQAQ-------LRIDD------KNQTDELTLGMRALLDL 667

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 668 SIKLKQKRLDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISV 725

Query: 756 GRFFAENKISGVFRCYKQLPLDAIAQQQ----------YNSLITSAKKGVFPKLEDITKL 805
            R           + Y   P  A+ ++            N ++   +KG+   LE    L
Sbjct: 726 AR-----------KIYDSFPQTAMLRRHAAPPSTNFEILNEMLQK-RKGLSISLESSKAL 773

Query: 806 SSLLNSS-------------------------FYTG----QPFRHEMIGANQYLTVTSPL 836
           +  L+                           FY+G      FRH  +  + Y   TSP+
Sbjct: 774 ADSLDRCVDKKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPI 833

Query: 837 RRFPDLINHLQIHRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNY 893
           RR+ D++ H Q+   +  +PL  S   + +++ +   I  R    + A R S  Y    Y
Sbjct: 834 RRYCDVVAHRQLAGAIGYEPLDLSHRDKNKMEMICKNINRRHRNAQFAGRASIEY----Y 889

Query: 894 LKTMMKSNP--EKTYDV------MITSVPQNGFAGCV 922
           +  +M++N   E  Y +      ++  VP+ G  G +
Sbjct: 890 VGQVMRNNESVETGYVIKVLNNGIVVIVPKFGVEGLI 926

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 99/445 (22%), Positives = 176/445 (39%), Gaps = 80/445 (17%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD       +T ++ +
Sbjct: 523 RRDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKPNTALDGE 578

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 579 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELNENAD 627

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++   + +K R+    ++ +A        L I D    P ++D   L+   + L +L
Sbjct: 628 IVNVDFAKSVIKSREAF--SYEQAQ-------LRIDD----PNQQD--ELTHGMRALLKL 672

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     I     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 673 SIKLKEKRINAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 730

Query: 756 GR-FFAENKISGVFRCYKQLPLD---------------AIAQQQYNSLITSAKKGVFPKL 799
            R  +     + + R +   P                 +I+ +   +L  S  + + PK 
Sbjct: 731 ARKIYDSFPQTAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKD 790

Query: 800 EDITKLSSLLNSS-------FYTG----QPFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 791 PYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 850

Query: 849 HRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNP--E 903
              +  +PL  S   + ++D +   I  +    + A R S  Y    Y+  +M++N   E
Sbjct: 851 AGAIGYEPLDLSHRDKNRMDMICKNINKKHRNAQFAGRASIEY----YVGQVMRNNESVE 906

Query: 904 KTYDV------MITSVPQNGFAGCV 922
             Y +      ++  VP+ G  G +
Sbjct: 907 TGYVIKVLNNGIVVLVPKFGVEGLI 931

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 95/444 (21%), Positives = 177/444 (39%), Gaps = 74/444 (16%)

Query: 520 GDRYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIE 576
            +R D  D  +  ID     +IDD +    H K   +G + + +HIAD      + T ++
Sbjct: 540 ANRKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKQGTALD 595

Query: 577 SQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPK 636
           ++G +         R  + YL D  + MLP  +   +DL          +FSV  ++   
Sbjct: 596 AEGAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDSN 644

Query: 637 STGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLR 696
           +    ++   + +K R+       +   +D ++   +T        + + +L  +S  L+
Sbjct: 645 ADIVKVDFTKSVIKSREAFSYEQAQLRIDDPNQTDDLT--------QGMRALLQLSIKLK 696

Query: 697 ELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVG 756
           + R+  N A+       +  +   T+  GE   V       T S  LV E M+LAN  V 
Sbjct: 697 QKRLD-NGALNLASPEVKVHMDSETSDPGE---VEIKKLLATNS--LVEEFMLLANISVA 750

Query: 757 R-FFAENKISGVFRCYKQLP------LDAIAQQQYNSLIT---------------SAKKG 794
           R  +     + + R +   P      L+ +  ++ N  I+                 K  
Sbjct: 751 RKIYDAFPQTAMLRRHAAPPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCEDPKDP 810

