Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4748.849ON60258731160.0
Skud_13.4578.849ON60258726530.0
Smik_13.5008.849ON60258725700.0
YMR284W (YKU70)8.849ON60258725610.0
NCAS0C003208.849ON60857417100.0
TDEL0B001808.849ON58258016780.0
ZYRO0C14850g8.849ON59456416310.0
NDAI0K003608.849ON62058416250.0
KAFR0L019508.849ON58857415690.0
Kwal_27.101998.849ON57256415010.0
TPHA0I003108.849ON60857314720.0
SAKL0D01188g8.849ON58155714410.0
KLTH0C03586g8.849ON57856014100.0
CAGL0I02662g8.849ON60657213950.0
KLLA0C06226g8.849ON59256113770.0
TBLA0B028908.849ON64861313820.0
KNAG0M02650singletonON57456513650.0
Kpol_1068.18.849ON51447813241e-177
AFR443CsingletonON57657010311e-132
Ecym_46208.849ON5975659051e-113
ABL117C8.849ON6025856952e-82
NCAS0F014802.444ON625214880.049
YMR094W (CTF13)2.467ON478111860.082
TBLA0B090202.444ON681179820.26
YMR106C (YKU80)2.444ON629480800.46
ZYRO0B05742g3.126ON1204247761.7
Ecym_54212.165ON745143751.8
TPHA0G024602.444ON626108742.5
TPHA0M009703.257ON1004100742.7
Smik_13.2782.467ON501111733.1
CAGL0A00803g4.128ON1162209706.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.474
         (602 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...  1204   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...  1026   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   994   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   991   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   663   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   650   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   632   0.0  
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     630   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   608   0.0  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   582   0.0  
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   571   0.0  
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   559   0.0  
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   547   0.0  
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   541   0.0  
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   535   0.0  
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   536   0.0  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   530   0.0  
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   514   e-177
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   401   e-132
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   353   e-113
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   272   2e-82
NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {O...    39   0.049
YMR094W Chr13 (455825..457261) [1437 bp, 478 aa] {ON}  CTF13Subu...    38   0.082
TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa] ...    36   0.26 
YMR106C Chr13 complement(478301..480190) [1890 bp, 629 aa] {ON} ...    35   0.46 
ZYRO0B05742g Chr2 complement(452478..456092) [3615 bp, 1204 aa] ...    34   1.7  
Ecym_5421 Chr5 (866187..868424) [2238 bp, 745 aa] {ON} similar t...    33   1.8  
TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.4...    33   2.5  
TPHA0M00970 Chr13 complement(186308..189322) [3015 bp, 1004 aa] ...    33   2.7  
Smik_13.278 Chr13 (439652..441157) [1506 bp, 501 aa] {ON} YMR094...    33   3.1  
CAGL0A00803g Chr1 complement(81425..84913) [3489 bp, 1162 aa] {O...    32   6.8  

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/587 (100%), Positives = 587/587 (100%)

Query: 1   MQSPTHGFNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILE 60
           MQSPTHGFNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILE
Sbjct: 1   MQSPTHGFNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSS 120
           SLNELMSQLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSS
Sbjct: 61  SLNELMSQLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSS 120

Query: 121 GRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQES 180
           GRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQES
Sbjct: 121 GRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQES 180

Query: 181 QDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEF 240
           QDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEF
Sbjct: 181 QDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEF 240

Query: 241 DGPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYK 300
           DGPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYK
Sbjct: 241 DGPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKD 360
           LVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKD
Sbjct: 301 LVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKD 360

Query: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420
           GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK
Sbjct: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420

Query: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480
           LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI
Sbjct: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480

Query: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540
           SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD
Sbjct: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587
           SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV
Sbjct: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/587 (82%), Positives = 540/587 (91%)

Query: 1   MQSPTHGFNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILE 60
           MQ+ ++ F  IG  ND+ +DA YRKFDIHEGILFC+ELS +MFKES EL+YKSPLLEILE
Sbjct: 1   MQASSNAFGGIGELNDVMDDAGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSS 120
           SLNELMSQLVITRPGT+IGCYFYYC RDDAK+GI+E  PLRDINA FMK LNDLLED+SS
Sbjct: 61  SLNELMSQLVITRPGTAIGCYFYYCSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSS 120

Query: 121 GRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQES 180
           GR+TL+EYFNFQ +EKQ QMPLG LFTFMLDTFLQDIPGQ+QLSSKK+FLFTDND PQE+
Sbjct: 121 GRMTLYEYFNFQPTEKQRQMPLGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEA 180

Query: 181 QDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEF 240
           QD D+RARLR LTIDLFDNKVNF+TFFIGY N SFDNEFYSDILQLGSH NKGV L+SEF
Sbjct: 181 QDTDDRARLRSLTIDLFDNKVNFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEF 240

Query: 241 DGPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYK 300
           DGPNTKPI+AKYIKSKILRKKE+KRI FQCPL+F E+ +F +GVKGYTM+SHEKAGVRYK
Sbjct: 241 DGPNTKPINAKYIKSKILRKKEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKD 360
           LVYEHED+R+EA+SKRKFLNP TG DVT STVKVYPYGDLDIN SE QNQ++MEAYTQKD
Sbjct: 301 LVYEHEDVRREAFSKRKFLNPMTGEDVTSSTVKVYPYGDLDINFSENQNQIVMEAYTQKD 360

Query: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420
            FLRIIGFRS + +IHYFNNIEKS FIVPDEAKYEGS+RTL SL KTLRKKDK+AI+WGK
Sbjct: 361 AFLRIIGFRSSSKAIHYFNNIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGK 420

Query: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480
           LK+NSH SLFVLSPSSI+EYNEGFYLYR+PFLDEIRKFPSLLSYD+GEK++L+Y+NMK+I
Sbjct: 421 LKTNSHASLFVLSPSSIKEYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKI 480

Query: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540
           +Q+IMGYFNL+DGYNPSDF+NPSLQ+HFKVLHDYLLQIE   E NET +A++NR+IHEDD
Sbjct: 481 TQNIMGYFNLKDGYNPSDFRNPSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587
           SLRKLYHIRNKIL+SEKSEDPAIQRLNKYVKIWN FYNKFNDD+ISV
Sbjct: 541 SLRKLYHIRNKILDSEKSEDPAIQRLNKYVKIWNVFYNKFNDDSISV 587

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/587 (80%), Positives = 531/587 (90%)

Query: 1   MQSPTHGFNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILE 60
           MQS  + F S   FN+  ++  YRKFD+HEGILFC+ELS +MFKES EL+YKSPLLEILE
Sbjct: 1   MQSINNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSS 120
           SLNELMSQLVITRPGT+IGCYFYYC RDDAKEGIYELFPLRDIN +FMK LNDLLED+SS
Sbjct: 61  SLNELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSS 120

