Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4758.850ON51551525450.0
Smik_13.5018.850ON51551522680.0
YMR285C (NGL2)8.850ON51551522650.0
Skud_13.4588.850ON51451521570.0
CAGL0I02684g8.850ON49345718220.0
Kpol_237.18.850ON50346018140.0
TBLA0B029008.850ON52046117980.0
NCAS0C003108.850ON55645818000.0
TDEL0B001908.850ON49245917830.0
ZYRO0C14872g8.850ON49646017690.0
NDAI0K003708.850ON56846017650.0
KAFR0L019608.850ON51146117520.0
SAKL0D01166g8.850ON50546117490.0
KLTH0C03608g8.850ON49546316960.0
TPHA0I003208.850ON52944216540.0
KNAG0K006508.850ON48246615850.0
Kwal_27.102048.850ON49445915810.0
KLLA0C06248g8.850ON51646315660.0
ABL118W8.850ON50446014350.0
Ecym_46198.850ON48742613900.0
NDAI0E002608.850ON49847712681e-171
NCAS0B002708.850ON47646412091e-162
TBLA0D033008.850ON48046111681e-156
Suva_13.258.850ON50246910041e-131
KAFR0A028608.850ON4784809841e-128
Skud_13.238.850ON4984729861e-128
YML118W (NGL3)8.850ON5054759731e-126
CAGL0B02387g8.850ON4714709651e-125
Smik_13.168.850ON5024759661e-125
KNAG0G034708.850ON4664819011e-116
Suva_1.457.78ON8312261832e-13
Skud_1.407.78ON8692261813e-13
KLLA0F15884g7.78ON7902291803e-13
KNAG0D048407.78ON7792641795e-13
ACR288W7.78ON7362391751e-12
SAKL0B10032g7.78ON7312271751e-12
KLTH0D02310g7.78ON7392381733e-12
Kwal_26.71127.78ON7422191733e-12
CAGL0H06149g7.78ON8732271723e-12
Ecym_73547.78ON7852281724e-12
NDAI0H025207.78ON8982251699e-12
YAL021C (CCR4)7.78ON8372261681e-11
KAFR0K006707.78ON7952181653e-11
ZYRO0D05302g7.78ON8572171643e-11
Smik_1.457.78ON8392261634e-11
TDEL0H037307.78ON7972731634e-11
NCAS0F016407.78ON8552701573e-10
KLLA0F07733g7.90ON3712441525e-10
Kpol_1040.147.78ON7842271545e-10
TBLA0A046607.78ON8962591511e-09
TPHA0H026807.78ON8722541456e-09
ACR277C7.90ON3782371428e-09
KAFR0D012507.90ON3562371293e-07
KNAG0L005507.90ON3812411284e-07
Kpol_1044.67.90ON3722411276e-07
Kwal_26.71707.90ON3722451267e-07
KLTH0D02574g7.90ON3682441267e-07
SAKL0B09768g7.90ON3682451251e-06
TBLA0E022607.90ON3882591251e-06
TDEL0H036007.90ON3662481161e-05
CAGL0F01001g7.90ON3592381107e-05
ZYRO0D05588g7.90ON3562441072e-04
TPHA0L005307.90ON3912431072e-04
NDAI0A085307.90ON3652371027e-04
Skud_15.1157.90ON363237980.002
NCAS0I005007.90ON389237970.003
Smik_15.1257.90ON363216960.003
YOL042W (NGL1)7.90ON36369910.015
Ecym_26367.90ON367212870.044
Suva_15.1277.90ON36364860.056
SAKL0H06578g8.675ON459106751.3
Kpol_1072.38.700ON34255705.0
TDEL0A062108.675ON45363705.8
Smik_2.783.325ON1025110697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.475
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   984   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   878   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   877   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   835   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   706   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   703   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   697   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      697   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   691   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   686   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   684   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   679   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   678   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   657   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   641   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   615   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   613   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   607   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   557   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   540   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   493   e-171
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      470   e-162
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   454   e-156
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   391   e-131
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   383   e-128
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   384   e-128
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   379   e-126
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   376   e-125
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   376   e-125
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   351   e-116
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    75   2e-13
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    74   3e-13
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    74   3e-13
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    74   5e-13
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    72   1e-12
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    72   1e-12
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    71   3e-12
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    71   3e-12
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    71   3e-12
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    71   4e-12
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      70   9e-12
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    69   1e-11
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    68   3e-11
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    68   3e-11
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    67   4e-11
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    67   4e-11
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      65   3e-10
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    63   5e-10
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    64   5e-10
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    63   1e-09
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    60   6e-09
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    59   8e-09
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    54   3e-07
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    54   4e-07
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    54   6e-07
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    53   7e-07
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    53   7e-07
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    53   1e-06
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    53   1e-06
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    49   1e-05
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    47   7e-05
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    46   2e-04
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    46   2e-04
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    44   7e-04
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    42   0.002
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    42   0.003
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    42   0.003
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    40   0.015
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    38   0.044
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    38   0.056
SAKL0H06578g Chr8 (580650..582029) [1380 bp, 459 aa] {ON} simila...    33   1.3  
Kpol_1072.3 s1072 complement(6129..7157) [1029 bp, 342 aa] {ON} ...    32   5.0  
TDEL0A06210 Chr1 complement(1086334..1087695) [1362 bp, 453 aa] ...    32   5.8  
Smik_2.78 Chr2 (140971..144048) [3078 bp, 1025 aa] {ON} YBL037W ...    31   7.9  

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/515 (92%), Positives = 474/515 (92%)

Query: 1   MTQDKQVKIXXXXXXXXXXXXTDKPVKDLKQQVGDXXXXXXXXXXXXXXXXXPVVTPEHI 60
           MTQDKQVKI            TDKPVKDLKQQVGD                 PVVTPEHI
Sbjct: 1   MTQDKQVKISAPDASSASEAETDKPVKDLKQQVGDNSKNQTKKKGNKGKKSKPVVTPEHI 60

Query: 61  AKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCL 120
           AKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCL
Sbjct: 61  AKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCL 120

Query: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLG 180
           AQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLG
Sbjct: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLG 180

Query: 181 YEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFS 240
           YEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFS
Sbjct: 181 YEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFS 240

Query: 241 EKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNEND 300
           EKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNEND
Sbjct: 241 EKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNEND 300

Query: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXXXXXX 360
           GDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR       
Sbjct: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDGEEGAD 360

Query: 361 XXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHP 420
                NIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHP
Sbjct: 361 EEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHP 420

Query: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGF 480
           ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGF
Sbjct: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGF 480

Query: 481 LRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           LRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL
Sbjct: 481 LRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/515 (80%), Positives = 455/515 (88%)

Query: 1   MTQDKQVKIXXXXXXXXXXXXTDKPVKDLKQQVGDXXXXXXXXXXXXXXXXXPVVTPEHI 60
           MTQ+K++K+             +KPVKD++   GD                 P+VTPEHI
Sbjct: 1   MTQEKEIKVATPDVPSTSNMQNNKPVKDIRHPTGDGSIPQTKKKGKKGKKSKPIVTPEHI 60

Query: 61  AKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCL 120
           AK+RAERDA+RKAKRD+MLAQG+DPDCPPELHFIKRPFL LHE+EPVTGFRFKLMTYNCL
Sbjct: 61  AKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMTYNCL 120

Query: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLG 180
           AQALIRRKLFPDSGDALKWYRRSRVLLNEF++Y ADVICLQEIDHIQFQSFWK+EF+KLG
Sbjct: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLG 180

Query: 181 YEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFS 240
           Y+GQY+RNSTKNHGVAI+WRR+MFQQVDKMLID+DKE S NI TRTTTNNVGLVLALKFS
Sbjct: 181 YDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALKFS 240

Query: 241 EKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNEND 300
           EKVLSNL K+SSKK GILIGT+HLFWHPFGTYERTRQCY+VLKKM+EFMHRVNVLQNEND
Sbjct: 241 EKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNEND 300

Query: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXXXXXX 360
           GDLSHWFPFFCGDFNSQPFDTPYLSMT KPVHY+ RAKTVIECSTSFKFSK R       
Sbjct: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDGDESAD 360

Query: 361 XXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHP 420
                NIEK+GKDQPESPVP+++HANEEQIELVD+MAQLHNSLDMRA+SLYSV Y+NVHP
Sbjct: 361 DEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHP 420

Query: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGF 480
           ENAGLDNDRGEPEISNWANTWRGLLDYLFY+KKWDLRSNCQEV++L DFEK NE+K RGF
Sbjct: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGF 480

Query: 481 LRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           LRMPPG EMTKHGQPHVGEYASDHLSMVCD+EL+L
Sbjct: 481 LRMPPGKEMTKHGQPHVGEYASDHLSMVCDLELEL 515

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/515 (80%), Positives = 450/515 (87%)

Query: 1   MTQDKQVKIXXXXXXXXXXXXTDKPVKDLKQQVGDXXXXXXXXXXXXXXXXXPVVTPEHI 60
           MTQDK+VK+             +K VKD K Q  D                 P+VTPEHI
Sbjct: 1   MTQDKEVKVVAPDVAPDQEVEINKSVKDAKHQTNDDSLLQHKKKGKKGKKSKPIVTPEHI 60

Query: 61  AKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCL 120
           AKVRAER+ +RKAKRD+MLAQG+DPDCPPELHFI+RPFLSLHE EPVTGFRFKLMTYNCL
Sbjct: 61  AKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTYNCL 120

Query: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLG 180
           AQALIRRKLFPDSGDALKWYRRS+VLLNEF++YN+DVICLQEIDHIQFQSFWK+EFSKLG
Sbjct: 121 AQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLG 180

Query: 181 YEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFS 240
           Y+GQY+RN+TKNHGVAI+WRR++F QVDKMLID+DKE S +I TRTTTNNVGLVLALKFS
Sbjct: 181 YDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFS 240

Query: 241 EKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNEND 300
           EKVLSNLGK SSKK GILIGT+HLFWHPFGTYERTRQCYIVLKKM+EFMHRVNVLQNEND
Sbjct: 241 EKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNEND 300

Query: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXXXXXX 360
           GDLSHWFPFFCGDFNSQPFDTPYLSMT KPVHY  RAKTVI CSTS+KFSKVR       
Sbjct: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEEGAD 360

Query: 361 XXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHP 420
                NIEK+GKDQPESPVP+ FHANEEQ ELVD+MAQLHNSLDMRA+SLYSV YKNVHP
Sbjct: 361 DEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHP 420

Query: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGF 480
           ENAGLDNDRGEPEISNWANTWRGLLDYLFY+KKWD +SNCQEV++L DFEK+N++K RGF
Sbjct: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGF 480

Query: 481 LRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           LRMPPG+EMTKHGQPHVGEYASDHLSMVCD+ELQL
Sbjct: 481 LRMPPGNEMTKHGQPHVGEYASDHLSMVCDLELQL 515

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/515 (78%), Positives = 447/515 (86%), Gaps = 1/515 (0%)

Query: 1   MTQDKQVKIXXXXXXXXXXXXTDKPVKDLKQQVGDXXXXXXXXXXXXXXXXXPVVTPEHI 60
           MT+DK+V++              + V ++KQQ GD                 P+VTPEHI
Sbjct: 1   MTKDKKVEVTAPNAAFSPEIENIESV-NIKQQTGDDSVVQAKRKAKKGKKSKPIVTPEHI 59

Query: 61  AKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCL 120
           AKVRAER+A+RKAKRD+MLA G+DPDCPPELHFI+RP LSL E EPVTGFRFKLMTYNCL
Sbjct: 60  AKVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCL 119

Query: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLG 180
           AQALIRRKLFPDSGDALKW+RRS+VLLNEF++YNADVICLQE+DHIQFQSFWK +F+K+G
Sbjct: 120 AQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMG 179

Query: 181 YEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFS 240
           Y+GQYHRN TKNHGVAIIWRR MFQ+VDKMLID+DKE SG+I TRTTTNNVGLVLALKFS
Sbjct: 180 YDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFS 239

Query: 241 EKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNEND 300
           ++VLS LGK SSKK GILIGT+HLFWHPFGTYERTRQCY+VL+KM+EFMHRVNVLQN+ND
Sbjct: 240 KEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDND 299

Query: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXXXXXX 360
           GDLSHWFPFFCGDFNSQPFDTPYLSMT KPVHY+ RAKTVIECSTSFKFSKVR       
Sbjct: 300 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRDGEEGAD 359

Query: 361 XXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHP 420
                NIEKFGKDQPESPVP++FHAN+EQIE+VD+M QLHNSLDMRA+SLYSV YK+VHP
Sbjct: 360 DEEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHP 419

Query: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGF 480
           ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDL+SN QEV++L DFEK NEIK RGF
Sbjct: 420 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGF 479

Query: 481 LRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           LRMPP SEMTKHGQPHVGEY SDHLSMVCD+ELQL
Sbjct: 480 LRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/457 (70%), Positives = 380/457 (83%), Gaps = 1/457 (0%)