Query: 795 VFPKLEDITKLSSLLNSS-FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQIH 849
            F  L  I     ++ +  FY+G      F+H  +  + Y   TSP+RR+ D++ H Q+ 
Sbjct: 811 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 870

Query: 850 RHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNP--EK 904
             +  +PL  S   + ++D +   I  +    + A R S  Y    Y+  +M++N   E 
Sbjct: 871 GAIGYEPLSLSHRDKNKMDMICRNINKKHRNAQFAGRASIEY----YVGQVMRNNETVET 926

Query: 905 TYDV------MITSVPQNGFAGCV 922
            Y +      ++  VP+ G  G +
Sbjct: 927 GYVIKVFNNGIVVLVPKFGVEGLI 950

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 97/445 (21%), Positives = 177/445 (39%), Gaps = 80/445 (17%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD       +T ++++
Sbjct: 527 RRDLRDKLICSIDPPGCVDIDDAL----HAKRLSNGNWEVGVHIADVTHFVKPNTALDAE 582

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 583 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVERFAFSVIWELDDNAN 631

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++ + + +K R+    ++ +A        L I D    P ++D   L+   + L +L
Sbjct: 632 IVNVDFMKSVIKSREAF--SYEQAQ-------LRIDD----PNQKD--ELTEGMRALLQL 676

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 677 SIKLKQKRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 734

Query: 756 GR-FFAENKISGVFRCYKQLPLD---------------AIAQQQYNSLITSAKKGVFPKL 799
            R  F     + + R +   P                 +I+ +   +L  S  + + P+ 
Sbjct: 735 ARKIFDAFPQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQD 794

Query: 800 EDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 795 PYFNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 854

Query: 849 HRHLQKKPLCF---SQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNP--E 903
              +  +PL      + ++D +   I  +    + A R S  Y    Y+  +M++N   E
Sbjct: 855 AGAIGYEPLDLMHRDKNKMDMICRNINKKHRNAQFAGRASIEY----YVGQVMRNNETVE 910

Query: 904 KTYDV------MITSVPQNGFAGCV 922
             Y +      ++  VP+ G  G +
Sbjct: 911 AGYVIKVLNNGIVVLVPRFGVEGLI 935

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 90/437 (20%), Positives = 169/437 (38%), Gaps = 73/437 (16%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPGTALDAE 586

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G           R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 587 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENAN 635

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++ + + ++ R+       +   +D+++                + L++  + L +L
Sbjct: 636 IVNVDFMKSVIRSREAFSYEQAQLRIDDINQN---------------DELTLGMRALLQL 680

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            +K     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 681 SVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 738

Query: 756 GR-FFAENKISGVFRCYKQLPLD---------------AIAQQQYNSLITSAKKGVFPKL 799
            R  +     + + R +   P                 +I+ +   +L  S  + V P+ 
Sbjct: 739 ARKIYDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPED 798

Query: 800 EDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      FRH  +  + Y   TSP+RR+ D++ H Q+
Sbjct: 799 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

Query: 849 HRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKT 905
              +  +PL  +   + ++D +   I  +    + A R S  Y    Y+  +M++N E T
Sbjct: 859 AGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEY----YVGQVMRNN-EST 913

Query: 906 YDVMITSVPQNGFAGCV 922
               +  V  NG    V
Sbjct: 914 ETGYVIKVFNNGIVVLV 930

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 97/433 (22%), Positives = 170/433 (39%), Gaps = 73/433 (16%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 528 RKDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPGTALDAE 583

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 584 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDENAD 632

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++   + +K R+    ++ +A        L I D+         + L+   + L +L
Sbjct: 633 IVNVDFTKSVIKSREAF--SYEQAQ-------LRIDDASQ------TDDLTQGMRALLQL 677

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELT---EVSFSDQAETPSTVLVSEMMILANTLV 755
            IK     +     N     +  + + E +   EV       T S  LV E M+LAN  V
Sbjct: 678 SIKLKQKRLDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISV 735