Query: 121 GRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQES 180
            R+TL+EYFNFQ +E Q QMPL  LFTF+LDTFLQD  GQKQL++K++FLFTDNDKPQE+
Sbjct: 121 ERVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEA 180

Query: 181 QDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEF 240
           Q+AD+RARLRRLT+DLFDNK+NF TFFIGY NNSFDNEFYSDILQLGSHKNK + L+SEF
Sbjct: 181 QNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF 240

Query: 241 DGPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYK 300
           DGPNTKPIDAKYIKS+ILRK+EVKRI FQC LIFDE T+FIIG+KGYTM+SHEKAGVRYK
Sbjct: 241 DGPNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKD 360
           LVYEHEDIRQEAYSKRKFLN  +G DVT +TVKVYPYGDLDINLSE Q+Q++MEAYT+KD
Sbjct: 301 LVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKD 360

Query: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420
            FL+I GFRS + S+HYFNNIEKS+FIVPDE KYEGSIR L SLLK LRKKDK+AI+WGK
Sbjct: 361 AFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGK 420

Query: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480
           LKSNSHPSLFVLSPS+I+EYNEGFYLYR+PFLDEIRKFPSLLSYD G  HE++YDNMK++
Sbjct: 421 LKSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKV 480

Query: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540
           +QSI+GYFNLRDGYNPSDFKNP LQ+H+KVLHDYLLQ E   EENETS+ +++R++HEDD
Sbjct: 481 TQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587
           SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWN FY KFN D+ISV
Sbjct: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV 587

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/587 (79%), Positives = 528/587 (89%)

Query: 1   MQSPTHGFNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILE 60
           M+S T+ F + G  ND  ++  YRKFDIHEGILFCIELS +MFKES +L YKSPLLEILE
Sbjct: 1   MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSS 120
           SL+ELMSQLVITRPGT+IGCYFYYC R+DAKEGIYELFPLRDINA FMK LNDLLED+SS
Sbjct: 61  SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS 120

Query: 121 GRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQES 180
           GRI+L++YF FQ +  + Q+ L  LFTFMLDTFL++IPGQKQLS+K++FLFTD DKPQE+
Sbjct: 121 GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA 180

Query: 181 QDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEF 240
           QD DERARLRRLTIDLFDNKVNFATFFIGY +  FDNEFYSDILQLGSH N+   LDSEF
Sbjct: 181 QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF 240

Query: 241 DGPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYK 300
           DGP+TKPIDAKYIKS+ILRKKEVKRI FQCPLI DE TNFI+GVKGYTM++HEKAGVRYK
Sbjct: 241 DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKD 360
           LVYEHEDIRQEAYSKRKFLNP TG DVTG TVKVYPYGDLDINLS+ Q+Q++MEAYTQKD
Sbjct: 301 LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD 360

Query: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420
            FL+IIGFRS + SIHYFNNI+KS+FIVPDEAKYEGSIRTLASLLK LRKKDK+AI+WGK
Sbjct: 361 AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK 420

Query: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480
           LKSNSHPSL+ LSPSS+++YNEGFYLYR+PFLDEIRKFPSLLSYD G +H+L+YDNMK++
Sbjct: 421 LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV 480

Query: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540
           +QSIMGYFNLRDGYNPSDFKNP LQ+H+KVLHDYLLQIE   +ENET   + +R++ EDD
Sbjct: 481 TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587
           SLRKLY+IRNKILESEKSEDP IQRLNKYVKIWN FY KFNDDNIS+
Sbjct: 541 SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISI 587

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/574 (57%), Positives = 424/574 (73%), Gaps = 16/574 (2%)

Query: 22  SYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCY 81
           S++K+DIHEGI+FCIELS SMF+E PELNYK  LLEILESL+ELMSQLVI RP T IGCY
Sbjct: 13  SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCY 72

Query: 82  FYYCGRD--DAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHS---EK 136
           F+YC R   D+K GIYE FPLRD+NA+ MK ++DL+ED++  RITL EYFNF  +   + 
Sbjct: 73  FHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDS 132

Query: 137 QMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDL 196
           Q ++PL  LF F+LD F +      +  SKKIFLFTDND P E  D D   R+RR+  D+
Sbjct: 133 QKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDM 192

Query: 197 FDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNK---------GVDLDSEFDGPNTKP 247
            DN +NF TFFIG     F N FYS+IL+LGS  NK         G +  SE+DGPNT P
Sbjct: 193 NDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPNTTP 252

Query: 248 IDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHED 307
           I A YIKSKILRKKE+KR  FQCPLI  E+ NFI+ V+GY + + EK   RYKLVYEHE+
Sbjct: 253 IPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHEN 312

Query: 308 IRQEAYSKRKFLNPTTGADVT-GSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRII 366
           IR+EA S+RKFLNP TG ++      KV+PYGD DI L++K+   I + Y++ + FL++I
Sbjct: 313 IRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVI 372

Query: 367 GFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSH 426
           GFRS  +SI YFNNI+K+ F+VPDE++YEG+I+T+ASL + L+K+DK  IVWGK+KSNS+
Sbjct: 373 GFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSN 432

Query: 427 PSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMG 486
             L++LSP++  + NEGFYLYRIPFLDEIRKFP LL Y+     E +Y N+ RI+++I+G
Sbjct: 433 LRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-DYLNLVRITENIIG 491

Query: 487 YFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLY 546
           YFNL+ GY PSDFKNPSLQRH+K LHDYLLQ+E  + E+  S+ + +R + EDD+L K+ 
Sbjct: 492 YFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKIL 551

Query: 547 HIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKF 580
           HIR KI+ S++S+D   QRL+KYV +WNTFY K 
Sbjct: 552 HIREKIIASKESDDVTQQRLSKYVSLWNTFYIKM 585

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/580 (55%), Positives = 421/580 (72%), Gaps = 9/580 (1%)

Query: 8   FNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMS 67
            + + S  + T    YR++DIHEGI+FCIELS  MF E PELNYK  L+EILE+L++LMS
Sbjct: 1   MSDVPSNEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMS 60

Query: 68  QLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFE 127
           QLVITRP T IGCYF+ C R DAK+GIY   PL+D+NA+ MK L+DLLED+   R TL +
Sbjct: 61  QLVITRPSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ 120

Query: 128 YFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERA 187
           +  +  S+     PL  L   + + F++D+P QK  ++KKIF FTDND P E+ D D ++
Sbjct: 121 FLPYDASK---HTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKS 177

Query: 188 RLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKP 247
           RLR L  DL D  +NF TFFIG     FD  FYSDIL+LG+   K  D   EFDGPNT P
Sbjct: 178 RLRHLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGA-TTKASD---EFDGPNTTP 233

Query: 248 IDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHED 307
           I A YIKS++LRK+E+KRI FQCPLI +E + FI+GVKGYT+ SHEK GVRYKLVYE+ED
Sbjct: 234 ISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENED 293