Query: 58  EHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTY 117
           E IA++RAER+A+R+AKR  ML +G+DPDCPPEL FI+R  L LHEEEPV G + K+M+Y
Sbjct: 38  EEIARIRAEREAMREAKRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSY 97

Query: 118 NCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFS 177
           NCLAQALIRRKLFPDSG+ALKWYRRSRVLLNEF+HY+ DV+CLQEID+IQ+QSFWKEEF 
Sbjct: 98  NCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQ 157

Query: 178 KLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLAL 237
           KLGY  Q+HR  +KNHGV IIW+ + F+  D+MLIDFD E SG+I  RTTTNN  L+LAL
Sbjct: 158 KLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILAL 217

Query: 238 KFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQN 297
           KF++KV     K    KSGIL+GT+HLFWHPFGTYERTRQCY+VL KM+EFMHRVNVLQN
Sbjct: 218 KFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQN 277

Query: 298 ENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXXX 357
            NDGD+SHW+PFFCGDFNSQPFD+PYLSMTCKP+ Y+ RAKTVIECSTSFKFSK R    
Sbjct: 278 NNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGE 337

Query: 358 XXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKN 417
                   NIEKFGKDQP++PVP+ F AN+EQ +LV +M +LHNSLDMRAVSLYSVAY  
Sbjct: 338 DAEDEEGGNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHK 397

Query: 418 VHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKF 477
           VHPEN+GLDN+RGEPEISNWA+TWRGLLDY+F I+ W+   +  E+D+L+DFE  N IK 
Sbjct: 398 VHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEF-DDRTEIDTLEDFENSNNIKI 456

Query: 478 RGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQ 514
           RG LRMPPGSEM+ HGQPHVGEY SDHL ++ ++EL+
Sbjct: 457 RGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVELR 493

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/460 (70%), Positives = 383/460 (83%), Gaps = 2/460 (0%)

Query: 56  TPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLM 115
           +PE I + RAER A ++ KR  +LA+G+DPD PPEL FIKRP L LH++EPVTGF F LM
Sbjct: 46  SPEEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLM 105

Query: 116 TYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEE 175
           TYNCLAQALIRRKLFPDSG+A+KW+RRS+VLL EF+HYN+DVICLQEIDHIQ+Q+FWK E
Sbjct: 106 TYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVE 165

Query: 176 FSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVL 235
           F KLGYE Q+HR ++KNHGVAI+W+R+MF+  D+MLIDFDKE S +IP RT TNN GL+L
Sbjct: 166 FEKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLIL 225

Query: 236 ALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVL 295
           +LKFS+K+LS L K ++K +GI+IGT+HLFWHPFGTYERTRQCY++L KM+EFMHRVNVL
Sbjct: 226 SLKFSDKILSTLPK-NTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVL 284

Query: 296 QNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXX 355
           QN NDGDLSHW PFFCGDFNSQPFD+PYLSMT KP+ Y +RAKTVI+CSTS+KFSK+R  
Sbjct: 285 QNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNG 344

Query: 356 XXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAY 415
                     NIEKFGKDQP++PVP+ F ANEEQ  LV+ MA +HN L MRA SLYSV Y
Sbjct: 345 EEDVDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGY 404

Query: 416 KNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEI 475
           K+VH ENAG+DN RGEP ISNWANTWRGLLDY+F++  WD   N Q VDSL+ FE +N I
Sbjct: 405 KHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDF-DNRQAVDSLEKFEIENSI 463

Query: 476 KFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           + RGFLRMP  SEM KHGQPH GEYASDHLSM+C+IEL L
Sbjct: 464 RLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIELLL 503

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/461 (68%), Positives = 384/461 (83%), Gaps = 3/461 (0%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKL 114
           ++PEHIA+VRA+R+A RKAKRD++LAQGIDPDCP EL FIKRP L +HE EPV GF+F L
Sbjct: 63  ISPEHIAQVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122

Query: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKE 174
           MTYNCLAQALIRRKLFP+ GDALKW+RRS+VLLNEF+HYN D+ICLQEIDH+Q+QSFWKE
Sbjct: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182

Query: 175 EFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLV 234
           EFSKLGYE Q+++  +KNHGV+++W++++F+  D+ML+D+DKE+SG+I  RTTTNN+ L+
Sbjct: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242

Query: 235 LALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNV 294
           L+LKFS+KV     K +  K+GILIGT+HLFWHPFGTYERTRQCYI+L KM+EF+ RVN+
Sbjct: 243 LSLKFSKKVTERFPK-NINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301

Query: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRX 354
           LQN  D D SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y  R+KTVIECSTSFKFSK R 
Sbjct: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360

Query: 355 XXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVA 414
                      NIEKFGKDQP+ PVP D+ AN+EQ  LV +M +LHNSLDMRA+SLYS  
Sbjct: 361 DGEEGDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420

Query: 415 YKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNE 474
           Y  VHPEN+G+DN+R EPEISNWA+ WRGLLDYLFYIK WD   N +E+DSL+DFE++N+
Sbjct: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPN-KEIDSLEDFEREND 479

Query: 475 IKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           IK RG+LRMPP  E+  HGQP  GEY SDHL M+C++EL L
Sbjct: 480 IKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/458 (70%), Positives = 376/458 (82%), Gaps = 8/458 (1%)

Query: 58  EHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTY 117
           E IAK+RAER    +AK+++ LAQG+DP+  P+L FI+RP L LHEEEPVTGF+  +MTY
Sbjct: 104 EEIAKIRAER----QAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159

Query: 118 NCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFS 177
           NCLAQALIRRKLFPDSGDALKW++RS+VL NEF+HYN DVICLQEIDH+Q+QSFWK EF 
Sbjct: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219

Query: 178 KLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLAL 237
           K+GYE Q+HR  +KNHGVAIIWR+++F   DKMLIDFDKE SG IP RTTTNN GL L+L
Sbjct: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279

Query: 238 KFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQN 297
           KF+EK LS     +S+  GI++GT+HLFWHPFGTYERTRQCY+VL KM+EFMHR+NVLQN
Sbjct: 280 KFTEKALSKFSNGTSR-MGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQN 338

Query: 298 ENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXXX 357
            NDGD SHW+PFFCGDFNSQPFDTPYLSMT KP+HY+ RAKTVIECSTS+KFSK R    
Sbjct: 339 NNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEE 398

Query: 358 XXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKN 417
                   NIEKFGKDQP++PVP  F ANEEQ +LV  M  LHNSLDMRA+SLY V Y+ 
Sbjct: 399 DADEEEGGNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRK 458

Query: 418 VHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKF 477
           VHPENAGLDND GEPEISNWA+TW GLLDY+ +IK W    +CQ VD+L+ FEK+N IK 
Sbjct: 459 VHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGF-DDCQHVDTLEKFEKENSIKV 517

Query: 478 RGFLRMPPGSEMTK--HGQPHVGEYASDHLSMVCDIEL 513
           RG+LRMPP +EM+K  HGQPH GEY SDHLSM+C++EL
Sbjct: 518 RGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/459 (68%), Positives = 379/459 (82%), Gaps = 3/459 (0%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKL 114
           ++PEH+AKVRAER+A RKAKR+ MLA+G+DPD PPEL FIKRP L+LHE+EP+ G  FKL
Sbjct: 35  MSPEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKL 94

Query: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKE 174
           +TYNCLAQALIRRKLFPDSGD+LKW+RRS+VL  EF+HYNADV+CLQEID+IQ+Q FWK+
Sbjct: 95  LTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKD 154

Query: 175 EFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLV 234
           E  KLGY+ Q+++   KNHGV+I W+R +FQ  D+MLID+DKE SG I  RT T+N GL+
Sbjct: 155 ELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLI 214

Query: 235 LALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNV 294
           LALKF++    +      +KSGIL+GTSHLFWHPFGTYERTRQCY+VLKKM+EFM RVNV
Sbjct: 215 LALKFTDAAKQSCPHI--RKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNV 272

Query: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRX 354
           LQN NDG+LSHW PFFCGDFNSQPFDTPYLSMT KPV Y  RAKTV+ECSTS+ FSK+R 
Sbjct: 273 LQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRN 332

Query: 355 XXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVA 414
                      NIEKFGKDQP++PVP+ F A  EQ +LV+EM +LHNS+DMRA+SLY+V 
Sbjct: 333 GEEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVG 392

Query: 415 YKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNE 474
           Y  VHPEN+G+DNDRGEPE+SNWANTWRGLLDY+  I +WD  S+ ++VDSL+ FEK+N 
Sbjct: 393 YGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWD-SSDRKKVDSLETFEKENS 451

Query: 475 IKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           +K RG LRMPP SEM+ HGQPH GEYASDHLSM+C IEL
Sbjct: 452 LKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/460 (70%), Positives = 391/460 (85%), Gaps = 5/460 (1%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKL 114
           V+PEHIAKVRAER+A R AK+++M+AQGIDPD PPEL FIKRP L LH+ E V GF+FKL
Sbjct: 39  VSPEHIAKVRAEREAARAAKKEAMMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98

Query: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKE 174
           MTYNCLAQALIRRKLFP SGDALKWYRRS+VLLNEF++YNADVICLQEID+IQ+QSFWK+
Sbjct: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158

Query: 175 EFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLV 234
           E +KLGY+ Q+HR ++KNHGVAI+W+R+ F   DKMLIDFD+E SG+IP RTTTNN GL+
Sbjct: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218

Query: 235 LALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNV 294
           L+LKFS+KV     + + KK+GI++GT+HLFWHPFGT+ERTRQCY+VL K++EF HRVNV
Sbjct: 219 LSLKFSDKVAQ---EHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNV 275

Query: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR- 353
           LQN NDGD SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y KRAKTVIECSTS+ FSK+R 
Sbjct: 276 LQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRD 335

Query: 354 XXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSV 413
                       NIEKFG DQP+ PVP+ + A + + ELV++M  LHNSLDMRAVSLYSV
Sbjct: 336 GEEDDAEEEEGGNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSV 395

Query: 414 AYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDN 473
           AY+ VHPENAGLDN+RGEPEISNWA+TWRGLLDYLF+I+ WD  S+C+E+DSL+ FE++N
Sbjct: 396 AYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDF-SDCKEIDSLESFEREN 454

Query: 474 EIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
            +K RG LR+PPG EMT+HGQPH GEY SDHL M+C++EL
Sbjct: 455 SLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/460 (67%), Positives = 370/460 (80%), Gaps = 8/460 (1%)

Query: 54  VVTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFK 113
           + +PE IAK+RAER  +++AK++  +        PPEL FIKRP L LHEEEPV GF+F 
Sbjct: 116 IPSPEEIAKLRAERKLLKEAKKEVSV-------IPPELQFIKRPILYLHEEEPVQGFKFS 168

Query: 114 LMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWK 173
           +MTYNCLAQALIRRKLFPDSGDALKWYRRS+VLLNEF +Y+ D+ICLQE+DHIQ+QSFWK
Sbjct: 169 MMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFTYYSPDIICLQEVDHIQYQSFWK 228

Query: 174 EEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGL 233
            EF KLGY+ QYHR   KNHGV+IIWRR +F   DKMLI+FDKE SGN+P RTTTNNVGL
Sbjct: 229 TEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMTDKMLIEFDKESSGNVPPRTTTNNVGL 288

Query: 234 VLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVN 293
           +L+LKF+ +  +      + K+GI+IGT+HLFWHPFGTYERTRQCY+VL KM+EFMHRVN
Sbjct: 289 ILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVN 348

Query: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR 353
           VLQN ND DLSHW+PFFCGDFNSQPFD+PYLSM  KPV Y  RAKTVIECSTS+KFSK R
Sbjct: 349 VLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSMVRKPVEYSGRAKTVIECSTSYKFSKKR 408

Query: 354 XXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSV 413
                       NIEKFG DQP++PVP++F AN EQ  LV +M +LHNSL+MRA+SLY V
Sbjct: 409 DGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGV 468

Query: 414 AYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDN 473
            YKNVHPENA +DN+ GEPEISNWA+TW GLLDYL ++K+W   S+C + ++L  FE+ N
Sbjct: 469 GYKNVHPENASIDNECGEPEISNWAHTWNGLLDYLLFVKEWTF-SDCTKTETLKQFEESN 527

Query: 474 EIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
            ++ RGFLRMPP +EMTKHGQPHVGEY SDHLSM+C IEL
Sbjct: 528 SMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSMLCSIEL 567

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/461 (68%), Positives = 370/461 (80%), Gaps = 5/461 (1%)

Query: 57  PEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMT 116
           PEHIAKVRAER+A+RK+K+++MLAQG+DPD PPEL FI+RP L+L + E   GF FK+MT
Sbjct: 54  PEHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMT 113

Query: 117 YNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEF 176
           YNCLAQALIRRKLFPDSG+A+KW+RRS+VLLNEF++Y++DVICLQE+D IQFQ+FWKEEF
Sbjct: 114 YNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEF 173