Query: 756 GR-FFAENKISGVFRCYKQLP------LDAIAQQQYN---------SLITSAKKGVFPKL 799
            R  +     + + R +   P      L+ +  Q+ N         +L  S  +   PK 
Sbjct: 736 ARKIYDAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMSISLESSKALADSLDRCEDPKD 795

Query: 800 EDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQI 848
                L  ++++        FY+G      F+H  +  + Y   TSP+RRF D++ H Q+
Sbjct: 796 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVVAHRQL 855

Query: 849 HRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKT 905
              +  +PL  S   + ++D +   I  +    + A R S  Y    Y+  +M++N E T
Sbjct: 856 AGAIGYEPLDLSHRDKNKMDMICRNINRKHRNAQFAGRASIEY----YVGQVMRNN-EST 910

Query: 906 YDVMITSVPQNGF 918
               +  V  NG 
Sbjct: 911 ETGYVIKVFNNGI 923

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 91/457 (19%), Positives = 177/457 (38%), Gaps = 104/457 (22%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD       +T ++++
Sbjct: 516 RRDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKANTPLDAE 571

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLP----ESICDLSDLGKQGQKTRTLSFSVDVKVL 634
           G +         R  + YL D  + MLP     ++C L     +       +FSV  ++ 
Sbjct: 572 GAS---------RGTSVYLVDKRIDMLPMLLGTNLCSLKPYVDR------FAFSVLWELD 616

Query: 635 PKSTGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKL 694
             +    ++   + +K R+       +   +D        +S+     + + +L  +S  
Sbjct: 617 ENANIVNVDFTKSVIKSREAFSYEQAQLRIDD--------ESQKDELTQGMRALLQLSIK 668

Query: 695 LRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTL 754
           L++ R+            + G + L + +     +V    +   P  V + +++   N+L
Sbjct: 669 LKQKRL------------DAGALNLASPE----VKVHMDSETSDPGEVEIKKLLA-TNSL 711

Query: 755 VGRFFAENKISGVFRCYKQLPLDAIAQQQ-------YNSL--ITSAKKGVFPKLEDITKL 805
           V  F     IS   R Y+  P  A+ ++        + +L  +   +KG+   LE    L
Sbjct: 712 VEEFMLLANISVARRIYEAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKAL 771

Query: 806 SSLLNSS-------------------------FYTGQ----PFRHEMIGANQYLTVTSPL 836
           ++ L+                           FY G      FRH  +  + Y   TSP+
Sbjct: 772 ANSLDRCVDLEDPYFNTLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPI 831

Query: 837 RRFPDLINHLQIHRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNY 893
           RR+ D++ H Q+   +  +PL  +   + ++D +   I  +    + A R S  Y    Y
Sbjct: 832 RRYCDVVAHRQLAAAIGYEPLDLNHRDKNKMDFMCRNINKKHRNAQFAGRASIEY----Y 887

Query: 894 LKTMMKSNP--EKTYDV------MITSVPQNGFAGCV 922
           +  +M++N   E  Y +      ++  VP+ G  G +
Sbjct: 888 VGQVMRNNESVETGYVIRVFHNGIVVLVPKFGVEGLI 924

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 91/448 (20%), Positives = 176/448 (39%), Gaps = 86/448 (19%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 530 RTDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPGTALDAE 585

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 586 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELNEDAD 634

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++   + ++ R+       +   +D ++   +T          + +L  +SK L++ 
Sbjct: 635 IVNVDFTKSVIRSREAFSYEQAQVRIDDSNQKDELTLG--------MRALLHLSKKLKQK 686

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAET------PSTVLVSEMMILAN 752
           R+            + G + L + +     +   SD  E        +  LV E M+LAN
Sbjct: 687 RL------------DAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLAN 734