Query: 308 IRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIG 367
           IRQEA+S+RK+LN  TG ++     KVYPYGDLDI LSE     I   Y  ++ FL++IG
Sbjct: 294 IRQEAFSRRKYLNAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIG 353

Query: 368 FRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHP 427
           F+S  + +HY+NNIEK+TF+VPDE +YEGSIRTL+SL K LR+K+KVAIVWGKLKSNS+P
Sbjct: 354 FQSTETCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNP 413

Query: 428 SLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGY 487
           ++F   PS     NEGFYLYR+PFLDE+R+ P +L    GE  + +Y+N+K  ++ ++ +
Sbjct: 414 AIFFFVPSDEASPNEGFYLYRVPFLDELRRIPPML-ISHGEIQDDDYENLKEATKKLINH 472

Query: 488 FNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYH 547
           FNL++G+ PS+FKNP LQ+HFK+LHDYLLQIE   E+++    R ++++ EDDSLR++  
Sbjct: 473 FNLKNGFEPSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQR-SKLLEEDDSLRRISQ 531

Query: 548 IRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587
           IR+KI ES  S+DP  Q+L+KY+ IWN+ Y+K  D   ++
Sbjct: 532 IRDKIDESANSKDPNKQKLSKYLAIWNSLYDKIFDQETAI 571

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/564 (54%), Positives = 419/564 (74%), Gaps = 16/564 (2%)

Query: 18  TEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTS 77
           T+  SYRK+++HEGI+FCIELSA MF+E  ELNYK  L+EILE+L +LMSQLVI RPGT 
Sbjct: 19  TQSKSYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVRPGTG 78

Query: 78  IGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQ 137
           IGCYFY C +DDAK  IYE FPLRDINAK MK L+DLL+D+++ RITL ++  +  SE+ 
Sbjct: 79  IGCYFYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLPYDESER- 137

Query: 138 MQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLF 197
              PL  L+ F+ D FL+++ GQK  ++KK+FLFTDND P E++D + ++RLR L  D+ 
Sbjct: 138 --TPLDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRHLVDDMD 195

Query: 198 DNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKI 257
           D+ +NF TFFIG     FD+ FYSD+L+LG+      D ++EFDGPNT PI A YIKS++
Sbjct: 196 DHFINFTTFFIGKEEAPFDDSFYSDVLKLGA---TAEDPNTEFDGPNTTPISASYIKSRV 252

Query: 258 LRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRK 317
           LRK+EVKRI FQC LI +E   F++G+KGYT+   E+ G RY+LVYE +++R+EA SKRK
Sbjct: 253 LRKQEVKRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRK 312

Query: 318 FLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHY 377
           FL+  TG  +     KV+PYGDLDI +++++   + ++YT+++ FL+IIGFR     IHY
Sbjct: 313 FLDSNTGEVIEEGLTKVFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHY 372

Query: 378 FNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSI 437
           FNNI+++ F+VPDE ++EGSIRTLASL K LR K KVA+VWGKLK+NSHP++FVLSPS  
Sbjct: 373 FNNIDRALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSRN 432

Query: 438 EEYNEGFYLYRIPFLDEIRKFPSLL----SYDSGEKHELEYDNMKRISQSIMGYFNLRDG 493
           E+ NEGFYLYRIPF +E+R+FP  L    SYD+      EY+ +K  ++SI+ +F    G
Sbjct: 433 EDPNEGFYLYRIPFAEELRRFPQSLIRHNSYDTP-----EYNQLKDTTKSIIDHFQFAKG 487

Query: 494 YNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKIL 553
           Y PS+F+NP LQ+HFK+LHDYLLQ+E   EE+++ E+   R++ EDDSL KL  IR+KI+
Sbjct: 488 YRPSEFRNPDLQKHFKILHDYLLQVEQE-EEDDSPESSKQRLLSEDDSLLKLAQIRDKIM 546

Query: 554 ESEKSEDPAIQRLNKYVKIWNTFY 577
           +S +S DP   +L++Y ++WN  Y
Sbjct: 547 DSAQSSDPKKFQLDEYFQLWNRLY 570

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/584 (55%), Positives = 429/584 (73%), Gaps = 22/584 (3%)

Query: 21  ASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGC 80
           ASY+K+DIHEGI+FCIELS  MF+E PELNY   LLEILESL ELMS LVI RP T +GC
Sbjct: 23  ASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTGVGC 82

Query: 81  YFYYCGRDD-------AK--EGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNF 131
           Y +YC + D       AK  +GIYELFPLRD+NA  MK L+DL ED+   RITL +YF F
Sbjct: 83  YIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQF 142

Query: 132 QHSEK-QMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLR 190
            + E  + Q+PL KLF F+LD F      +    S+KIFLFTDND P ES++ + + R+R
Sbjct: 143 DNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIR 202

Query: 191 RLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLD---------SEFD 241
           RL  D+ DN +NF TFFIG  +  FD+ FYSD+L+LG+   +  D D         SEFD
Sbjct: 203 RLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFD 262

Query: 242 GPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKL 301
           GPNTKPI AKYIKS+ILRKKE+KRI FQ PLI +ED  FIIG++GY ++SHEK   RYKL
Sbjct: 263 GPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKL 322

Query: 302 VYEHEDIRQEAYSKRKFLNPTTGADVTGST-VKVYPYGDLDINLSEKQNQVIMEAYTQKD 360
           VYE E++R+EA+S RK+LNP TG ++     VK++PYGD++I L++K+   + E  +  +
Sbjct: 323 VYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPE 382

Query: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420
            FL+IIGFRS    ++YFNNI  +TF+VPDE++YEGSIRT+ASL +TL+KKDKVAI+WGK
Sbjct: 383 AFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGK 442

Query: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480
           +K+NS P L++L P+S  + NEGFYLYR+PFL+EIRKFP LL Y     +  +Y N+ +I
Sbjct: 443 MKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNP-DYTNLIKI 501

Query: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540
           +  I+ YF+LR+GY PS+F+NPSLQR ++VLHDYLLQ+E ++ E +  + +I +++ EDD
Sbjct: 502 TSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGD-EQHQIQKLLEEDD 560

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDN 584
           +LRK+  IR+KIL S+KS+DP  QRL+KY+ +WNT+Y K  ++N
Sbjct: 561 TLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEEN 604

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/574 (51%), Positives = 417/574 (72%), Gaps = 11/574 (1%)

Query: 15  NDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRP 74
           N+  ++ASY+KF+ HE ++F +ELS  MF+  PELN K  L+EILESL ELMSQL++ RP
Sbjct: 9   NEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEELMSQLIVVRP 67

Query: 75  GTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHS 134
             +IGCYF+YCG++    GIYE FPL DINAK MK L+DLLED+   RI L ++F + ++
Sbjct: 68  NAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFFQYNNA 127

Query: 135 EKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTI 194
           +K     + KLFTF L+ F  ++ GQ++ + ++IFLFTDND P + +D + ++ LR++  
Sbjct: 128 KK---TSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVD 184