Query: 177 SKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLA 236
            KLGY+ Q+H   +KNHG++I+W+R +F   DKMLID+DKE+SGNIP RTTTNNVGLVLA
Sbjct: 174 DKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLA 233

Query: 237 LKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQ 296
           LKFS KVL      +++KSGI++GT+HLFWHPFGTYERTRQCYIVL K +EFMHRVNVLQ
Sbjct: 234 LKFSPKVLERF--PNTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQ 291

Query: 297 NENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXX 356
           N ND    HW+ FF GDFNSQPFDTPYLSMT KPV Y  RAKTVIECSTS+ FSK R   
Sbjct: 292 NNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGE 351

Query: 357 XXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYK 416
                    NIEKFGKDQP +PVP  F A+ EQ  LV  M +LHNSLDMRA+SLYSV Y 
Sbjct: 352 EDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYG 411

Query: 417 NVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIK 476
            VH ENAGLDN RGEPEISNWA+ W GLLDYLF IK WD     Q VDSL  FE +NE+K
Sbjct: 412 TVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKIQ-VDSLKKFEDENELK 470

Query: 477 FRGFLRMPPGSEMTK--HGQPHVGEYASDHLSMVCDIELQL 515
            + FL+MP  +EM K  HGQPHVGEY SDHLSM+C +EL+L
Sbjct: 471 VKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLELKL 511

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/461 (70%), Positives = 379/461 (82%), Gaps = 4/461 (0%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKL 114
           ++PEHIA+ RA+R+A R AKR++MLA G+DP+ PP+L FIKRP L LHEEEPV GF+FK+
Sbjct: 49  ISPEHIAEKRAQREAARAAKREAMLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKI 108

Query: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKE 174
           MTYN LAQALIRRKLFP SG+A+KW++RS+VLLNEF+HY+ADV CLQEIDHIQ+Q+FWKE
Sbjct: 109 MTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKE 168

Query: 175 EFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLV 234
           EF KLGY  Q+HR  TKNHGVAI+WR  +F  VD ML+D+DKE SG+IP RTTT N GL+
Sbjct: 169 EFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLI 228

Query: 235 LALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNV 294
           LALKF++KVL+      +KKSGILIGT+HLFWHPFGT+ERTRQCY+VL KM+E +HRVNV
Sbjct: 229 LALKFTDKVLNQF--PGTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNV 286

Query: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRX 354
           LQN  D D SHW+PF CGDFNSQPFDTPYLSMT KPV Y  RAKTVIECSTSF FSK+R 
Sbjct: 287 LQNNQDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLR- 345

Query: 355 XXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVA 414
                      NIEKFGK QPE PVPK+FHA EEQ  LV +M  LHNSLDMRA+SLY+V 
Sbjct: 346 DGEEGEDEEGGNIEKFGKGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVG 405

Query: 415 YKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNE 474
           YK+VHPENAGLDND GEPEISNWA TWRGLLDY+F++K W+  ++   VD +D FE++N 
Sbjct: 406 YKHVHPENAGLDNDSGEPEISNWAETWRGLLDYIFFVKNWN-GTDRSSVDKIDVFERENG 464

Query: 475 IKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           IK RG LRMPPG EMTKHGQPH GEY SDHLSM+C+IEL +
Sbjct: 465 IKIRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCEIELNV 505

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/463 (65%), Positives = 369/463 (79%), Gaps = 4/463 (0%)

Query: 53  PVVTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRF 112
           P V+PEHIA+VRA+R+A +K KR+ M+A+G+DPD PP+L FI RP LSL+  E   GF F
Sbjct: 37  PKVSPEHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVF 96

Query: 113 KLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFW 172
           KLMTYNCLAQALIRRKLFP SG+ALKW++RSRVLLNEF HYN+DV+CLQE+D+IQ+QSFW
Sbjct: 97  KLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFW 156

Query: 173 KEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVG 232
           KEEF KLGYE Q+HR+ TKNHG+AI+W+RDMF  VDKMLID+DKE SG +  RTTT NVG
Sbjct: 157 KEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVG 216

Query: 233 LVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRV 292
           L +AL F++KVL+      S K GI++GT+HLFWHPFGT+ERTRQCY++L KM+EFMHR+
Sbjct: 217 LAIALGFTKKVLAKY--PGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRI 274

Query: 293 NVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKV 352
           NVLQ++     + W+PFFCGDFNSQPFDTPYLS++ KPV Y+ RAKTVIECSTS+ FSK 
Sbjct: 275 NVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKA 334

Query: 353 RXXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYS 412
           R            NIEKFG  QPE PVP+ F A EEQ  LV+ MA LHNSLDMR +S+YS
Sbjct: 335 R-DGEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYS 393

Query: 413 VAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKD 472
           V YK+VH ENAGLDN+  EPEISNWA TWRGLLDY+F+IKKWD  S+    + L+ F+ +
Sbjct: 394 VGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDF-SDKASPEELEAFQDE 452

Query: 473 NEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
           N IK RG LRMPP  EM  HGQPH GEY SDHLSM+C++EL++
Sbjct: 453 NGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELELKI 495

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/442 (65%), Positives = 360/442 (81%), Gaps = 3/442 (0%)

Query: 74  KRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDS 133
           K+  MLA G+DPDCPPEL FI+RP L+LH++EP   F F LMTYNCLAQALIRRKLFPDS
Sbjct: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146

Query: 134 GDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNH 193
           G+A+KWYRRSRVLLNEF++YN D+ICLQEIDHIQFQSFW+EEF K+GY  Q+HR  +KNH
Sbjct: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206

Query: 194 GVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGK-ASS 252
           GVAI+W+ ++F+  D+MLIDFDKE+SG+I  RT TNN GL+L+LK+S+ VL+   +  ++
Sbjct: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266

Query: 253 KKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCG 312
            KSGI+IGT+HLFWHPFGTYERTRQC+++L K++EF  RVNVLQN NDG++ HW  FFCG
Sbjct: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326

Query: 313 DFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRX-XXXXXXXXXXXNIEKFG 371
           DFNSQPFDTPYLS+T KPV Y++RAK VIECSTS+ +SK+R             NIEKFG
Sbjct: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFG 386

Query: 372 KDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGE 431
           KDQP++PVP  +    EQ +LV +M  LHNSL+M+A SLY+V YK VHPEN+GLDN +GE
Sbjct: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446

Query: 432 PEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTK 491
           PEISNWA++WRGLLDY+FY+  WD  S+C+EV+  + FEK N +K RG+LRMPP +EM+K
Sbjct: 447 PEISNWAHSWRGLLDYIFYVDHWDF-SDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSK 505

Query: 492 HGQPHVGEYASDHLSMVCDIEL 513
           +GQPH GEY SDHLSM+C IEL
Sbjct: 506 YGQPHQGEYPSDHLSMMCKIEL 527

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/466 (63%), Positives = 351/466 (75%), Gaps = 15/466 (3%)

Query: 58  EHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVT--GFRF--K 113
           E IA++RAER    KAKR++   QG   D P EL FI+RP LS+H +  +   G R    
Sbjct: 24  EEIARIRAER----KAKREAAALQGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVT 79

Query: 114 LMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWK 173
           LMTYNCLAQALIRRKLFPDSG ALKWYRRS+VLLN+F+HY  DV+CLQE+D +Q+ SFW+
Sbjct: 80  LMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWR 139

Query: 174 EEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGL 233
            EF KLGY  Q+H+  TKNHGVA++WR  +F   DKMLIDFDKE SG++P RTTTNN GL
Sbjct: 140 GEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGL 199

Query: 234 VLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVN 293
           V+ALKF+E+ L+  G   + +SGIL+GT+HLFWHPFGT+ERTRQCY+VL KM+EFMHRVN
Sbjct: 200 VIALKFTEQALT--GHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVN 257

Query: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR 353
           VLQNENDG+  HWFPFFCGDFNSQP+D PYLSMT KPV Y  RA+TVIECSTS+ FSK R
Sbjct: 258 VLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQR 317

Query: 354 --XXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLY 411
                         NIE FGKDQP  PVP  F  N EQ  LV +M  LHNSLDMRAVSLY
Sbjct: 318 DGEDAAADEEEEGGNIEIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLY 377

Query: 412 SVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEK 471
           SV Y+NVHPENAG DN RGEPEISNWA+TW GLLDYLFY+  WD +     VD+L++FE+
Sbjct: 378 SVGYRNVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTG-VDTLEEFEQ 436

Query: 472 DNEIKFRGFLRMPPGSEMTK--HGQPHVGEYASDHLSMVCDIELQL 515
           D+ +  +  LRMP   EM +  HGQPH GEY SDHL+MVCD+EL L
Sbjct: 437 DSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLELAL 482

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/459 (65%), Positives = 361/459 (78%), Gaps = 5/459 (1%)

Query: 57  PEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMT 116
           PEHIA+VRA+R+A +KAKR+ MLA+G+DP+ PP+L FI RP L L       GF FK+MT
Sbjct: 41  PEHIAEVRAKREAAKKAKREEMLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100

Query: 117 YNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEF 176
           YNCLAQALIRRKLFP SG+ALKW++RSRVLLNEF HY ADV CLQEID+IQ+QSFWKEEF
Sbjct: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160

Query: 177 SKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLA 236
            KLGY+ Q+HR+ TKNHG+AI+W+RD+F  VDKML+D+DKE SG++  RTTT NVGLVLA
Sbjct: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220

Query: 237 LKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQ 296
           L FS+KVL      S  K GIL+GT+HLFWHPFGT+ERTRQCY++L KM++F+HRVNVLQ
Sbjct: 221 LAFSKKVLDKYPGTS--KRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ 278

Query: 297 NENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXXX 356
           + +  +   W+PFFCGDFN+QPFDTPYLSM+ KPV Y+ RAKTVIECSTS+ FSK R   
Sbjct: 279 DGSSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR-DG 336

Query: 357 XXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYK 416
                    NIEKFG  QPE PVP  + A  EQ ELV  MA+LHNSLDMRA+S+YSVAYK
Sbjct: 337 EECDDEEGGNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYK 396

Query: 417 NVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIK 476
           +VHPENAG DN   EPEISNWA TWRGLLDY+F+IK+W+   N +  + L  FEK+N++K
Sbjct: 397 HVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDN-KRPEELQTFEKENDVK 455

Query: 477 FRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
               LRMPP  EM  HGQPH GEY SDHLS++C+IEL L
Sbjct: 456 ILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/463 (60%), Positives = 352/463 (76%), Gaps = 8/463 (1%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFR--- 111
           +TPE+IA++RA+R+A + AK+++++AQGIDP  P +L FIKRP L++  +      R   
Sbjct: 56  ITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115

Query: 112 -FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
              +MTYNCLAQALIRR LFP SG+A+KW++RS+VLLNEF++YN DV+CLQEID +Q++S
Sbjct: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175

Query: 171 FWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNN 230
           FWK EF+KLGY  Q+H N TKNHGV I W+ D+F   DKMLID+DKE +G I  RTTT N
Sbjct: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235

Query: 231 VGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMH 290
           VG++L+LKF +KVL       +K SGI+IGT+HLFWHPFGTYERTRQCYIVLKK++EF +
Sbjct: 236 VGMLLSLKFKKKVLEKY--PDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293

Query: 291 RVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFS 350
           R+NVLQNE DGD SHW  FFCGDFNSQPFD PYLS+T KPV Y  RAKTVIECSTSF FS
Sbjct: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353

Query: 351 KVRXXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSL 410
           K+R            NIEKFGK QPE+PVP+ F  NEEQ +L + M  LHN +DMRA+SL
Sbjct: 354 KLR-DGDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISL 412

Query: 411 YSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFE 470
           YS+AY  VHPEN+GLDN R EPEISNWA+ WRGLLDYL+Y+  WD   +C ++D L  FE
Sbjct: 413 YSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD-GCDCTKIDELSTFE 471

Query: 471 KDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           ++  ++    LR+PP  EMT+HGQPH GEY SDHL M+  + +
Sbjct: 472 QNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/460 (56%), Positives = 337/460 (73%), Gaps = 14/460 (3%)

Query: 56  TPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLM 115
           + E I K+RA+R    KAK+++   QG +     ++ FIKRP L  + +E   GF F++M
Sbjct: 59  SAEEIEKIRAQR----KAKKEAAGKQGGE-----DVGFIKRPLLVCNGDE-AKGFVFRMM 108

Query: 116 TYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEE 175
           TYNCLAQALIRRKLFP SG+ALKW++RS+VLL+E ++YN DVICLQEIDH Q++SFW + 
Sbjct: 109 TYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDA 168

Query: 176 FSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVL 235
               GY  ++HR+  KNHG+AI+WRR +F +VD+ LIDFD+E SG I  RTTT NVGL++
Sbjct: 169 LQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTKNVGLIV 228