Query: 753 TLVGR-FFAENKISGVFRCYKQLP------LDAIAQQQYN---------SLITSAKKGVF 796
             V R  +     + + R +   P      L+ +  Q+ N         +L  S  + + 
Sbjct: 735 ISVARKIYDAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMTISLESSKALADSLDRCID 794

Query: 797 PKLEDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINH 845
           P+      L  ++++        FY+G      F+H  +  + Y   TSP+RR+ D++ H
Sbjct: 795 PQDAYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAH 854

Query: 846 LQIHRHLQKKPLCF---SQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNP 902
            Q+   +  +PL      + ++D +   I  +    + A R S  Y    Y+  +M++N 
Sbjct: 855 RQLAAAIDYEPLSLMHRDKNKMDMVCRNINKKHRNAQFAGRASIEY----YVGQVMRNNE 910

Query: 903 --EKTYDV------MITSVPQNGFAGCV 922
             E  Y +      ++  VP+ G  G +
Sbjct: 911 SVETGYVIKVFNNGIVVLVPKFGVEGLI 938

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 108/495 (21%), Positives = 189/495 (38%), Gaps = 99/495 (20%)

Query: 494 KLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKK- 552
           K G   +   +LT+ E +  +N  +   R DF D  +  ID     +IDD +    H K 
Sbjct: 513 KEGHDWKAPEDLTDPEAI--RNDPLLPSRKDFRDKLICSIDPPGCVDIDDAL----HAKQ 566

Query: 553 --DGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESIC 610
             +G + + +HIAD        T ++++G +         R  + YL D  + MLP  + 
Sbjct: 567 LPNGNWEVGVHIADVTHFVKPGTALDAEGAS---------RGTSVYLVDKRIDMLPMLLG 617

Query: 611 DLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRI 670
             +DL          +FSV  ++   +    + + +    IR     ++ KA  N +D  
Sbjct: 618 --TDLCSLKPYVDRFAFSVVWEL--DNDANIVGVDFTKSVIRSREAFSYEKAQ-NRID-- 670

Query: 671 LSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELT-- 728
               ++        + +L  +SK L++ R+            N     +  + + E +  
Sbjct: 671 ---DETAKDELTLGMRALLQLSKKLKQKRLDAG-------ALNLASPEVKVHMDSETSDP 720

Query: 729 -EVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQYNSL 787
            EV      +T S  LV E M+LAN  V R           + Y+  P  A+ ++     
Sbjct: 721 NEVEIKKLLDTNS--LVEEFMLLANISVAR-----------KIYEAFPQTAMLRRHAAPP 767

Query: 788 ITS---------AKKGVFPKLEDITKLSSLLNSS-------------------------F 813
            T+          +KG+   LE    L+  L+                           F
Sbjct: 768 STNFELLNEMLQVRKGMSISLESSKALADSLDRCEDPNDSYLNTLIRIMSTRCMMAAQYF 827

Query: 814 YTGQ----PFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFS---QAQIDR 866
           + G      FRH  +  + Y   TSP+RR+ D++ H Q+   +  + L  S   + +++ 
Sbjct: 828 HAGAFSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEALDLSHRDKQKMEM 887

Query: 867 LIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDL 926
           +   I  +    + A R S  Y    Y+  +M++N E T    +  V  NG A  V P  
Sbjct: 888 ICRNINKKHRNAQFAGRASIEY----YVGQVMRNN-ESTETGYVIKVFNNGIAVLV-PKF 941

Query: 927 SFARGTLKLNPSTEH 941
               G ++L   TE+
Sbjct: 942 G-VEGLIRLENLTEN 955

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 99/435 (22%), Positives = 175/435 (40%), Gaps = 69/435 (15%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD       +T ++++
Sbjct: 519 RRDMRDKLICSIDPPGCVDIDDAL----HAKKLINGNWEVGVHIADVTHFVKPNTALDAE 574

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R+ + YL D  + MLP  +   +DL          +FSV  ++   + 
Sbjct: 575 GAS---------RATSVYLVDKRIDMLPMLLG--TDLCSLKASVDRFAFSVIWELDNDAN 623