Query: 195 DLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIK 254
           DL ++ VNF  FFIG  +  F++  YS+IL+LG+ K    D  +E+DGPNT PI A YIK
Sbjct: 185 DLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARK----DSSTEYDGPNTTPIQASYIK 240

Query: 255 SKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYS 314
           SK+LRK+E+KR+AF+CPLI +E  NFI+G++GY   SHEK   RYKLVYE+E++RQEA+S
Sbjct: 241 SKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFS 300

Query: 315 KRKFLNPTTGADVTGSTV-KVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTS 373
           +RKFL+  T  ++ G  + K++  GDLDI + E++   + +A      FL+++GFRS  S
Sbjct: 301 RRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKS 360

Query: 374 SIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLS 433
            + Y NNI+K  F+VPDE +Y  SI+ L SL KTLR K K AI+WGKLK+NS+PSLFVL 
Sbjct: 361 CVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLE 420

Query: 434 PSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDG 493
           PS  ++ NEGFYL+R+PFLDEIRK P++++Y+ GE    +Y+N+ ++++ IM YFNL+ G
Sbjct: 421 PSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTS-DYENLIKVTEYIMAYFNLKGG 479

Query: 494 YNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKIL 553
           YNP D KNP +Q++FK+LHDYLLQIE +   +E+S  R  R++ EDD+LRK+ HIR KI+
Sbjct: 480 YNPMDLKNPCIQKYFKILHDYLLQIE-DKTSDESSTERKQRLLREDDTLRKVSHIREKII 538

Query: 554 ESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587
            S +SED   Q+L+KY+K+WN FY K   +++S+
Sbjct: 539 SSSRSEDAGAQKLSKYIKVWNNFYAKIEKESVSL 572

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/564 (49%), Positives = 402/564 (71%), Gaps = 11/564 (1%)

Query: 23  YRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCYF 82
           Y+KF++HEGI+FCIELS  MF++S ++N K  L+EILE+L ELMSQ++I+ PGT IGCYF
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 83  YYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMPL 142
           ++CG ++A  GIYEL PL D+NA+ MK LNDLL+D+++   TL + F     ++Q+  PL
Sbjct: 69  FHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPL---DEQLSTPL 125

Query: 143 GKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKVN 202
             +F  + + FL  +PGQK  ++KKIFLFTDND P+E+ D+D R RLR++  DL D  +N
Sbjct: 126 ETVFILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHIN 185

Query: 203 FATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRKKE 262
           F TFFIG     FD  FYSDIL+LG+ K       S F+GP+T PI+A  IK++ LRKKE
Sbjct: 186 FTTFFIGTEQKPFDQSFYSDILKLGAKKTASQG-GSTFNGPSTAPINANLIKARALRKKE 244

Query: 263 VKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPT 322
           +KRI FQC L  +E T+F + +KGYT+ SHE+ G +YK VY+H  +R+E  S RK+LN  
Sbjct: 245 IKRIRFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNAN 304

Query: 323 TGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNIE 382
           TG DVT S  +V+ + ++DI  SE++   I + Y+  D FL++IGFR  +  + +++NI 
Sbjct: 305 TGEDVTDSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNIG 364

Query: 383 KSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYNE 442
            S+F+VPDE+  EGSI+T++SL ++L KK K A+VWGKLKSNS+P++++LSPS+ ++ NE
Sbjct: 365 NSSFVVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNE 424

Query: 443 GFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFKNP 502
           GFYL R+PF+DE+RKFP +  YD  E     ++ M +I+++++ YF+LR  Y PSDFKNP
Sbjct: 425 GFYLTRVPFVDEVRKFPPIPRYDE-ELGGKNFEQMCKITETLISYFSLRRPYKPSDFKNP 483

Query: 503 SLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDPA 562
           +LQ+HFK+L+DYLLQ+EV     + S   ++  +  DD+L KLY +R KI ES  S+DP 
Sbjct: 484 TLQKHFKLLYDYLLQVEV-----DCSSESVDGALKHDDTLLKLYQVRRKIQESLSSKDPE 538

Query: 563 IQRLNKYVKIWNTFYNKFNDDNIS 586
            +RL  YVK WN+ YNK ++  ++
Sbjct: 539 EERLGTYVKAWNSLYNKISNQELT 562

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/573 (51%), Positives = 406/573 (70%), Gaps = 13/573 (2%)

Query: 21  ASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGC 80
           ASYRK++ HEG +FCIELS  MF E  +LNYK  L+E+LESL ELMSQLVITRP T +GC
Sbjct: 33  ASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGC 92

Query: 81  YFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQM 140
           +F+ C   ++K+ IYE  PLRDIN   MK L+DLL+DV   R+++ + F F     +   
Sbjct: 93  FFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGN- 151

Query: 141 PLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNK 200
            L  LF  + D F  +IPGQK  ++KK+FLFTDNDKP+ES D ++  RLRRL  D+ DN 
Sbjct: 152 SLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNY 211

Query: 201 VNFATFFIGYGNNS--FDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKIL 258
           + F TFFI   ++S  FD+ FYSDIL+L +  +       EFDGP+TKPI   YIK+K+L
Sbjct: 212 IQFVTFFINKIDSSDNFDDSFYSDILKLRNSNS------IEFDGPSTKPISVAYIKNKVL 265

Query: 259 RKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKF 318
           RKKE+KRI FQCPLI + D++F + VKGYT+ SHEK G RYKLVYEHE+IR+EA+SKRK 
Sbjct: 266 RKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKL 325

Query: 319 LNPTTGADVT-GSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHY 377
           LN  TG  VT   T K++  G+  IN  E + +   +    ++ FL++IGFRSP +S+H 
Sbjct: 326 LNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHL 385

Query: 378 FNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSS- 436
           FNNI K+ FIVPDE++  GSIRTL+S+ +T+R K++ AIVWGKLKSNS+P++++LSPS  
Sbjct: 386 FNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDP 445

Query: 437 IEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEK--HELEYDNMKRISQSIMGYFNLRDGY 494
            ++ NEGFYLY++PFLDEIRK PS  ++   ++     +Y+N+KR++++I+GYFNL +GY
Sbjct: 446 TKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGY 505

Query: 495 NPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILE 554
           +P +FKNP LQ+++K+LHDYLLQ+E   E   + E    +++ EDD++RK + IR+KI++
Sbjct: 506 SPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIK 565

Query: 555 SEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587
           S  S +   QRL+    IWN  Y+K   + I+V
Sbjct: 566 SASSTESHKQRLSANFNIWNDIYSKLEGNEIAV 598

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/557 (49%), Positives = 388/557 (69%), Gaps = 11/557 (1%)

Query: 23  YRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCYF 82
           Y+K+++H GI+FCIEL+++M+++  ELN+K  L+EILESL ELMSQL++T P T +GCYF
Sbjct: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78