Query: 236 ALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVL 295
           AL++++++        S +SGI++GTSHLFWHPFGTYER RQCYI+L +M+ F+ R+ +L
Sbjct: 229 ALEYTDEIKRRY--PGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLL 286

Query: 296 QNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRXX 355
           +  + G  S W PFFCGDFNSQPFD PYLSM  KP+ YE RA+TVIECSTS+KFS +R  
Sbjct: 287 ERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLR-D 345

Query: 356 XXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAY 415
                     NIEKFG  QPE+PVP  F    EQ  LVD M  LHN+LDMRA+SLYS+AY
Sbjct: 346 GCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAY 405

Query: 416 KNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEI 475
           + VHPENAG+DN+RGEPEISNWA+ WRGLLDY+ Y+  WD   N  EVD + +F+K+  +
Sbjct: 406 RYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVMPWDFSDNT-EVDDIGEFQKNTSV 464

Query: 476 KFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
             R  LR+PP SEM  HGQPH GEY SDHLS++C++EL +
Sbjct: 465 IVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELELLM 504

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/426 (59%), Positives = 314/426 (73%), Gaps = 8/426 (1%)

Query: 91  LHFIKRPFLSLHEEEPV-TGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNE 149
           L FI RP L L   + V  GF F LMTYNCLAQ+LIRR LFP SG ALKW +RS VLL E
Sbjct: 69  LEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLKE 128

Query: 150 FRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDK 209
           F+HYNADV+CLQEID+ Q+ SFW    S LGY  ++HR   K+HGVAI W++D+F  +D+
Sbjct: 129 FKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMDQ 188

Query: 210 MLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPF 269
           MLI+FD E SG I  R TTNNVG++LAL FS+KV  +     + KSGI++GTSHLFWHPF
Sbjct: 189 MLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSF--PGTVKSGIIVGTSHLFWHPF 246

Query: 270 GTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCK 329
           GTYERTRQCY++L KM+EF+HRV++ QNE+  DL+ W+PFFCGDFNSQPFD PYLS+T K
Sbjct: 247 GTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSK 306

Query: 330 PVHYEKRAKTVIECSTSFKFSKVRXXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQ 389
           PV Y  RAKTVIECS ++KF  +             +    G+D+P  PVP+ F    E 
Sbjct: 307 PVLYSGRAKTVIECSAAYKFPDL----GAGARGANEDGGTVGEDRPVDPVPESFQPTAEV 362

Query: 390 IELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLF 449
             LV +M +LHNSLDMRA+SLY+VAYK+VHP+NAGLDN+RGEPEISNWA TWRGLLDY+ 
Sbjct: 363 SSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIM 422

Query: 450 YIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVC 509
           YI  W   +N  EVDSL+ FEK + I  +  LRMPP  EM+ HGQPH GEY SDHL+M+C
Sbjct: 423 YITPWQASNNV-EVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMC 481

Query: 510 DIELQL 515
            +E+++
Sbjct: 482 KLEVEM 487

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  493 bits (1268), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 323/477 (67%), Gaps = 30/477 (6%)

Query: 54  VVTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFK 113
           ++  E+I K+RAER+  R+ +R+  +  G +PD P EL FIKRP L+LH+++PV G   K
Sbjct: 33  MLNTEYITKIRAEREKKRELEREYRMKHGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLK 92

Query: 114 LMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWK 173
           +MTYNCLAQ+LI+R LFP SG ALKW RRS+VLLNE ++Y++D++ LQEID +QF+ +WK
Sbjct: 93  IMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWK 152

Query: 174 EEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGL 233
              +KLGY+ ++++ + K HGV I W+R++F +V  + IDFD+ +SG I  RT T NVGL
Sbjct: 153 IVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGL 212

Query: 234 VLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVN 293
           V+AL+F  K      K++ KK G++IGT+HLFWH FGT+ERTRQCY+++ +M++FM ++ 
Sbjct: 213 VIALEFLNK-----DKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL- 266

Query: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR 353
                  G +  W+PFF GDFNSQP D PY+S+T KPV ++   K VIECS ++K+SK R
Sbjct: 267 -------GGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKR 319

Query: 354 X-----------------XXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEM 396
                                          E+   +QP +  P  F    EQ ELV ++
Sbjct: 320 NGEEEEKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQL 379

Query: 397 AQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDL 456
           A LHNSL++RA+SLYSV Y+ V PENA ++NDRGEPE+S WA  W GLLDY+F+++ WD 
Sbjct: 380 AALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDG 439

Query: 457 RSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           ++N ++VDSL  FE++N +K RG L+MP   EM +H  P+ GEY SDHL M+  +EL
Sbjct: 440 KTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  470 bits (1209), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 223/464 (48%), Positives = 314/464 (67%), Gaps = 14/464 (3%)

Query: 56  TPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTG---FRF 112
           +PE+I+++R +R    +  R+S + QG+DPD PPEL F +RPFL+LH+ EP  G     F
Sbjct: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78

Query: 113 KLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFW 172
            ++TYNCLAQ LI R +FP+SG+ALKW RRS+ ++NE ++YN D++CLQEID    + FW
Sbjct: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138

Query: 173 KEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVG 232
             +F  LGY  ++ +   K HGV I WR  +F+  D+  +DFD+ ++G+IP RT T N+G
Sbjct: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198

Query: 233 LVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRV 292
           L++AL+F +   +N    S +  GI++ T+HLFWHPFGT+ERTRQCY++L +M +F+  +
Sbjct: 199 LIVALQFLD---NNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255

Query: 293 NVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKV 352
           N    E+ G +++W+PF  GDFNSQP D PY+SMT KP+ Y    +TVIECSTS+ +SK 
Sbjct: 256 N----EHSG-ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310

Query: 353 R---XXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVS 409
           R                 E+F K QP  P P  F   +EQ  LV+ + QLHNSL  RA+S
Sbjct: 311 RNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370

Query: 410 LYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDF 469
           LYSV Y+NVHPEN+ ++N RGEPE S+W   W GLLDY+FYIK W+L+    +V++L+ F
Sbjct: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430

Query: 470 EKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           EK N +K  GFL++P   EM  H QP+ GEY SDHL+++C ++L
Sbjct: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  454 bits (1168), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/461 (47%), Positives = 305/461 (66%), Gaps = 16/461 (3%)

Query: 62  KVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSL--HEEEPVTGFRFKLMTYNC 119
           ++R +R+  +  KR+  L QG DPD P EL FIKRP L L  H      GF+F LMTYNC
Sbjct: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80

Query: 120 LAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEF-SK 178
           LAQA+IRR++F DSG ALKW+RRS+VL+NE  +YN D++CLQEID  Q+++FWK++  S 
Sbjct: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140

Query: 179 LGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALK 238
           L     Y++   K+HGV I W++ +F+QVD M++DFD   + NI  RT T N+ + +ALK
Sbjct: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200

Query: 239 FSEKVLSN-----LGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVN 293
           F+++ ++      L        G +I T+HLFWHPFGT+ERTRQCYI+L+KM++F+  +N
Sbjct: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260

Query: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR 353
           V     D   +HW+PF CGDFNS P D PYLSMT KP+ Y  R K VIECST++KFSK R
Sbjct: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316

Query: 354 XXXXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSV 413
                         EK   +QP+  VP  F    EQ +LV ++  LHN L +RA SLY +
Sbjct: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373

Query: 414 AYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEV-DSLDDFEKD 472
           AYK V P N  ++NDRGEPE ++WA +W G+LDY+ Y+  WD+     E+ +SL++FEK+
Sbjct: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433

Query: 473 NEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           N++  +G L+MP   +M  H QP   EY SDH+S++C++E+
Sbjct: 434 NQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 200/469 (42%), Positives = 289/469 (61%), Gaps = 32/469 (6%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCP-PELHFIKRPFLSLHEE-------EP 106
           +T E + K+R ER   R+++R+S+++QG DPD P P+L FIKRPFL LH E         
Sbjct: 42  LTKEQVKKIREERAQKRQSRRNSLISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTEST 101

Query: 107 VTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHI 166
                 K+MTYN LAQ LIRR  FP SG ALKW++RS+VL++E + Y  D++ LQE+D+ 
Sbjct: 102 PNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYN 161

Query: 167 QFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGN-IPTR 225
           + + FW+E F KLG++  + R+  K HG+ I W    FQ  ++ ++D+D  ++GN IP R
Sbjct: 162 ELK-FWQENFRKLGFDLTFKRHDGKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIPAR 220

Query: 226 TTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKM 285
           T T N+ L+ +L+     L N+   S+   G+++  +HLFWHPFG +ER RQ Y+VL K+
Sbjct: 221 TRTKNIALIASLR-----LKNISDPST--DGVIVANTHLFWHPFGVFERLRQSYLVLAKI 273

Query: 286 EEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECST 345
           +E    +      N      W     GDFN++P + PYL++T KPV     A+ + ECS 
Sbjct: 274 QE----IKACPKYNG-----WHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSL 324

Query: 346 SFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPKDFHANEEQIELVDEMAQLHNS 402
           ++++SK R            + +  G+   +QP++P PK F A  EQ  LVD++  LHNS
Sbjct: 325 AYRYSKKRNGEEGGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNS 384

Query: 403 LDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQE 462
           L +R VSLY + Y  V PEN+   N  GEPE+SNWAN+W GLLDY+FYI+  D  S   +
Sbjct: 385 LHVRGVSLYGLGYGKVQPENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHS-AHD 441

Query: 463 VDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDI 511
            + +DDFE  N ++  G+L+MP   EM KH QP  GEYASDH+S++C +
Sbjct: 442 QNPVDDFENKNNLRVMGYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQL 490

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/480 (43%), Positives = 302/480 (62%), Gaps = 40/480 (8%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPD-CPPELHFIKRPFLSL-HEEEPVTGFRF 112
           +TPE I+K+R  R+  R    ++      +P+    +  FIKR  L L + EE       
Sbjct: 20  ITPEFISKIRKLREKKRAENEEN------NPEFLNSKYDFIKRAILQLPNVEELDNSVDL 73

Query: 113 KLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFW 172
           K+MTYN L+Q+LIRR+++PD+ DA+KW+ RS+V+LNE ++YN D++C QE+D IQ+  FW
Sbjct: 74  KIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIKYYNCDIMCFQEVDVIQWDKFW 133

Query: 173 KEEFSKLGYEGQYHRN--STKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTT-TN 229
             E SKLGYEG+++++    K HGVAI WR ++F+Q D + I+FD  V+GN  ++TT T 
Sbjct: 134 LPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDVIKINFDDIVAGNAISKTTRTW 193

Query: 230 NVGLVLALKFSEKVLSNLGKASSKK--SGILIGTSHLFWHPFGTYERTRQCYIVLKKMEE 287
           NVGL++ALKF         K+S+ K  SGI+IGT+HLFWHPFGT+ERTRQ  I+LKK  +
Sbjct: 194 NVGLIVALKF---------KSSNAKFRSGIVIGTTHLFWHPFGTFERTRQLAILLKKFRK 244

Query: 288 FMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSF 347
            +  +N      +   + W P   GDFNSQP D PYLS+T KPV     AKTVIECST++
Sbjct: 245 LIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKPVSASGEAKTVIECSTAY 304

Query: 348 KFSKVRXXXXXXXXXXXXNIEK----------FGKDQPESPVPKDFHANEEQIELVDEMA 397
           KFS+ R            N E             +  P  P P  F A  EQ +L+ ++ 
Sbjct: 305 KFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPSHFEATSEQKDLIAKLE 364

Query: 398 QLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLR 457
           ++HNS++++A SL+ +AYK VH  + GL N + EPE+S+ +  W GLLDY+F ++ W+  
Sbjct: 365 KVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSHTSIFWTGLLDYIFILEPWN-- 419

Query: 458 SNCQEVD--SLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515
              ++ D  SL+DFEK   ++ +G L+MP   E+ K+ QPH G+Y SDHLSM+CD+ +++
Sbjct: 420 -EVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYPSDHLSMICDLNVRI 478

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  384 bits (986), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 296/472 (62%), Gaps = 37/472 (7%)

Query: 58  EHIAKVRAERDAIRKAKRDSMLAQGIDPDCP-PELHFIKRPFLSLHEEE----------- 105
           +HI K+R ER   R+++R+S+++QG DPD P P+L FI+RPFL ++ E            
Sbjct: 45  DHIKKIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQV 104

Query: 106 PVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDH 165
           P +    ++MTYN LAQ LIRR  FP SG ALKW++RS+VL++E + Y  D++ LQE+D+
Sbjct: 105 PPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDY 164

Query: 166 IQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGN-IPT 224
            +   FW E F KLG+   + R+  K HG+ + W  + FQQ ++ ++D+D  ++GN I  
Sbjct: 165 NEL-GFWHENFHKLGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISA 223

Query: 225 RTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKK 284
           RT T N+ L+++L  S K ++NL       SG+++  +HLFWHPFG +ER RQ ++VLKK
Sbjct: 224 RTRTKNIALIVSL--SVKNMTNLS-----TSGVIVANTHLFWHPFGVFERLRQSFLVLKK 276