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              +E   + ++ R+    ++ +A        L I D    P + D  +L M  + L +L
Sbjct: 624 IVSVEFTKSVIRSREAF--SYEQAQ-------LRIDD----PNQNDELTLGM--RALLQL 668

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPST-VLVSEMMILANTLVGR 757
             K     +     N     +  + + E ++ S  +  +  ST  LV E M+LAN  V R
Sbjct: 669 SKKLKQKRLDAGALNLASPEVKVHMDSETSDPSEVEIKKLLSTNSLVEEFMLLANISVAR 728

Query: 758 -FFAENKISGVFRCYKQLP------LDAIAQQQYN---------SLITSAKKGV------ 795
             +     + + R +   P      L+ + Q + N         +L  S  + V      
Sbjct: 729 KIYDSFPQTAMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVY 788

Query: 796 FPKLEDITKLSSLLNSS-FYTG----QPFRHEMIGANQYLTVTSPLRRFPDLINHLQIHR 850
           F  L  I     ++ +  FY+G      FRH  +  + Y   TSP+RR+ D+I H Q+  
Sbjct: 789 FNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQLAA 848

Query: 851 HLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKTYD 907
            +  + L  S   + +++ +   I  R    + A R S  Y    ++  +M++N E    
Sbjct: 849 AIGYESLDLSHRDKQKMEIICRNINKRHRNAQFAGRASIEY----HVGQVMRNN-ESIET 903

Query: 908 VMITSVPQNGFAGCV 922
             +  V  NG A  V
Sbjct: 904 GYVIKVFNNGIAVLV 918

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 91/453 (20%), Positives = 178/453 (39%), Gaps = 96/453 (21%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD        T ++++
Sbjct: 518 RRDLRDKLICSIDPPGCVDIDDAL----HAKQLPNGNWEVGVHIADVTHFVKAGTPLDAE 573

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKST 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++  K++
Sbjct: 574 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDQKAS 622

Query: 639 GKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLREL 698
              ++   + ++ R+    ++ +A        L I D    P ++D  +  M + L   +
Sbjct: 623 IVNVDFTKSVIRSREAF--SYEQAQ-------LRIDD----PNQKDELTQGMRALLNLSV 669

Query: 699 RIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRF 758
           ++K+          + G + L + +     +V    +   P  V + +++   N+LV  F
Sbjct: 670 KLKQKR-------LDAGALNLASPE----VKVHMDSETSDPGDVEIKKLLA-TNSLVEEF 717

Query: 759 FAENKISGVFRCYKQLPLDA---------------------------IAQQQYNSLITSA 791
                IS   + Y+  P  A                           I+ +   +L  S 
Sbjct: 718 MLLANISVAKKIYEAFPQTAMLRRHAAPPSTNFETLNEMLQLRKSMSISLESSKALADSL 777

Query: 792 KKGVFPKLEDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFP 840
            + + P+      L  ++++        FY+G      FRH  +  + Y   TSP+RR+ 
Sbjct: 778 DRCIDPQDPYFNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYC 837

Query: 841 DLINHLQIHRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTM 897
           D++ H Q+   +  +PL  +   + +++ +   I  R    + A R S  Y    Y+  +
Sbjct: 838 DVVAHRQLAGAIGYEPLDLTHRDKNKMEMICKNINKRHRNAQFAGRASIEY----YVGQV 893

Query: 898 MKSNP--EKTYDV------MITSVPQNGFAGCV 922
           M++N   E  Y +      ++  VP+ G  G +
Sbjct: 894 MRNNESVETGYVIRVFNNGIVVLVPKFGVEGLI 926

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 96/453 (21%), Positives = 180/453 (39%), Gaps = 96/453 (21%)

Query: 522 RYDFGDLKVFCIDSETAHEIDDGVSIENHKK---DGLYTLHIHIADPASLFPESTDIESQ 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD       +T ++++
Sbjct: 516 RRDLRDKLICSIDPPGCVDIDDAL----HAKQLPNGNWEVGVHIADVTHFVKPNTPLDAE 571