Query: 83  YYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMPL 142
           + C +D+++ GIYE  PL+D+NAK MK LNDLLED+   R TL E F F  S   + + L
Sbjct: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPS---LDVSL 135

Query: 143 GKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKVN 202
             +  F+ + F++++P +K  ++ K+FLFTDN KP   ++ + R+ LR++  DL D  +N
Sbjct: 136 ESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYIN 195

Query: 203 FATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRKKE 262
           F  FFI      FD  FYSDIL+L + K   VD    FDGPNT PI A YIKS++ RKKE
Sbjct: 196 FTPFFIDTEEKPFDQSFYSDILKLRA-KTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKE 254

Query: 263 VKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPT 322
            +R+ FQCPLI D+  NF I +KGYT+ SHEK G RYKLVYE+E +R+EA+S R++L+ +
Sbjct: 255 TRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDAS 314

Query: 323 TGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNIE 382
           TG DV+    K++PYGD +I LS++    + +     + FL+IIGFRS    + Y+NN++
Sbjct: 315 TGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVD 374

Query: 383 KSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYNE 442
           K+ F+VPDE  YEGSIR +ASL + LR K K A+VWGKLK NS+P +++++PS+  + NE
Sbjct: 375 KTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNE 434

Query: 443 GFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFKNP 502
           GFYL RIPF+DEIR+FPS+  Y      + +Y +M + +++I+ YFNLR+GY PS+FKNP
Sbjct: 435 GFYLTRIPFIDEIRRFPSVPQYGDVLSSQ-DYGHMCQATETIIAYFNLRNGYKPSEFKNP 493

Query: 503 SLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDPA 562
            LQ +F +LHD LL      E  E S A   +   +DD+L KL  IR+KI+ES KS++P 
Sbjct: 494 GLQHYFSLLHDQLL------EAKEESSADEEQESLKDDTLLKLSQIRDKIIESSKSDEPG 547

Query: 563 IQRLNKYVKIWNTFYNK 579
            QRL+KY K WNT YNK
Sbjct: 548 RQRLSKYFKGWNTLYNK 564

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/560 (49%), Positives = 399/560 (71%), Gaps = 11/560 (1%)

Query: 20  DASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIG 79
           ++ Y+KF++HEGI+FC+ELS +MFKE  +LN K  LLEILE+L ELM+Q++I  PGT IG
Sbjct: 13  ESKYKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMTQVIIILPGTGIG 71

Query: 80  CYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQ 139
           C+F+ C  + AK GIYE  PL D+NA+ MK LNDLL+D+     TL E F F  ++KQ  
Sbjct: 72  CFFFQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPF--NDKQ-N 128

Query: 140 MPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDN 199
             L  +F  + + F + + GQK  ++KKIFLFTDND+P+ES D + + RLR++  DL D+
Sbjct: 129 TSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLDDS 188

Query: 200 KVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILR 259
            +N   FF+G     FD  FYSDIL+LG+ K K  D   +++GPNT PI AK IKS++LR
Sbjct: 189 FINIIPFFVGSEQRPFDQSFYSDILKLGA-KKKASDGPFKYEGPNTTPISAKLIKSRVLR 247

Query: 260 KKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFL 319
           KKE+KR+ FQC LI +E ++F + +KGYT  SHE+AG +YK VY+H+ +R+EA S RK+L
Sbjct: 248 KKEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHRKYL 307

Query: 320 NPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFN 379
           +  TG DVT   VKV+ + ++DI LSE +   +   Y+  D FL+++GFR     + YFN
Sbjct: 308 DANTGEDVTERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFN 367

Query: 380 NIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEE 439
           NI  S+F+VPD++ ++GSI+T+ASL + LR+K K A+VWGKLKSNS+PSL+ L+PS+  +
Sbjct: 368 NISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFND 427

Query: 440 YNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDF 499
           +NEGFYL R+PF+DEIRKFP   +Y         ++ M +I+++++ YF+LR  Y PSDF
Sbjct: 428 HNEGFYLTRVPFIDEIRKFPP-TAYHGNLSKTKTFEQMCKITETLISYFSLRHSYRPSDF 486

Query: 500 KNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSE 559
           +NP+LQ+HF++LHDYLLQ+EV    + TS ++   ++ +DD+L KL+ +R KILES +S+
Sbjct: 487 ENPTLQKHFELLHDYLLQVEV----DPTSGSK-EHLLKKDDTLLKLHQVRAKILESAESD 541

Query: 560 DPAIQRLNKYVKIWNTFYNK 579
           DP   RL+ YVK WN+ YN+
Sbjct: 542 DPVQARLSNYVKAWNSMYNR 561

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/572 (46%), Positives = 396/572 (69%), Gaps = 12/572 (2%)

Query: 16  DITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPG 75
           ++ + AS+++F+IHEGI+FCIELS  MF+   EL+ KS +  IL SL+ELM  L++TRP 
Sbjct: 24  EVNKQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPS 83

Query: 76  TSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSE 135
           T+IGCYFY C R+D+KE I+E  PL D+N ++MK +NDLLEDVS+ RIT  EY N+   +
Sbjct: 84  TAIGCYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNYNIDQ 143

Query: 136 -KQMQMP--LGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRL 192
            K++ +P  L KLF+ +L+TF ++I GQK+ +SKK+FLFTDND P           L+ +
Sbjct: 144 NKKLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSIDVLKGI 203

Query: 193 TIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSE-FDGPNTKPIDAK 251
             D+ DN +NF  FFI   +  F+  FYS +L+     N    L S+ + GP+TKPI   
Sbjct: 204 LKDIDDNMINFTNFFISKKDKPFNPAFYSKVLRNDRDYNS---LGSQAYFGPSTKPIGVN 260

Query: 252 YIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQE 311
            IK +I ++KE++R+ FQCPL+ DE TNF+I +KGY++ +HEK  VRYKLVYE+++IR+E
Sbjct: 261 DIKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIRKE 320

Query: 312 AYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSP 371
           A+SKRKF+NP TG DV+  TVK+ PYG+ +I + +K     +  Y      L +IGF + 
Sbjct: 321 AFSKRKFINPKTGEDVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGFLNE 380

Query: 372 TSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFV 431
            +S+ ++NNI+K+ FI PDE   EGS    ASL +TL+K  KV +VWG  KSNS PSL++
Sbjct: 381 DNSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPSLYL 440

Query: 432 LSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLR 491
           L PS  ++ N+GFYL ++PF+DEIRK+P+L + +  E+ E EY N+K ++Q I+ +FNL+
Sbjct: 441 LWPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWE-EYKNVKELTQGIISHFNLK 499

Query: 492 DGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNK 551
            GY+  +F+NP+L RH+K+LHDYLLQ+E+  ++N+  +    R + EDD+L K+  IR +
Sbjct: 500 SGYHAEEFRNPALNRHYKLLHDYLLQVEIPQDDNDIRD----RYLREDDTLLKITKIRER 555