Query: 285 MEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECS 344
           +EE          +       W     GDFN++P + PY+++T +P+     A+ + ECS
Sbjct: 277 IEEI---------KTCPKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECS 327

Query: 345 TSFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPKDFHANEEQIELVDEMAQLHN 401
            ++++SK+R              E  G+   DQP++P PK F A +EQ  LV+++  LHN
Sbjct: 328 LAYRYSKMRNGEESDQDEECDE-ESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHN 386

Query: 402 SLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQ 461
           SL ++ +SLY ++Y  VHP+N+    + GEPE+SNWANTW GLLDY+FYI++ D  S+ +
Sbjct: 387 SLHVKGISLYGLSYGKVHPDNS--KENHGEPELSNWANTWCGLLDYIFYIERNDNVSSSK 444

Query: 462 EVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           + + + +FE  N +K  G+LRMP   EM KH QP  GEYASDH+S++C + L
Sbjct: 445 D-EPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRL 495

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  379 bits (973), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 194/475 (40%), Positives = 292/475 (61%), Gaps = 36/475 (7%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCP-PELHFIKRPFLSLHEEE-----PVT 108
           ++ + I K+R ER   R+ +R+S+++QG DPD P P+L FI+RPFL ++ +      P T
Sbjct: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPAT 99

Query: 109 ------GFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQE 162
                     K+MTYN LAQ LIRR  FP+SG ALKW++RS+VL++E + Y  DV+ LQE
Sbjct: 100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQE 159

Query: 163 IDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGN- 221
           +D+ +  +FW+E F KLG++  + R+  K HG+ + W    FQ  +  ++D+D  ++GN 
Sbjct: 160 VDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218

Query: 222 IPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIV 281
           I  RT T N+ L+++L F        G   S   GI++  +HLFWHPFG +ER RQ Y+V
Sbjct: 219 ISARTRTKNIALIISLYFK-------GITDSSSRGIIVANTHLFWHPFGVFERLRQSYLV 271

Query: 282 LKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVI 341
           L+K++E    +      N      W     GDFN++P + PYL++T +P+  +   + ++
Sbjct: 272 LQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322

Query: 342 ECSTSFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPKDFHANEEQIELVDEMAQ 398
           ECS ++++SK R            + +  G+   DQP++P P+ F A +E+  LV+++  
Sbjct: 323 ECSLAYRYSKKRNGEESDQDDEECDEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382

Query: 399 LHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRS 458
           LHNSL ++ VSLY + Y  VHPENA  +   GEP +SNWANTW GLLDY+FYI+  D   
Sbjct: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEG-DHNQ 439

Query: 459 NCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           + ++ + L+ FE +N +K  G+LRMP   EM KH QP  GEYASDH+S++C I L
Sbjct: 440 DTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  376 bits (965), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 195/470 (41%), Positives = 272/470 (57%), Gaps = 32/470 (6%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSL-HEEEPVTGFRFK 113
            TP  I   R  R   ++  R+ +L++G+DPD P E  FI+RP L + H +    G    
Sbjct: 22  ATPAEIEAKREARRLKKQKLREELLSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLS 81

Query: 114 LMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWK 173
           +MTYNCLAQ LIRR++FP+SG ALKW+ RS+VLL+E +HYNAD+ CLQEID +Q+  FW 
Sbjct: 82  IMTYNCLAQTLIRREMFPESGPALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWS 141

Query: 174 EEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGL 233
           EE  K GY+  Y    +K+HGV I W+ ++FQ    M I+FDKE    I  RT TNNVGL
Sbjct: 142 EELPKFGYKTIYFHQDSKSHGVMIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGL 201

Query: 234 VLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVN 293
           ++AL F++   +   +  + +SG++IGT HLFWHPFGTY+RTRQC ++ KK+ EF   V 
Sbjct: 202 LVALAFTDAFRARNNRIRTSRSGVIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK 261

Query: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR 353
                  GD   +   F GDFNSQP   PYL +T        + +T IE ST++++S+ R
Sbjct: 262 -------GD---YCKMFTGDFNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERR 311

Query: 354 XXXXXXXXXXXXNIEKF----------GKDQPESPVPKDFHANEEQIELVDEMAQLHNSL 403
                         E+           G D   +P P +F + EEQ +LV+ +    N +
Sbjct: 312 NLGKEYSMEEEEEEEEEEEKREYEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDV 371

Query: 404 DMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEV 463
            + A SLYS+ Y  V P +     D  EPE+S+W+  W GLLDY+FY+         Q  
Sbjct: 372 PLCATSLYSIGYHTVDPTHIA---DHHEPELSSWSTKWAGLLDYIFYVN--------QRP 420

Query: 464 DSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
            +   FE  N I   G+L+MP  ++M  H QP+ GEY SDH+SM+C +E+
Sbjct: 421 STPATFETANNIAIAGYLQMPTHAQMHNHSQPYTGEYPSDHISMMCALEI 470

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  376 bits (966), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 194/475 (40%), Positives = 296/475 (62%), Gaps = 37/475 (7%)

Query: 56  TPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCP-PELHFIKRPFLSLHEEEPVTGFR--- 111
           T +HI K+R ER   R+  R+S+++QG DPD P P+L FI+RP L +  E+    F+   
Sbjct: 41  TIDHIKKIREERAERRQRCRNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSF 100

Query: 112 ---------FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQE 162
                     K+MTYN LAQ LIRR  FP SG ALKW++RS+VL++E + Y  D++ LQE
Sbjct: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQE 160

Query: 163 IDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGN- 221
           +D+ + + FW+E F KLG++  + RN  K HG+ + W  + FQ  ++ ++D+D+ ++GN 
Sbjct: 161 VDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219

Query: 222 IPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIV 281
           I  RT T N+ L+++L+F +         ++  +GI++  +HLFWHPFG +ER RQ Y+V
Sbjct: 220 ISARTRTKNIALIVSLRFKD-------TRNASTNGIVVANTHLFWHPFGVFERLRQSYLV 272

Query: 282 LKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVI 341
           L+K++E          ++      W     GDFN++P + PYL++T KP+      + ++
Sbjct: 273 LQKIQEI---------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMV 323

Query: 342 ECSTSFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPKDFHANEEQIELVDEMAQ 398
           ECS ++++SK R            +    G+   +QP++P PK F A +E+ +LV+++  
Sbjct: 324 ECSLAYRYSKKRNGEESDQDDEDYDENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLIT 383

Query: 399 LHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRS 458
           LHNSL ++ +SLY + Y  VHPENA  +   GEPE+SNWANTW GLLDY+FYI+  D  +
Sbjct: 384 LHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIES-DDNN 440

Query: 459 NCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513
           + Q+  SL+ FE++N +   G+LRMP   EM KH QP  GEYASDH+S++C I L
Sbjct: 441 SAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  351 bits (901), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/481 (41%), Positives = 277/481 (57%), Gaps = 46/481 (9%)

Query: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTG----- 109
           +TPE+I ++RA    +R+ KR+   A+    D   E+ FIKRP L    E P  G     
Sbjct: 12  ITPEYIERIRA----LRREKREREKAE--RADVAREI-FIKRPLL----EVPYVGGVPCR 60

Query: 110 ---FRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHI 166
               R K+MTYN LAQ LIRR  FPD+ DA+KW+RRS+VL+ E  +Y+ADV+CLQE D I
Sbjct: 61  DGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRI 120

Query: 167 QFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQ--VDKMLIDFDKEVSG-NIP 223
           Q+  FW EEF +LGY+G +     K HGVAI+W+  MF+   +DK+ +  D  V+G +I 
Sbjct: 121 QWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIA 180

Query: 224 TRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLK 283
             T T  V L +AL+          K       I+  T+HLFWH FGT+ERTRQ +++L 
Sbjct: 181 ATTGTRTVALAVALRL---------KHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILS 231

Query: 284 KMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIEC 343
           ++ +F+ +V    + +       + FF GDFNSQP D PYLS+T KPV  + RAK++IEC
Sbjct: 232 ELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIEC 288

Query: 344 STSFKFSKVRXX-------XXXXXXXXXXNIEKFGKDQPESPVPKDFHANEEQIELVDEM 396
           S S+++SK R                   ++E    ++P+ P P  + A  EQ+E V  +
Sbjct: 289 SLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQDPRPYTYDAMPEQVERVQHL 347

Query: 397 AQLHNSLDMRAVSLYSVAYKNVHPENAG--LDNDRGEPEISNWANTWRGLLDYLFYIKKW 454
             LHN + ++ VSLY + Y  VHPEN+     +   EP++S+ A  W GLLDY+F I +W
Sbjct: 348 QNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEW 407

Query: 455 DLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQ 514
               N  ++  L   E+   IK  G+LRMP   EM  H +PH  EY SDHL+M+CDI L 
Sbjct: 408 S--ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISLP 465

Query: 515 L 515
           L
Sbjct: 466 L 466

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 100/226 (44%), Gaps = 35/226 (15%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKW-YRRSRVLLNEFRHYNADVICLQEIDHIQFQ 169
           F +++YN L Q     K++  +   AL W YRR++ L  +   Y++DV+CLQE++   F+
Sbjct: 499 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNK-LKEQILSYSSDVLCLQEVESKTFE 557

Query: 170 SFWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD---- 215
            +W     K GY G +H          ++S K  G  I ++RD F+ V++  +DF     
Sbjct: 558 DYWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWM 617

Query: 216 -----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFG 270
                +     +      +NV L L L+             S    I + T+HL W P  
Sbjct: 618 KHKKFQRTEDYLNRAMNKDNVALFLKLQH-----------VSSGDTIWVVTTHLHWDPKF 666

Query: 271 TYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
              +T Q  ++L  +E  + + +   N    D+       CGDFNS
Sbjct: 667 NDVKTFQVGVLLDHLETLL-KEDTTHNSRQ-DIKKSPVLICGDFNS 710

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 99/226 (43%), Gaps = 35/226 (15%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKW-YRRSRVLLNEFRHYNADVICLQEIDHIQFQ 169
           F +++YN L Q     K++  +   AL W YRRS+ L  +   Y++DV+CLQE++   F+
Sbjct: 537 FSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSK-LKEQILSYDSDVLCLQEVESKTFE 595

Query: 170 SFWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD---- 215
            +W     K GY G ++          ++S K  G  I ++RD F+ V K  +DF     
Sbjct: 596 DYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWM 655

Query: 216 -----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFG 270
                +     +      +NV L L L+             S    I + T+HL W P  
Sbjct: 656 KHKKFQRTEDYLNRAMNKDNVALFLKLQH-----------VSSGDTIWVVTTHLHWDPKF 704

Query: 271 TYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
              +T Q  ++L  +E  + + +   N    D+       CGDFNS
Sbjct: 705 NDVKTFQVGVLLDHLESLL-KEDTTHNSRQ-DIKKSPVLICGDFNS 748

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 95/229 (41%), Gaps = 39/229 (17%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F L++YN L       K++  +   AL W  R   L  +   ++ DVICLQE++ + ++ 
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE 513

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFDK---- 216
           +W     K  Y   +H          ++S K  G AI +++D FQ V +  IDF      
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 217 -----EVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGT 271
                     +      +NV L+  LK             +    + + T+HL W P   
Sbjct: 574 HKKFHRTEDYLNRAMNKDNVALIAELKH-----------LNTNENVWVVTTHLHWDPQFN 622

Query: 272 YERTRQCYIVLKKMEEFM---HRVNVLQNENDGDLSHWFPFFCGDFNSQ 317
             +T Q  ++L  +E  +   H VN     N+ D+       CGDFNSQ
Sbjct: 623 DVKTFQVGVMLDYLETLIKQHHHVN-----NNNDIKKIPMVICGDFNSQ 666

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 115/264 (43%), Gaps = 43/264 (16%)

Query: 86  DCPPELHFIK-RPFLSL-------HEEEPV-----------TGFRFKLMTYNCLAQALIR 126
           D  PE+  +  RPF+ L       HE E +           T   F +++YN L Q    
Sbjct: 390 DNRPEIPLVHDRPFVELDIDGEPKHEYESLQESSQGVDHELTKKSFTVLSYNTLCQHYAT 449

Query: 127 RKLFPDSGD-ALKW-YRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQ 184
            K++  +   AL W YRR++ L ++   Y+ D++CLQE++   F+ FW     K GY G 
Sbjct: 450 PKMYRYTPSWALSWEYRRAK-LRDQILSYSCDIMCLQEVEARTFEDFWLPLLEKHGYSGS 508

Query: 185 Y----------HRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLV 234
           +          HR+S K  G  + ++R  F+ + K  +DF      +   + T +     
Sbjct: 509 FHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKHEKFQRTED----F 564