Query: 579 GITTDVLNVALKRSFTTYLPDLVVPMLP----ESICDLSDLGKQGQKTRTLSFSVDVKVL 634
           G +         R  + YL D  + MLP     ++C L     +       +FSV  ++ 
Sbjct: 572 GAS---------RGTSVYLVDKRIDMLPMLLGTNLCSLKPYVDR------FAFSVLWELD 616

Query: 635 PKSTGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDS-EAPPFKEDLESLSMISK 693
             +    ++   + +K R+    ++ +A        L I DS +     + + +L  +S 
Sbjct: 617 QDANIVNVDFTKSVIKSREAF--SYEQAQ-------LRIDDSTQTDELTQGMRALLSLSI 667

Query: 694 LLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAET------PSTVLVSEM 747
            L+E R+            N G + L + +     +   SD  E        +  LV E 
Sbjct: 668 KLKEKRL------------NAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEF 715

Query: 748 MILANTLVGRFFAEN-KISGVFRCYKQLPLD---------------AIAQQQYNSLITSA 791
           M+LAN  V R   E    + + R +   P                 +I+ +   +L  S 
Sbjct: 716 MLLANISVARKIYEAFPQTAMLRRHAAPPATNFEALNEMLQLRKGMSISLESSKALADSL 775

Query: 792 KKGVFPKLEDITKLSSLLNSS-------FYTGQ----PFRHEMIGANQYLTVTSPLRRFP 840
            + V PK      L  ++++        FY+G      FRH  +  + Y   TSP+RR+ 
Sbjct: 776 DRCVDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYC 835

Query: 841 DLINHLQIHRHLQKKPLCFS---QAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTM 897
           D++ H Q+   +  + L  +   + +++ +   I  +    + A R S  Y    Y+  +
Sbjct: 836 DVVAHRQLAAAIGYEALDLNHRDKNKMEFMCRNINKKHRNAQFAGRASIEY----YVGQV 891

Query: 898 MKSN-PEKT-------YDVMITSVPQNGFAGCV 922
           M++N  E+T       ++ ++  VP+ G  G +
Sbjct: 892 MRNNESEETGYVIRVFHNGIVVLVPKFGVEGLI 924

>Kpol_513.28 s513 complement(84409..86838) [2430 bp, 809 aa] {ON}
           complement(84409..86838) [2430 nt, 810 aa]
          Length = 809

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 54/124 (43%), Gaps = 28/124 (22%)

Query: 581 TTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGK 640
           TTD+ ++A   S T + P L +         L   GK+    + L+ S+D   L ++T  
Sbjct: 238 TTDLSSIATTSSETGFFPALSIV--------LDSRGKKNIDQQALAQSMDD--LLQTTKT 287

Query: 641 PIEIIYNSLK---IRKGIVSNFP-------KATYNDVDRILSITD--------SEAPPFK 682
           P E I   L    IR    +N         KATYNDV  +LSI D        SE  PF 
Sbjct: 288 PYEKIIAYLTLIPIRLDSSTNLSYQPIDQWKATYNDVSSLLSILDENINTYQVSELAPFN 347

Query: 683 EDLE 686
           + LE
Sbjct: 348 DSLE 351

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 30/173 (17%)

Query: 599 DLVVPMLP------ESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGK--PIEIIYNSLK 650
           D + P LP      +++  LSDL +  Q  RT       + LP    K  P+E +     
Sbjct: 85  DGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTL----RQFLPYDASKHTPLESLLEL-- 138

Query: 651 IRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNN------ 704
           +R+  V + P     +  +I   TD+++PP   D+++ S +  L+ +L  +  N      
Sbjct: 139 VREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTTFFI 198

Query: 705 ---AVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTL 754
               + F EGF   ++ L    +        SD+ + P+T  +S   I +  L
Sbjct: 199 GKPGLPFDEGFYSDILRLGATTKA-------SDEFDGPNTTPISAAYIKSRVL 244