Query: 552 ILESEKSEDPAIQRLNKYVKIWNTFYNKFNDD 583
           I++    +D   +RL+KY+++WN +Y KF +D
Sbjct: 556 IMKDTTIDDVEKRRLSKYLEVWNIYYRKFKED 587

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/561 (46%), Positives = 388/561 (69%), Gaps = 14/561 (2%)

Query: 23  YRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCYF 82
           +R+++ H+GI+FCI+L+ +M+  +P+L  K  LLEIL+SLN+LMSQLV+  P T++GCY 
Sbjct: 28  WRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAVGCYI 87

Query: 83  YYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMPL 142
           Y C   +A++ +YEL PLRD+N K MK ++DLLED+   RI L +          ++  L
Sbjct: 88  YNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIPIADPNNPIE--L 145

Query: 143 GKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKVN 202
             +   + +TFLQ I GQKQL++KKIF FTD+DKP E  + D R+RLR++  DL+D  +N
Sbjct: 146 SPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKVVDDLYDYYIN 205

Query: 203 FATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRKKE 262
           F TFFIG  +  FD+  Y+DIL+ GS  N+     S   GP+T PI+A YIKSK+ R KE
Sbjct: 206 FVTFFIGSEDKPFDDSMYADILKWGSKINEAQSWLSSH-GPSTNPINASYIKSKVKRTKE 264

Query: 263 VKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPT 322
           +KRI F+CPL+ DE  + ++ V GYT+ SHE  G +YKLVY +  +R+EAYS R++L+  
Sbjct: 265 IKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLDAE 324

Query: 323 TGADVTGSTV-KVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNI 381
           TG  V  S + KVY +GD  I L+E +N  I   Y++ + FL++IGFRS    +HY++NI
Sbjct: 325 TGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYDNI 384

Query: 382 EKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYN 441
           +   F+VP+E  Y GSI+TLASL +T+  K K A+VWGKL+ NS PS+FVL+PSS ++YN
Sbjct: 385 DVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSSKKDYN 444

Query: 442 EGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFKN 501
           +GFYLY++PF++E+RK P  L++ +  + + +Y  M +++++++ +FNL++GY PSDF N
Sbjct: 445 QGFYLYKVPFMEEVRKLPDFLNHSALIESD-DYKVMSKVTETLINFFNLKNGYRPSDFHN 503

Query: 502 PSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDP 561
           P+LQ+HFK+L +YLLQIEV+  + E            D++L+K+  I  +I  S KS+D 
Sbjct: 504 PALQKHFKILREYLLQIEVDKSKPED---------EGDETLQKVKQIYARIASSAKSDDV 554

Query: 562 AIQRLNKYVKIWNTFYNKFND 582
             QRL KY+K+WN+FYN+ ++
Sbjct: 555 KQQRLVKYLKLWNSFYNRLSN 575

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/613 (46%), Positives = 407/613 (66%), Gaps = 48/613 (7%)

Query: 15  NDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRP 74
           ND + +ASY+KF IHEGI+FC+ELS+ MF+  PEL  KS LLEILESL++L  QL+I+RP
Sbjct: 15  NDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRP 74

Query: 75  GTSIGCYFYYCGRDDAKE---GIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNF 131
            T+IG Y ++   D  ++   GIYE F L DIN K MK + DLLED+S  R  L + F F
Sbjct: 75  NTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKF 134

Query: 132 QHSEKQMQMPLGKLFTFMLDTFLQ--DIPGQKQLSSKKIFLFTDNDKPQESQDADERARL 189
            +S       L  +F  + + FL    +   K  + KK+FLFT+NDKP ES++ + R +L
Sbjct: 135 DNSRP---TKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKL 191

Query: 190 RRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQL---------------------GS 228
           RR+  DL ++++ F+TFFI   ++ FD+ FYSDIL+L                     G+
Sbjct: 192 RRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGN 251

Query: 229 H-----------KNKGVDLD-----SEFDGPNTKPIDAKYIKSKILRKKEVKRIAFQCPL 272
           H           K+K  D         F  PNTKPI+A  IK +ILRK+E++R+ FQCPL
Sbjct: 252 HYLLINDLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPL 311

Query: 273 IFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPTTGADVTGSTV 332
           I DE +NFIIG+ GY + S EK G RYKLVYEHE++R+EA+S+RKFL+P TG ++     
Sbjct: 312 ILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDF 371

Query: 333 -KVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNIEKSTFIVPDE 391
            KVY YGD++I LS++  Q I   Y +   F++++GFRS   S+ Y+NNI+K++F+VPDE
Sbjct: 372 QKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDE 431

Query: 392 AKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYNEGFYLYRIPF 451
           + YEGSI+T+ASL +TL KK KVAIVWG   S  HP++ +LSPS+  E+NEG YL+++PF
Sbjct: 432 SSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPF 491

Query: 452 LDEIRKFPSLLSYDSGEKHEL-EYDNMKRISQSIMGYFNLRDGYNPSDFKNPSLQRHFKV 510
           LDEIR+FP+L SY  G    + EY+ MK++++ I+G  +LR GY PS ++NP+LQ+++K+
Sbjct: 492 LDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKI 551

Query: 511 LHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDPAIQRLNKYV 570
           LHDYLLQIE +    +T +  + R ++EDD+L +L  +R +I++S ++ +   QRL+K++
Sbjct: 552 LHDYLLQIE-DTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFI 610

Query: 571 KIWNTFYNKFNDD 583
           + WN  + K N+D
Sbjct: 611 EHWNRVFKKINED 623

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/565 (47%), Positives = 385/565 (68%), Gaps = 18/565 (3%)

Query: 22  SYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCY 81
            Y+K+D HEGILFCIEL+ ++F+    L  +S LLEIL SL ELM QLVI RPG+S+GC 
Sbjct: 15  GYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVIVRPGSSVGCI 74

Query: 82  FYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMP 141
           F+Y   + A +G+YE  PLRD+NAK MK L+D LED+   RI +F+YF F  S+    + 
Sbjct: 75  FHYTDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFKFDGSK---HVS 131

Query: 142 LGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKV 201
           L +LF  + + + ++    K+ + K+ FLFTDND P ES D +   R+ ++  DL +  V
Sbjct: 132 LERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIVDDLDETAV 191

Query: 202 NFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRKK 261
           +F TFFIG     FDN FYS++L+LG+         S++DGP+ +PI    IK++ILR K
Sbjct: 192 SFTTFFIGSEEAPFDNRFYSNVLKLGAQLKH-----SDYDGPSVRPITGSDIKARILRGK 246

Query: 262 EVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNP 321
           E+KR  FQCPL  ++D+NFIIG++GY + +HEK G RYKL YE EDIRQEA+SKRK+LN 
Sbjct: 247 EIKRTMFQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSKRKYLNS 306