Query: 235 LALKFSEKVLSNLGKASSKKSG--ILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRV 292
           L    ++  ++   K     SG  I + T+HL W P     +T Q  ++L  ++  + + 
Sbjct: 565 LNRAMNKDNIALYFKLQHIASGEHIWVATTHLHWDPKFNDVKTFQVGVLLDHLQTLIRQD 624

Query: 293 NVLQNENDGDLSHWFPFFCGDFNS 316
           N  Q+     +       CGDFNS
Sbjct: 625 NPRQDVKKAPV-----IICGDFNS 643

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 99/239 (41%), Gaps = 39/239 (16%)

Query: 102 HEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICL 160
           H  E +    F L++YN L Q     K++      AL W  R   L +E   Y  D+ICL
Sbjct: 388 HLNEELLKKSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICL 447

Query: 161 QEIDHIQFQSFWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKM 210
           QE++   ++ FW     K GY G +H          +++ K  G  I ++   F  V K 
Sbjct: 448 QEVESKTYEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKD 507

Query: 211 LIDFD---------KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILI 259
            IDF          +     +      +NV L++ L+              +++G  + +
Sbjct: 508 AIDFSSVWMKHKKFQRTEDYLNRAMNKDNVALIIKLR-------------HERTGEHVWV 554

Query: 260 GTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPF-FCGDFNSQ 317
            T+HL W P     +T Q  ++L  +E+ + +   + +  D       P   CGDFNSQ
Sbjct: 555 VTTHLHWDPHFNDVKTFQVAVMLDYIEKLLKQHGGVGSPQD---KKKIPLVICGDFNSQ 610

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 98/227 (43%), Gaps = 35/227 (15%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKW-YRRSRVLLNEFRHYNADVICLQEIDHIQFQ 169
           F L++YN L Q     K++  +   AL W YRR + L  +   + ADV+CLQE++   F+
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDK-LKEQIISFQADVVCLQEVECKTFE 457

Query: 170 SFWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD---- 215
            FW     K GY G +H          ++S K  G  + ++   F+ V K  +DF     
Sbjct: 458 DFWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWM 517

Query: 216 -----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFG 270
                +     +      +NV L + L+  +               I + T+HL W P  
Sbjct: 518 KHKKFQRTEDYLNRAMNKDNVALFVKLQHLK-----------TNEQIWVTTTHLHWDPQF 566

Query: 271 TYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317
              +T Q  ++L  ME+ +   N +   N+ ++       CGDFNSQ
Sbjct: 567 NDVKTFQVGVLLDYMEKLLRDQNGV--GNNQEMKKVPLVICGDFNSQ 611

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 96/238 (40%), Gaps = 37/238 (15%)

Query: 102 HEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICL 160
           H+        F +++YN L Q     K++  +   AL W  R   L  +   YN D++CL
Sbjct: 398 HQSRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCL 457

Query: 161 QEIDHIQFQSFWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKM 210
           QE++   ++ FW     + GY G +H          ++S K  G    ++   F+ + K 
Sbjct: 458 QEVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKE 517

Query: 211 LIDFD---------KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILI 259
            +DF          +     +      +NV LV+ L+               KSG  +  
Sbjct: 518 AVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQHI-------------KSGEHVWA 564

Query: 260 GTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317
            T+HL W P     +T Q  ++L  ME+ +   N   N    +L       CGDFNSQ
Sbjct: 565 ATTHLHWDPQFNDVKTFQVGVLLDYMEKVIKEQNNCNNTQ--ELKKVPVVICGDFNSQ 620

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 97/219 (44%), Gaps = 19/219 (8%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F L++YN L Q     K++  +   AL W  R   L  +  +Y+ D+ICLQE++   ++ 
Sbjct: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSG 220
           FW     + GY G +H          ++S K  G  + +R   F+ + K  +DF      
Sbjct: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529

Query: 221 NIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILIGTSHLFWHPFGTYERTRQC 278
           +   + T +     L    ++  ++ L K    KSG  +   T+HL W P     +T Q 
Sbjct: 530 HKKFQRTED----YLNRAMNKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQV 585

Query: 279 YIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317
            ++L  ME+ +   +   N    +L       CGDFNSQ
Sbjct: 586 GVLLDHMEKVIKEHSGYNNSQ--ELKKVPVIICGDFNSQ 622

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 95/227 (41%), Gaps = 40/227 (17%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F +++YN L Q     K++  +   AL W  R   L  +  ++N D+ICLQE++   F+ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD----- 215
           FW+    K GY G +H          ++S K  G    ++   F+ + K  +DF      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 216 ----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILIGTSHLFWHPF 269
               +     +      +NV +V+ L+  +             SG  + + T+HL W P 
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKLQHIQ-------------SGEIMWLVTTHLHWDPK 704

Query: 270 GTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
               +T Q  ++L  ME  +   N  Q     D+  +    CGD NS
Sbjct: 705 FNDVKTFQVGVLLDHMETLLKEQNPKQ-----DVKKYPLVICGDLNS 746

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 94/228 (41%), Gaps = 37/228 (16%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F L++YN L Q     K++      AL W  R   L  E   Y  DVICLQE++   ++ 
Sbjct: 445 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE 504

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD----- 215
           FW     K GY G +H          +++ K  G  I ++   F  + K  IDF      
Sbjct: 505 FWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMK 564

Query: 216 ----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILIGTSHLFWHPF 269
               +     +      +N+ L++ LK              + SG  + + T+HL W P 
Sbjct: 565 HKKFQRTEDYLNRAMNKDNIALIVKLK-------------HELSGEHVWVVTTHLHWDPH 611

Query: 270 GTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317
               +T Q  ++L  +E+ + + + + N  +          CGDFNSQ
Sbjct: 612 FNDVKTFQVGVLLDYIEKLLKQQSNIGNPQEKKKVPL--IICGDFNSQ 657

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 92/225 (40%), Gaps = 36/225 (16%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F +++YN L Q     K++  +   AL W  R   L  +   Y +D++CLQE++   F+ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD----- 215
           FW     K  Y+G +H          + S K  G  I +++  F+ + K  +DF      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 216 ----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGT 271
               +     +      +NV L + L           ++ +    + + T+HL W P   
Sbjct: 689 HKKFQRTEDYLNRAMNKDNVALYMKL-----------QSITSGETVWVVTTHLHWDPKFN 737

Query: 272 YERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
             +T Q  I+L  ME  +   N  Q+    ++       CGD NS
Sbjct: 738 DVKTFQVGILLDHMETLLKEENPKQDVKKANV-----VICGDLNS 777

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 96/226 (42%), Gaps = 35/226 (15%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKW-YRRSRVLLNEFRHYNADVICLQEIDHIQFQ 169
           F +++YN L Q     K++  +   AL W YRR++ L  +   Y++D++CLQE++   F+
Sbjct: 505 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNK-LKEQILSYDSDLLCLQEVESKTFE 563

Query: 170 SFWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD---- 215
            +W     K GY G +H          ++S K  G  I ++RD F+ + K  +DF     
Sbjct: 564 EYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWM 623

Query: 216 -----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFG 270
                +     +      +NV L L L+                  I   T+HL W P  
Sbjct: 624 KHKKFQRTEDYLNRAMNKDNVALFLKLQH-----------IPSGDTIWAVTTHLHWDPKF 672

Query: 271 TYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
              +T Q  ++L  +E  +       +    D+  +    CGDFNS
Sbjct: 673 NDVKTFQVGVLLDHLETLLKEET--SHNFRQDIKKFPVLICGDFNS 716

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 93/218 (42%), Gaps = 22/218 (10%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F +++YN L Q     K++  +   AL+W  R   L  +   Y  D++CLQE++   ++ 
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYED 525

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSG 220
           FW     K GY G +H          ++S K  G  + +++  F+ + K  +DF    SG
Sbjct: 526 FWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDF----SG 581

Query: 221 NIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILIGTSHLFWHPFGTYERTRQC 278
                         L    ++  ++   K    +SG  + + T+HL W P     +T Q 
Sbjct: 582 AWQKHKRFQRTEDYLNRAMNKDNVAIYMKLQHVQSGEYLWVVTTHLHWDPKFNDVKTFQV 641

Query: 279 YIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
            ++L  ME  +   N  Q     D+  +     GDFNS
Sbjct: 642 GVLLDHMESIIKEENPKQ-----DVKKFPIIITGDFNS 674

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 93/217 (42%), Gaps = 15/217 (6%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F +M+YN L Q     K++  +   AL W  R + L  E   Y  D++CLQE++   ++ 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSG 220
            W     K GY G +H          ++S K  G  + ++   F+   K  +DF      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 221 NIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYI 280
           +   + T + +   +  K +  +   L    S +S + I T+HL W P     +T Q  I
Sbjct: 644 HKKFQRTEDYLNRAMN-KDNVVIYIKLNHLKSGES-VWIATTHLHWDPQFNDVKTFQVGI 701

Query: 281 VLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317
           ++  +EE +       +  D   S      CGDFNSQ
Sbjct: 702 LMDHLEELIKEHGSPSSRQDPKKSPV--IICGDFNSQ 736

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 96/226 (42%), Gaps = 35/226 (15%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKW-YRRSRVLLNEFRHYNADVICLQEIDHIQFQ 169
           F +++YN L Q     K++  +   AL W YRR++ L  +   Y++D++CLQE++   F+
Sbjct: 507 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNK-LKEQILSYDSDLLCLQEVESKTFE 565

Query: 170 SFWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD---- 215
            +W     K GY G +H          ++S K  G  I +++D F+ + K  +DF     
Sbjct: 566 DYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWM 625

Query: 216 -----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFG 270
                +     +      +NV L L L+                  I   T+HL W P  
Sbjct: 626 KHKKFQRTEDYLNRAMNKDNVALFLKLQHIP-----------SGDTIWAVTTHLHWDPKF 674

Query: 271 TYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
              +T Q  ++L  +E  + R     N    D+       CGDFNS
Sbjct: 675 NDVKTFQVGVLLDHLETLL-REETTHNFRQ-DIKKSPVLICGDFNS 718

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 109/273 (39%), Gaps = 56/273 (20%)

Query: 86  DCPPELHFIK-RPFLSLHEE-EPVTGFR-----------------FKLMTYNCLAQALIR 126
           D  PE+   K R F+ ++ E EPV  +R                 F +++YN L Q    
Sbjct: 419 DNRPEVPLNKDRDFIEINAEGEPVEKYRSLHEADEHLSSELSKRSFTVLSYNTLCQHYAT 478

Query: 127 RKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQY 185
            K++  +   AL W  R   L  +   Y  DVICLQE++   F+ +W     K GY G +
Sbjct: 479 PKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEEYWAPLMQKHGYSGLF 538

Query: 186 H----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD---------KEVSGNIPTRT 226
           H          ++S K  G  + +R + F+   K  +DF          +     +    
Sbjct: 539 HAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQKHKKFQRTEDYLNRAM 598

Query: 227 TTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILIGTSHLFWHPFGTYERTRQCYIVLKK 284
             +NV + L L+               KSG  + I T+HL W P     +T Q  +++  
Sbjct: 599 NKDNVAIYLKLQHI-------------KSGESVWIVTTHLHWDPQFNDVKTFQVGVLMDH 645

Query: 285 MEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317
           +E  +   +  Q++ +          CGD NS+
Sbjct: 646 IENLLKEQSNAQSKQEAKKCPV--ILCGDLNSE 676

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 109/270 (40%), Gaps = 55/270 (20%)

Query: 86  DCPPELHFIK-RPFLSLHEE-EPVTGF-----------------RFKLMTYNCLAQALIR 126
           D  PE+  IK R F+ +  E EPV  +                  F L++YN L Q    
Sbjct: 481 DNRPEIPLIKDRKFIEIDTEGEPVREYDSLKLADANGNPDLEKKSFTLLSYNTLCQHYAT 540

Query: 127 RKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQY 185
            K++  +   AL W  R   L ++   Y +D++CLQE++   F+ FW     K  Y+G +
Sbjct: 541 PKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEFWSPLLEKYDYQGIF 600

Query: 186 H----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD---------KEVSGNIPTRT 226
           H          ++S K  G  I +++  F+ + K  +DF          +     +    
Sbjct: 601 HIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMKHKKFQRTEDYLNRAM 660

Query: 227 TTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKME 286
             +NV L L L           ++ +    + + T+HL W P     +T Q  I+L  ME
Sbjct: 661 NKDNVALYLKL-----------QSLTSGESVWVVTTHLHWDPKFNDVKTFQVGILLDHME 709

Query: 287 EFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
             +   N  Q+    ++       CGD NS
Sbjct: 710 ALLKEENPKQDVKKANV-----VICGDLNS 734