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
           Anc_5.307 YDR293C
          Length = 1260

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 553 DGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDL 612
           DG + L  H+ D  +   E++ ++ +         A KRS   ++P  VV +LP+++ + 
Sbjct: 734 DGTFELGCHVVDATAHIEENSSLDRR---------ARKRSSGVFMPQKVVNLLPKALNES 784

Query: 613 SDLGKQGQKTRTLS--FSVDVKVLPKSTGKPIE--IIYNSLKIRKGIVSNFPKATYNDVD 668
             L K+ +K+ TLS  ++++ + L   +    E  I+ +     K I  N      +DVD
Sbjct: 785 LSL-KKDKKSATLSVIYTLNAETLEIRSTTVCESIILPSRFMTAKEIDDNL---ASDDVD 840

Query: 669 RILSITDSEAPPF 681
             LSI +  A  F
Sbjct: 841 PYLSIVEKIATSF 853

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 56/140 (40%), Gaps = 19/140 (13%)

Query: 755 VGRFFAENKISGVFRCYK--------QLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLS 806
           VG  F  N  +G+  C+K        +L   ++  + ++ ++T  +    PKLE    L 
Sbjct: 81  VGHVFGINSSNGLLFCFKCGDYIGSNELIAASMLNKYWDDVVTKTQ---IPKLERRDGLQ 137

Query: 807 SLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDR 866
            LLN        F   ++   Q L       +F   IN L   R   + PL      +DR
Sbjct: 138 GLLNMG---STCFMSSIV---QCLIHNPYFFQFS--INQLHSQRCPLQDPLSCISCALDR 189

Query: 867 LIWPIQSRADILKTASRNSS 886
           ++W      +++K    +S+
Sbjct: 190 MVWEFYGHPELIKNGEDDSN 209

>Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON}
           YJL186W (REAL)
          Length = 586

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 558 LHIHIADPASLFPESTDIESQG-----ITTDVLNVALKRSFTTYLPDLVVPMLPESICDL 612
           L+  I    +LFPES  I + G     +    +   L+ + TT   ++++P   E   D 
Sbjct: 135 LNYSIPQREALFPESEGIVTIGGGKYSVLAHTMIKKLRETGTTLPIEVIIPPQDEGDDDF 194

Query: 613 SDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATYNDVD 668
                  Q  + L FS    ++P    + +E+ +  LK+   I+SNF +  + D D
Sbjct: 195 CKNWLPRQNGKCLYFS---DIVPSKPLRDLELTHFQLKVFGLIISNFKRIIFIDAD 247

>KLTH0A01958g Chr1 (172931..174997) [2067 bp, 688 aa] {ON} similar
           to uniprot|P04397 Saccharomyces cerevisiae YBR019C GAL10
           UDP-glucose-4-epimerase catalyzes the interconversion of
           UDP-galactose and UDP-D-glucose in galactose metabolism
           also catalyzes the conversion of alpha-D-glucose or
           alpha-D-galactose to their beta- anomers
          Length = 688

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 655 IVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRI 700
           +V NF  + Y  + R+  + ++E P FK DL     + K+ R+ +I
Sbjct: 38  VVDNFSNSCYEPIARLKVLLETEIPFFKVDLTDADGLEKVFRKFKI 83

>Kpol_380.12 s380 complement(19992..20789) [798 bp, 265 aa] {ON}
           complement(19992..20789) [798 nt, 266 aa]
          Length = 265

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 664 YNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEG 711
           +NDV+R+ +I ++       D+  +  I +LL EL+I+ N     G+G
Sbjct: 69  FNDVERLFAIGENTVVGVSGDISDMQYIERLLDELQIENNYDNSTGDG 116

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 100/240 (41%), Gaps = 33/240 (13%)

Query: 300 TLVGLVQKLDLNKALDN---KNGVNYLADL-VNSYKSADSVPMNSATFVSTYWAIVQQQE 355
           TL+ L    D N    N   KN    L DL ++  KS   +P+           I QQ  
Sbjct: 41  TLIVLDTGADTNFTYSNLWSKNDSITLQDLHISKEKSRSCIPLTVTPAFGVSLVINQQ-- 98