Query: 322 TTGADVTGSTV-KVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNN 380
            TG +V    + KV PYGD++I LS +  Q +  +Y ++  F++++GFRS    + YFNN
Sbjct: 307 KTGEEVDPKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDLCVKYFNN 366

Query: 381 IEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEY 440
           I+K +FIVPDE +YEGSI+TLASL +TLR K+K AI+WGK KSNS+ +L+++ PS  E+ 
Sbjct: 367 IDKPSFIVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVPSHREDR 426

Query: 441 NEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFK 500
           N+GFY++RIPFLDE+RK P  +     +  +L+ D +  ++++I+ YFNLR GY PS+FK
Sbjct: 427 NDGFYMHRIPFLDELRKVP--IKMVDNDWTQLDND-LLTVTETILKYFNLRQGYIPSEFK 483

Query: 501 NPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSED 560
           NP +Q ++KVLHDY+LQ+E    ++E  +     ++ +DD+L+K+ HIR KI  S  S+ 
Sbjct: 484 NPGIQNYYKVLHDYILQVEEI--KHEGWDFSQEELLRQDDTLKKISHIRGKIEASNDSD- 540

Query: 561 PAIQRLNKYVKIWNTFYNKFNDDNI 585
              + L+ Y+ +WN FY     +N+
Sbjct: 541 ---KVLSGYMNMWNLFYKSLETNNV 562

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  514 bits (1324), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 259/478 (54%), Positives = 349/478 (73%), Gaps = 5/478 (1%)

Query: 22  SYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCY 81
           SYRK+D+HEGI+FC+ELS  MF++ PELNYK  LLEILESL ELMSQLVITRPGT +GCY
Sbjct: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGTGVGCY 99

Query: 82  FYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMP 141
            Y C +D++   I+   PL D+N K MK +NDLL+D+S+ R TL +YF +   +K  + P
Sbjct: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPY---DKTQRTP 156

Query: 142 LGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKV 201
           L  L     D  ++++   K  ++KK+FLFTDND P E+ D   +ARLRRL  D  +N +
Sbjct: 157 LESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFI 216

Query: 202 NFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRKK 261
            F  FFI   N  FD+ FYSDI +LG+ +N   D + EFDGP+T+PI A YIKS++LRK+
Sbjct: 217 TFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQ 276

Query: 262 EVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNP 321
           E+KR+ FQC LI +++ NF + +KGY++ S EK G RYK+VYEHED+R+EA+SKRK LN 
Sbjct: 277 EIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNC 336

Query: 322 TTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNI 381
            T  +V     KV+PYGDL+I LSE+  + + EAY +   FL+++GFRS   S+HY+NNI
Sbjct: 337 ITAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNI 396

Query: 382 EKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYN 441
            K +F+VPDE+K +GSIR LASL +T+RKK+KVA++WGKLK NSHP L+VLS S+  + N
Sbjct: 397 TKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPN 456

Query: 442 EGFYLYRIPFLDEIRKFPSLL--SYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPS 497
           EGF+LYRIPFLDEIRKFP +   S+     + +EY+N+KR +++I+GYFNL+ GY PS
Sbjct: 457 EGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  401 bits (1031), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 228/570 (40%), Positives = 343/570 (60%), Gaps = 25/570 (4%)

Query: 11  IGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLV 70
           + S  D  +D  + ++++HEGI+FC+ELS +M+K SPEL  K  LLEILE+L ELM QLV
Sbjct: 13  LDSTADKEDDKRHLRYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLV 72

Query: 71  ITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFN 130
              P T +GCYF+ C   +AK+GIYELFPLRD+N   MK +  LLE + +G+ +L E   
Sbjct: 73  AVMPDTGVGCYFFQCRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELP 132

Query: 131 FQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLR 190
           +   + +    L  +FT + D FLQ++P Q+  ++KKIFLFTDND P E +    R RLR
Sbjct: 133 Y---DGRHPTSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLR 189

Query: 191 RLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDA 250
           ++  DL D  +NF+TFFIG     FD  FYSDIL+LG+           +DGP+TKPI  
Sbjct: 190 KVVDDLNDYYINFSTFFIGTEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISV 249

Query: 251 KYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQ 310
            YI+S++LRKKEV+R+ + CPL  +E+   ++ VKGY   ++E+ G RY++VY+HED+++
Sbjct: 250 SYIRSRVLRKKEVRRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQR 309

Query: 311 EAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIME-AYTQKDGFLRIIGFR 369
           EA+S R++L+P TG + T    KVY  GD  ++L +    +I   A    D FLR++G R
Sbjct: 310 EAFSHRRYLDPDTGEEATEDLCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGSR 369

Query: 370 SPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSL 429
           +  + + Y+NNI   TF+VPD++ Y GS   LASL +TLR   +  +++GKL++ S P+L
Sbjct: 370 TAVAVLPYYNNIHHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPAL 429

Query: 430 FVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFN 489
           + L+P++    +  F L R+PF +E+RKFP+ LS         +Y  +++I+  I+    
Sbjct: 430 YALAPAAAPLPDAVFILARLPFQEEVRKFPA-LSPPQASLASPDYAVLQKITSRIIDLLV 488

Query: 490 LRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIR 549
           L   Y P+DFKNP +  HF++L D+L +   +   ++T                    I 
Sbjct: 489 LSSPYAPADFKNPVIATHFRLLSDHLFETAQDPRTDDT--------------------IA 528

Query: 550 NKILESEKSEDPAIQRLNKYVKIWNTFYNK 579
             +    +  D    RL KY++ WN FY +
Sbjct: 529 RLLRLRHRVLDDPESRLAKYLRHWNAFYAR 558

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  353 bits (905), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/565 (35%), Positives = 327/565 (57%), Gaps = 19/565 (3%)

Query: 25  KFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCYFYY 84
           K +  + I+ CIELS+ ++ +S E++ K+ L E+LE+L ELM QL +  P + + CY Y 
Sbjct: 17  KHERRQSIIVCIELSSRVY-QSSEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQ 75

Query: 85  CGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMPLGK 144
           C R + K+GIYEL PL  +N + +  ++ LL D+ + ++ L +   F+  +     PL  
Sbjct: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGS---PLSS 132

Query: 145 LFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKVNFA 204
           +   +          + +  +K+I L T ND P E  DA+ + + +     L+D+  +  
Sbjct: 133 VLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIV 192

Query: 205 TFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSE---FDGPNTKPIDAKYIKSKILRKK 261
           TFFI      F++ FY+D+L+      +  DLD     +DGPNTKPI+ K +K K+L+KK
Sbjct: 193 TFFIHSQTRPFNDTFYADLLK---PLRRPEDLDKNIQYYDGPNTKPIEIKELKGKLLQKK 249

Query: 262 EVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNP 321
           E  +  F+C  I ++  +FII +KG+   + EKAG R+K +Y+     Q+A+S RKF N 
Sbjct: 250 EGNKFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNA 309