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 110/244 (45%), Gaps = 51/244 (20%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNE-FRHYNADVICLQEIDHIQF 168
           RF ++TYN L+   +  +++    D  K W  R R+L +E F  Y +D+ICLQE+    +
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 169 QSFWKEE-FSKLGYEGQYHRNSTKNH---------GVAIIWRRDMFQ-------QVDKML 211
             FWK++  +++ Y   +   +   +         GV I +  D F+        ++ ++
Sbjct: 93  NEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 212 IDFDKE-----VSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSK------------K 254
             FD++        NI   T TN  G V+     E  L N+ KA ++            K
Sbjct: 153 GTFDQQELHYLTHHNI---TLTNGAGDVIG----EDSLYNVAKARNQVCLFVMLRHRESK 205

Query: 255 SGILIGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCG 312
           S I++  +HL+W     Y+  +  QC I+++K++  +    +L        S+    F G
Sbjct: 206 SIIVVINTHLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKILFSG 259

Query: 313 DFNS 316
           DFNS
Sbjct: 260 DFNS 263

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 94/227 (41%), Gaps = 37/227 (16%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170
           F +++YN L Q     K++  +   AL W  R   L ++   + +DVICLQE++   ++ 
Sbjct: 452 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE 511

Query: 171 FWKEEFSKLGYEGQYH----------RNSTKNHGVAIIWRRDMFQQVDKMLIDFD----- 215
           FW     K GY G ++          ++S K  G  I ++   F  + K  +DF      
Sbjct: 512 FWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMK 571

Query: 216 ----KEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG--ILIGTSHLFWHPF 269
               +     +      +NV L + L+               KSG  + + T+HL W P 
Sbjct: 572 HKKFQRTEDYLNRAMNKDNVALYMKLEHI-------------KSGESVWVVTTHLHWDPQ 618

Query: 270 GTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
               +T Q  I+L  +EE +   N   ++   ++       CGD NS
Sbjct: 619 FNDVKTFQVGILLDHLEELLKDNNNASSKQ--EIRKCPVIICGDLNS 663

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 107/259 (41%), Gaps = 43/259 (16%)

Query: 83  IDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGD-ALKWYR 141
           I+ D  P+  +      + H    +    F +++YN L Q     K++  +   AL W  
Sbjct: 535 INTDGEPQTEYDSIEDATSHLSRDLEKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWEY 594

Query: 142 RSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYH----------RNSTK 191
           R   L ++   + +D++CLQE++   +  FW+    K GY+G +H          ++S K
Sbjct: 595 RRDKLKDQILSFKSDILCLQEVESRTYDDFWEPLLQKHGYKGIFHAKTRAKTMQTKDSKK 654

Query: 192 NHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKAS 251
             G  I ++   F+ + K  +DF                 G+ +  K  ++    L +A 
Sbjct: 655 VDGCCIFYKESEFKVLFKEAVDFS----------------GIWMKHKNFQRTEDYLNRAM 698

Query: 252 SK------------KSGIL--IGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQN 297
           +K            KSG +  I T+HL W P     +T Q  ++L  +E  +   + + +
Sbjct: 699 NKDNVAIYMKLQHIKSGEVTWIVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKEHSNIHS 758

Query: 298 ENDGDLSHWFPFFCGDFNS 316
           +   D+       CGD NS
Sbjct: 759 KQ--DVKKCPIIICGDLNS 775

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 100/254 (39%), Gaps = 33/254 (12%)

Query: 83  IDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGD-ALKWYR 141
           I+ D  P+  F        H    +    F +++YN L Q     K++  +    L W  
Sbjct: 511 INADEEPQEEFDTMALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDT 570

Query: 142 RSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYH----------RNSTK 191
           R   L N+     +DVICLQE++   ++ FW     K GY G +H          ++S K
Sbjct: 571 RREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKK 630

Query: 192 NHGVAIIWRRDMFQQVDKMLIDFD---------KEVSGNIPTRTTTNNVGLVLALKFSEK 242
             G  I ++   F+   +  +DF          +     +      +NV L + L+    
Sbjct: 631 VDGCCIFYKESEFKLQHQESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVKLEH--- 687

Query: 243 VLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGD 302
              N G++      + + T+HL W P     +T Q  ++L  +E  +   N   ++   +
Sbjct: 688 --INSGES------VWVVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYNNASSKQ--E 737

Query: 303 LSHWFPFFCGDFNS 316
           +       CGD NS
Sbjct: 738 IRKCPVIICGDLNS 751

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 103/237 (43%), Gaps = 38/237 (16%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFRH-YNADVICLQEIDHIQF 168
           RF L+TYN L+   +  +++    +  K W  R ++L  E  H Y+AD++CLQE+    +
Sbjct: 41  RFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLLEYELFHKYHADILCLQELTGKDY 100

Query: 169 QSFWKEEFS-KLGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEV 218
           + FW+++   ++ +E QY          R+  +  GV   +  D F+ V   L      +
Sbjct: 101 EKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGVGTFYNADKFEHVATDLEYLSDTL 160

Query: 219 SGNIPTRT---------TTNNVGLVLALKFSEKVLSNLGKAS------SKKSGIL--IGT 261
               PT            T+  G V+  +  + VL+   +         K +G L  +  
Sbjct: 161 GVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQRNQVCLFVTLLHKPTGSLFVVVN 220

Query: 262 SHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
           + L+W     Y+  +  QC+I++++++  + R   L    D   S+      GD NS
Sbjct: 221 TQLYWK----YDEVKLAQCFIIMRRLKAIVKR---LLTRKDTSYSNIKVLLSGDLNS 270

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 108/237 (45%), Gaps = 42/237 (17%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNE-FRHYNADVICLQEIDHIQFQ 169
           F L+TYN L+Q+ +  +++       K W  R ++L  E  + YNAD+ICLQE+    ++
Sbjct: 22  FTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYE 81

Query: 170 SFWKEEFSKLGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDK--------MLI 212
            +W+++ SK      +          + +    GV I +  DMF+ +D         ++ 
Sbjct: 82  YYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLIS 141

Query: 213 DFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASS---------KKSGI--LIGT 261
           DF++     + +R      G    +K S  +L  L + +          K++G   ++ T
Sbjct: 142 DFEQPELDYLASRKLVLTDGEGRQIKVSN-ILDVLEEKNQVCLFMTLKHKRTGATVVVVT 200

Query: 262 SHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
           +HL+W     Y+  +  QC I+++++ + M      Q + DG  S     F GD NS
Sbjct: 201 THLYWK----YDEIKLTQCMIIMRQLSKIMKD----QLKKDGS-SFVKVLFAGDLNS 248

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 105/241 (43%), Gaps = 45/241 (18%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFR-HYNADVICLQEIDHIQF 168
           RF L+TYN L+ A +  +++    +  K W  R  +L  E    Y AD++C+QE+    +
Sbjct: 38  RFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDY 97

Query: 169 QSFWK----------EEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQV-------DKML 211
           Q FW            EF        + R   +  GVAI + R MF  V       ++ML
Sbjct: 98  QQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQML 157

Query: 212 IDF-DKEV-------------SGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGI 257
             F D E+             +GN PT  T  N+   L LK    +  +L   S+    +
Sbjct: 158 DAFNDHELEYLGQKKLGLTDGAGN-PTGET--NLLNFLKLKNQVSLFVSLQHKSTGMYFV 214

Query: 258 LIGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFN 315
           +I T HL+W     Y+  +  QC ++++++ + +   ++L++  D         F GD N
Sbjct: 215 VINT-HLYWK----YDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLN 267

Query: 316 S 316
           S
Sbjct: 268 S 268

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 101/241 (41%), Gaps = 38/241 (15%)

Query: 107 VTGFRFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEF-RHYNADVICLQEID 164
           + G +F L+TYN L+   +  +++    D  K W  R  +L +E  R Y ADV+CLQE+ 
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELT 91

Query: 165 HIQFQSFWKEEFSK-LGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLIDF 214
              + S+WK  F K L Y  ++          +   +  G  I +  D F+ +    +  
Sbjct: 92  WEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFL 151

Query: 215 DKEVSG------NIPTRTT---TNNVGLVLALKFSEKVLSNLG--------KASSKKSGI 257
           +  V+       N   R     T+  G  +  +   ++L N          K     +  
Sbjct: 152 NDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKETNNVF 211

Query: 258 LIGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFN 315
           ++  +HL+W     Y+  +  QC I+++K+ +    +N L    D  LS    F  GD N
Sbjct: 212 VVINTHLYWK----YDEVKLTQCMIIMRKLSQI---INELLIGADPSLSKDVIFITGDLN 264

Query: 316 S 316
           S
Sbjct: 265 S 265

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 101/245 (41%), Gaps = 44/245 (17%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFRH-YNADVICLQEIDHIQFQ 169
           F  MTYN L+   +  +++    +  K W  R R+L  E  + Y AD++C+QE+    + 
Sbjct: 34  FTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYD 93

Query: 170 SFWKEEF-SKLGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVS 219
            FWK  F SK+ Y   +          R   +  GV I +  D F+ +    I  +  + 
Sbjct: 94  GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIG 153

Query: 220 -GNIP--------TRTTTNNVGL---------VLALKFSEKVLSNLGKASSKKSGILIGT 261
             NI           T TN  G          VL  +    +  +L    ++   ++I T
Sbjct: 154 LFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVINT 213

Query: 262 SHLFWHPFGTYERTR--QCYIVLKKMEEFMHRV--NVLQNENDGDLSHWFPFFCGDFNSQ 317
            HL+W     Y+  +  QC  +++K    +HRV  ++L        S     F GD NS 
Sbjct: 214 -HLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGREGVTYSKVKILFAGDLNSA 264

Query: 318 PFDTP 322
           P D+P
Sbjct: 265 P-DSP 268

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 101/244 (41%), Gaps = 42/244 (17%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFRH-YNADVICLQEIDHIQFQ 169
           F LMTYN L+   +  +++    +  K W  R R+L  E  + Y AD++C+QE+    ++
Sbjct: 30  FTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYE 89

Query: 170 SFWKEEF-SKLGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVS 219
            FWK  F +K+ Y   Y          R   +  GV I +  + F+ +    I  +  + 
Sbjct: 90  GFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIG 149

Query: 220 -GNIP--------TRTTTNNVGLVLALKFSEKVLSNLGKAS--------SKKSGILIGTS 262
             NI           T TN  G  +       VL    + S          ++  ++  +
Sbjct: 150 LFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVNT 209

Query: 263 HLFWHPFGTYERTR--QCYIVLKKMEEFMHRV--NVLQNENDGDLSHWFPFFCGDFNSQP 318
           HL+W     Y+  +  QC  +++K    +HRV  ++L        S     F GD NS P
Sbjct: 210 HLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGMEGVTYSKVKILFAGDLNSAP 261

Query: 319 FDTP 322
            D+P
Sbjct: 262 -DSP 264

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 100/245 (40%), Gaps = 39/245 (15%)

Query: 105 EPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNE-FRHYNADVICLQE 162
           +P    +F L+TYN L+   +  +++    +  K W  R R+L +E F+ Y AD++CLQE
Sbjct: 23  KPFFNNKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQE 82

Query: 163 IDHIQFQSFWKEEFSK-LGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLI 212
           +    + +FW ++  + L Y   +          R + +  GV I +  D F+ +    I
Sbjct: 83  LTTKDYHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI 142

Query: 213 DFDKEVSGNIPTR----------TTTNNVGLVLALKFSEKVLSNLGKAS--------SKK 254
            +  +V G    R          T TN  G  +       +L    +             
Sbjct: 143 -YLNDVLGIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTN 201

Query: 255 SGILIGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCG 312
           +  ++  +HL+W     Y+  +  QC  +++K+E  +   ++L        S     F G
Sbjct: 202 TVFVVINTHLYWK----YDEVKLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKILFSG 255

Query: 313 DFNSQ 317
           D NS 
Sbjct: 256 DLNSN 260

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 108/259 (41%), Gaps = 41/259 (15%)

Query: 94  IKRPFLSLHEEEPVTGF------RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVL 146
           ++ P LS+  ++P           F  ++YN L+   +  +++       K W  R  +L
Sbjct: 20  VRGPSLSIPIQQPHQTLPAAKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLL 79

Query: 147 LNE-FRHYNADVICLQEIDHIQFQSFWKEEFSK-LGYEGQYHRNSTKNH---------GV 195
             E    Y +D++C+QE+  I + SFW++   K   Y  ++   +  N+         GV
Sbjct: 80  EKEILDKYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGV 139

Query: 196 AIIWRRDMFQQVDKMLID-------FDKEVSGNIPTR--TTTNNVGLV--------LALK 238
            I +  DMF  +    I+       FD++    +  +  T  N  G V        LAL 
Sbjct: 140 GIFYNLDMFDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALS 199

Query: 239 FSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQ 296
            ++  L  + +    K   +I  +HL+W     YE  +  QC I+++K+ + ++ +    
Sbjct: 200 KNQVCLFVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNELLFNA 255

Query: 297 NENDGDLSHWFPFFCGDFN 315
              D + +     F GD N
Sbjct: 256 ESRDMNYNKVKILFSGDLN 274

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 102/248 (41%), Gaps = 59/248 (23%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNE-FRHYNADVICLQEIDHIQF 168
           +F  MTYN L+   +  +++    D  K W  R ++L  E    Y AD++CLQE+    +
Sbjct: 28  KFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDY 87