Query: 356 SNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQ-VIEKLE------------ADNYKDID 402
             ++ +I + TA +      +IP K  H+   + +++KL             AD   D+ 
Sbjct: 99  --VFLRIRIGTATIC-DWFYLIPQKRSHIILGKPLLKKLHYQLSPSCESLTIADTTIDVT 155

Query: 403 RF---------VKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIE 453
           RF         +++      + + + +P+V     +F+    H+    V LI+  +   +
Sbjct: 156 RFPGISATSTLLQISKTPFLKSLKTKFPTVFS--SNFSLDLHHDFLAHVNLINFPYTTPK 213

Query: 454 LYKGSDITRDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQR 513
            Y  S + R+  +  VN+ L N +I PL  +  +A+     L QS +K+  +T++  + +
Sbjct: 214 AYFTSGLRREAIKKYVNQSLENGLIEPLSPDELVAVSPVFALPQSSEKIRIITDLRKVNK 273

>CAGL0M00462g Chr13 (57126..58961) [1836 bp, 611 aa] {ON} similar to
           uniprot|P47166 Saccharomyces cerevisiae YJR134c SGM1
          Length = 611

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 80  RIKGLEPDIE-LKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPKIPSYKLINLDI 138
           ++  LE D++ LK  Y + E  Y   R +Y   SES  +NS RS+ +    S+       
Sbjct: 351 KVATLERDLQNLKDDYNLLESKYNTQRSQYRKSSESRLNNSSRSINEEVSESWN------ 404

Query: 139 HFDTKLESSKQMEFQPA--QLMKNPLNVGDLV 168
            F + L S K  E   A   LM    N+GDL 
Sbjct: 405 DFGSGLNSLKITESNGALDTLMGQSSNIGDLT 436

>Kpol_1004.68 s1004 complement(143077..144804,144807..146831) [3753
           bp, 1250 aa] {ON}
           complement(143077..144804,144807..146831) [3753 nt, 1251
           aa]
          Length = 1250

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 552 KDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESI 609
           KDG      HI D  +   E + ++ +         A KRS   +LP  VV +LPE+I
Sbjct: 721 KDGTIEFACHIVDVTAHIEEGSSLDRR---------ARKRSTAVFLPQRVVNLLPEAI 769

>Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {ON}
           YDR293C (REAL)
          Length = 1258

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 12/84 (14%)

Query: 553 DGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDL 612
           DG   L  H+ D  S   E + ++ +         A KRS   ++P  +V +LP+S  D 
Sbjct: 729 DGTLELGCHVVDVTSHIEEGSSVDRR---------ARKRSSAVFMPQKLVSLLPQSFNDT 779

Query: 613 SDLGKQGQKTRTLS--FSVDVKVL 634
             L   G+++ T+S  +++D   L
Sbjct: 780 LSLAP-GKESPTISVVYTLDSSTL 802

>Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {ON}
           YDR293C (REAL)
          Length = 1252

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 12/84 (14%)

Query: 553 DGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDL 612
           DG   L  HI D  S   E + ++ +         A KRS   ++P  +V +LP+S  D 
Sbjct: 723 DGTLELGCHIVDVTSHIEEGSSVDRR---------ARKRSSAVFMPQKLVNLLPQSFNDE 773

Query: 613 SDLGKQGQKTRTLS--FSVDVKVL 634
             L   G+++ T+S  +++D   L
Sbjct: 774 LSLAP-GKESATISVVYTLDSSTL 796

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,857,795
Number of extensions: 4850301
Number of successful extensions: 16382
Number of sequences better than 10.0: 86
Number of HSP's gapped: 16725
Number of HSP's successfully gapped: 87
Length of query: 969
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 850
Effective length of database: 39,836,145
Effective search space: 33860723250
Effective search space used: 33860723250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)