Query: 169 QSFWKEEFSKLGYEG---------QYHRNSTKN-HGVAIIWRRDMFQQVDKMLI------ 212
             +W+E   +  + G         QY +   K+  GV I +  + F  +    I      
Sbjct: 88  HQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLI 147

Query: 213 ---DFD-------KEV-----SGN-------IPTRTTTNNVGLVLALKFSEKVLSNLGKA 250
              D D       K+V     +GN       +    + N VGL +ALK  +         
Sbjct: 148 GSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKD--------- 198

Query: 251 SSKKSGILIGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFP 308
               +  ++  +HL+W     Y+  +  QC I+++K+ + +   ++L  E+    +    
Sbjct: 199 --TNTIFVVINTHLYW----KYDEVKLTQCLIIMRKLAKIIR--DLLVGEHGTTYNKMKV 250

Query: 309 FFCGDFNS 316
            F GD NS
Sbjct: 251 VFAGDLNS 258

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 105/238 (44%), Gaps = 41/238 (17%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFR-HYNADVICLQEIDHIQFQ 169
           F L++YN L+ + +  +++    +  K W  R ++L  E    Y AD++CLQE+    + 
Sbjct: 22  FTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS 81

Query: 170 SFWKEEF-SKLGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEV- 218
           +FWK+   + + Y   Y          R   +  GV I +  D F+ + +  I  ++ + 
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLG 141

Query: 219 --SGN----------IPTRTTTNNVG---LVLALKFSEKVLSNLGKASSKKSG--ILIGT 261
             S N            T    N VG   L+  LK S+  ++       K++G   ++  
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILK-SKNQVALFVSLKHKETGNVFVVIN 200

Query: 262 SHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNV-LQNENDGDLSHWFPFFCGDFNS 316
           +HL+W     Y+  +  QC I+++++   + +  V L+N  D  +      F GD NS
Sbjct: 201 THLYW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTDDKIK---ILFTGDLNS 251

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 104/244 (42%), Gaps = 51/244 (20%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFRH-YNADVICLQEIDHIQF 168
           +  ++TYN L+   +  +++    D  K W  R ++L  E    Y AD++CLQE+  + +
Sbjct: 21  KLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDY 80

Query: 169 QSFW-KEEFSKLGYEGQY---------HRNSTKNHGVAI--------------IWRRDMF 204
           Q +W K    K  Y  +Y          R+ ++  GV +              I+  D+F
Sbjct: 81  QQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLF 140

Query: 205 QQVD---------KMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLG-KASSKK 254
              D         KML   D +  GN   + T ++V     LK   +V   +  +  +  
Sbjct: 141 GTFDLKEQNYLEHKMLQLTDGQ--GNPMEKMTLSDV-----LKGRNQVCMFVSLRHKATN 193

Query: 255 SGILIGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCG 312
           + +++  +HL+W     Y+  +  QC I+++++ + +   ++L    D   +     F G
Sbjct: 194 TFLIVINTHLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTTYNKVKIIFAG 247

Query: 313 DFNS 316
           D NS
Sbjct: 248 DMNS 251

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 102/243 (41%), Gaps = 43/243 (17%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEF-RHYNADVICLQEIDHIQF 168
           +F ++TYN L+   +  +++    D  K W  R ++L  E  + Y AD++CLQE+    +
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 169 QSFWKEEFS-KLGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEV 218
            S+WK + + K+ Y  ++          +   +  G  I + ++ F+ +    + F  +V
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKL-FLNDV 165

Query: 219 SGNIPTR-------------------TTTNNVGLVLALKFSEKVLSNLGKASSKKSGILI 259
            G                        T TNN+  V   +    +  +L   ++    ++I
Sbjct: 166 VGTFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKATNTVFVVI 225

Query: 260 GTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFP----FFCGD 313
            T HL+W     Y+  +  QC I+++K+   ++ + +  N    D S         F GD
Sbjct: 226 NT-HLYWK----YDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKIIFSGD 280

Query: 314 FNS 316
            NS
Sbjct: 281 LNS 283

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 107/237 (45%), Gaps = 40/237 (16%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-W-YRRSRVLLNEFRHYNADVICLQEIDHIQF 168
           +F +++YN L+ + +  +++    D  K W YR + + L     Y AD++C+QE+    +
Sbjct: 29  KFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 169 QSFWKEEF-SKLGYEGQYHRNSTKNH---------GVAIIWRRDMFQ-------QVDKML 211
             +W+ +  + +GY  ++   S   +         GVAI +    F         +++ L
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 212 IDFDKEVSGNIPTRT--TTNNVGLVLALKFSEKVLSNLGKAS------SKKSG--ILIGT 261
             F+ E    +  +T   T+  G+ +  K   ++LS   + S       K++G   +I  
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIIN 208

Query: 262 SHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
           +HL+W     Y+  +  QC I+++++ + +    +LQ+     +      F GD NS
Sbjct: 209 THLYWK----YDEVKLSQCIIIMRELSKIIDE--LLQDVRHSKVK---IIFAGDLNS 256

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 102/237 (43%), Gaps = 38/237 (16%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFRH-YNADVICLQEIDHIQF 168
           RF L+TYN L+ + +  +++    +  K W  R ++L  E  + + AD++CLQE+    +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDY 85

Query: 169 QSFWKEEFS-KLGYEGQYHRNSTKNH---------GVAIIWRRDMFQQVDKMLIDFDKEV 218
           + +W +     + Y  ++   +   +         GV+I +  D F  +    I  ++ +
Sbjct: 86  EDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLNQLL 145

Query: 219 S-------------GNIPTRTTTNNVG---LVLALKFSEKVLSNLG-KASSKKSGILIGT 261
           +               I T   +N VG   L+  LK   +V   +  K     +  ++  
Sbjct: 146 NVFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKETDTIFVVLN 205

Query: 262 SHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
           +HL+W     Y+  +  QC I+++++ + + ++     +  G +      F GD NS
Sbjct: 206 THLYWK----YDEVKLTQCMIIMRELSKIIEQLLPGDAKGRGKVK---ILFTGDLNS 255

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 101/237 (42%), Gaps = 39/237 (16%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFR-HYNADVICLQEIDHIQF 168
           +F L+TYN L+ + +  +++    D  K W  R ++L +E    Y AD++CLQE+    +
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 169 QSFWKEEF-SKLGYEGQY---------HRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEV 218
              WK    S +GY  ++          R   +  GV I +    F  +    I  ++ +
Sbjct: 89  NENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 219 SGNIPTR---------TTTNNVGLVLALKFSEKVLSNLGKA------SSKKSG--ILIGT 261
           +    T            T+  G+ +  K    V+S   +         K++G   ++  
Sbjct: 149 NVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKETGEMFVVIN 208

Query: 262 SHLFWHPFGTYERTR--QCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316
           +HL+W     Y+  +  QC I+++++ + +  + V   ++ G +      F GD NS
Sbjct: 209 THLYWK----YDEVKLTQCMIIMRELSKIIDEL-VKGVDDPGKVK---ILFTGDLNS 257

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 98/216 (45%), Gaps = 41/216 (18%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFRH-YNADVICLQEIDHIQF 168
           RF L+TYN L+ + +  +++    +  K W  R ++L  E  + + AD++CLQE+    +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDY 85

Query: 169 QSFWKEEFS-KLGYEG--------QYHRNSTKNH-GVAIIWRRDMFQQVDKMLID----- 213
           + +W++     + Y          +Y +N  K+  GV+I +  + F  +    I      
Sbjct: 86  EDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQLL 145

Query: 214 -----------FDKEVSGNIPTRTTTNNVG---LVLALKFSEKVLSNLG-KASSKKSGIL 258
                      F+K+V+    T   +N VG   L+  LK   +V   +  K     +  +
Sbjct: 146 NVFNERELKYLFNKKVT---LTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFV 202

Query: 259 IGTSHLFWHPFGTYERTR--QCYIVLKKMEEFMHRV 292
           +  +HL+W     Y+  +  QC I+++++ + + ++
Sbjct: 203 VLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQL 234

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEFRH-YNADVICLQEIDHIQF 168
           RF L+TYN L+ + +  +++    +  K W  R R+L  E  + + AD++CLQE+    +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDY 85

Query: 169 QSFWKEEFS 177
           + +W +   
Sbjct: 86  EDYWHDSIG 94

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 85/212 (40%), Gaps = 35/212 (16%)

Query: 112 FKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNE-FRHYNADVICLQEIDHIQFQ 169
             ++TYN L+   +  +++    D  K W  R ++L  E F  + AD++CLQE+    + 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 170 SFWKEEFS-KLGYEGQYHRNSTKNHGVA-----------------------IIWRRDMFQ 205
            FW+++   +L Y   +       +  A                       +I+  D   
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 206 QVDKMLIDFDKE---VSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTS 262
              K  +D+         N      T    L + L  ++  L    +    KS I++  +
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKDTKSLIVVVNT 209

Query: 263 HLFWHPFGTYERTR--QCYIVLKKMEEFMHRV 292
           HL+W     Y+  +  QC  +++K+++ ++++
Sbjct: 210 HLYWK----YDEVKLSQCLTIMRKLKQVINKL 237

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 111 RFKLMTYNCLAQALIRRKLFPDSGDALK-WYRRSRVLLNEF-RHYNADVICLQEIDHIQF 168
           RF L+TYN L+ + +  +++    +  K W  R ++L  E    + AD++CLQE+    +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDY 85

Query: 169 QSFW 172
           +++W
Sbjct: 86  ENYW 89

>SAKL0H06578g Chr8 (580650..582029) [1380 bp, 459 aa] {ON} similar
           to uniprot|Q08650 Saccharomyces cerevisiae YOR245C DGA1
           Diacylglycerol acyltransferase catalyzes the terminal
           step of triacylglycerol (TAG) formation acylates
           diacylglycerol using acyl-CoA as an acyl donor localized
           to lipid particles
          Length = 459

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 241 EKVLSNLGKAS---SKKSGIL---IGTSHLFWHPFGTYERTRQCYIVLKKME-EFMHRVN 293
           E +LS +G A     K+ G +   + T ++   P  ++  T  CY +LK  E  ++HR+ 
Sbjct: 313 ESLLSKIGSADLVLKKRKGFIKLALETGNVGLVPCYSFGET-DCYNILKTTERSYLHRLQ 371

Query: 294 VLQNENDGDLSHWF---PFFCGDFNSQPFDTPYLSMTCKPVHYEKR 336
           +   EN G     F     F  DF   PF  P   +  +P++ EK+
Sbjct: 372 LWVKENYGFTIPLFFARGLFNYDFGLVPFRKPINIVVGRPIYVEKK 417

>Kpol_1072.3 s1072 complement(6129..7157) [1029 bp, 342 aa] {ON}
           complement(6129..7157) [1029 nt, 343 aa]
          Length = 342

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 433 EISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKF-RGFLRMPPG 486
           EI N  N  +     +F ++ + +  +CQE + + DF     IK  RGF R P G
Sbjct: 273 EIDNVINEVKS---KIFEVEHYIIEESCQEPEIITDFNNKKRIKTGRGFFRKPKG 324

>TDEL0A06210 Chr1 complement(1086334..1087695) [1362 bp, 453 aa]
           {ON} Anc_8.675 YOR245C
          Length = 453

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 4/63 (6%)

Query: 278 CYIVLKKME-EFMHRVNVLQNENDGDLSHWF---PFFCGDFNSQPFDTPYLSMTCKPVHY 333
           CY ++   E  F H+V +   +N G     F     F  DF   PF TP   +T  P++ 
Sbjct: 349 CYNIVHTSENSFSHKVQLWMKKNYGFTIPIFYARGLFNYDFGFLPFRTPITVLTGNPIYV 408

Query: 334 EKR 336
           EK+
Sbjct: 409 EKK 411

>Smik_2.78 Chr2 (140971..144048) [3078 bp, 1025 aa] {ON} YBL037W
            (REAL)
          Length = 1025

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query: 154  NADVICLQEIDHIQFQSFWKEEFSKLGYEGQY-------HRNSTKNHGVAI--------- 197
            N++V     ++  QF S WK     LG +G+Y       +++S K   + +         
Sbjct: 893  NSEVNPSMHLNLAQFISRWKTLSDALGKDGEYQKSGIKFNKDSKKAETIGLEDGLLLLTQ 952

Query: 198  IWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNL 247
            I +R  F  VD+  +     VSG I T+ T  N G ++ +++ E  L+N+
Sbjct: 953  IVKRLGFDIVDQTSVHSTLFVSGIIHTK-TEGNFGCLMKIQYQENGLANV 1001

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,262,645
Number of extensions: 2411590
Number of successful extensions: 5816
Number of sequences better than 10.0: 78
Number of HSP's gapped: 5772
Number of HSP's successfully gapped: 78
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)