Query: 322 TTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNI 381
             G        KV+  G L+I  +E+Q+Q ++ ++++ + FL +IGFRS      Y+NNI
Sbjct: 310 NDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNI 369

Query: 382 EKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYN 441
             S++++PD+  YEGS +TL+ L  ++ KK K AIVWGKL   +HP LF++     +  N
Sbjct: 370 STSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTN 429

Query: 442 EGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFKN 501
           +GFYL R+PF++EIR+FP  L  +     + EY  MK+I+ +I+ +FNL+  Y  ++F +
Sbjct: 430 QGFYLVRLPFIEEIRRFPQTLQKNRSVNIQ-EYALMKKITGNIIAFFNLKSSYRAAEFPS 488

Query: 502 PSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDP 561
           P L+  +  L D LLQ  +      + +  +   +  D +L K+ H+R  I +S ++ + 
Sbjct: 489 PVLKSFYTTLSDKLLQKSL------SDQWGMGFKLSNDITLGKVQHLRELINKSSQNMEQ 542

Query: 562 AIQRLNKYVKIWNTFYNKFNDDNIS 586
            I  L KY+K WNT+YNK  +++I+
Sbjct: 543 PI--LAKYMKYWNTYYNKEGNNSIT 565

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  272 bits (695), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/585 (28%), Positives = 313/585 (53%), Gaps = 44/585 (7%)

Query: 10  SIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQL 69
           S G      +  ++   D ++ I+ CIELS ++   +  L   +P+LE++ +L  ++ +L
Sbjct: 8   SGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEEL 67

Query: 70  VITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYF 129
           +I +P +++GC  +  GR  A++GI E FPLR ++A +++ ++D + D+    + + ++F
Sbjct: 68  IIVQPNSAVGCLTFRNGRR-AEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHF 125

Query: 130 NFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARL 189
            F  +   +   L  +       F +D     Q +  +IFL TD D P E  D     ++
Sbjct: 126 PFTAT---VPASLDVMLAASDRYFTEDT----QNADNRIFLVTDVDTPVEFTDPIRLEKV 178

Query: 190 RRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPID 249
           +   + L+  +++  TFF+   + +F++  Y++IL+       G          +T P+ 
Sbjct: 179 QARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKTREWGIPGAP-------QSTSPLS 231

Query: 250 AKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIR 309
              ++ K+L +K++ R  F CPL+ ++  + ++ V GY   +HE+ G RYK + +H+   
Sbjct: 232 ICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRT 291

Query: 310 QEAYSKRKFL---NPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRII 366
           +  +  RK+    N     D   S+V  Y  G   I +++ + + +    ++ + FL I+
Sbjct: 292 KSVHQCRKYKTVDNEKYIRDADRSSV--YWIGGAGIEVTDAELRKMTRGCSKYESFLEIL 349

Query: 367 GFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSH 426
           GFR+  ++  Y++NI ++ +I+P E  + GS + LASL +++ +K K AIVWG+LK+  H
Sbjct: 350 GFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFH 409

Query: 427 PSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEK---HELEYDNMKRISQS 483
           P+LF L PS  E       L RIPF++E+R FP+L     GE    H  EY+ +K +SQ+
Sbjct: 410 PTLFALIPSDGETC--ALRLVRIPFIEEVRCFPTL----DGEDRLFHTREYELVKTVSQN 463

Query: 484 IMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIH---EDD 540
           ++ +F+LR  Y PSD +NP L+  +  L+          E+++ ++ ++  + +    D 
Sbjct: 464 LIRHFSLRTSYRPSDIRNPLLRNFYSTLYH---------EQSQDAKRKMPELQYLPESDS 514

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNI 585
           +L K+  +R++I  S   ++P I  +++Y+  WN +YN   D  +
Sbjct: 515 TLHKVQLVRDRIENSIIHDEPPI--ISEYINCWNIYYNHIIDKAV 557

>NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {ON}
           Anc_2.444 YMR106C
          Length = 625

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 85/214 (39%), Gaps = 31/214 (14%)

Query: 284 VKGYTMHSHEKAGVRYKLVYEHEDIR-----QEAYSKRKFLNPTTGADVTGSTVKVYPYG 338
           +K  T  +H    +  K V E+E I      Q+A  K      T   D   S  K Y YG
Sbjct: 262 IKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDKNDARPVTVSRD---SITKAYRYG 318

Query: 339 -DLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNIEKSTFIVPDE--AKYE 395
            D  +  S  Q+Q++ E +   D    I GF        Y+ N E STFI+ D       
Sbjct: 319 ADYVVLPSTLQSQLVYETFPGLD----IRGFMDMELLPRYYLNSE-STFIIADTRLGGLA 373

Query: 396 GSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYNEGF----------- 444
            S+ T   L+  L    KVA+     K+NS   + VL P  +  +++ F           
Sbjct: 374 DSV-TFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQSFSGEGEENFVRT 432

Query: 445 -YLYRIPFLDE--IRKFPSLLSYDSGEKHELEYD 475
             L R+PF ++  +  FP L +  S     L  D
Sbjct: 433 LVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPED 466

>YMR094W Chr13 (455825..457261) [1437 bp, 478 aa] {ON}  CTF13Subunit
           of the CBF3 complex, which binds to the CDE III element
           of centromeres, bending the DNA upon binding, and may be
           involved in sister chromatid cohesion during mitosis
          Length = 478

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 15/111 (13%)

Query: 474 YDNMKRISQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARIN 533
           +DN++++  S + Y +L     P +FK+ +++R  K+          NIEEN   E +++
Sbjct: 331 WDNLQKLVLSRVAYIDLNSIVFPKNFKSLTMKRVSKIKW-------WNIEENILKELKVD 383

Query: 534 R------VIHEDDS-LRKLYHIRN-KILESEKSEDPAIQRLNKYVKIWNTF 576
           +       I EDDS   K +++R+ +I E +KSE   I  L     +W +F
Sbjct: 384 KRTFKSLYIKEDDSKFTKFFNLRHTRIKELDKSEINQITYLRCQAIVWLSF 434

>TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa]
           {ON} Anc_2.444 YMR106C
          Length = 681

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 76/179 (42%), Gaps = 36/179 (20%)

Query: 363 LRIIGFRSPTS-SIHYFNNIEKSTFIVPD-EAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420
           L I GF    S   HY   I +STFIV D  A     + +   L+  L +  K+AI    
Sbjct: 376 LDITGFMDEESLPRHYL--ISESTFIVADSRAGSTADMMSFEILVDVLYENKKIAIARYV 433

Query: 421 LKSNSHPSLFVLSPSSI----------------------EEYN-EGFYLYRIPFLDE--I 455
            K+N++  + +L P  +                      EE N  G  L R+PF ++  +
Sbjct: 434 QKNNTNAQMVMLCPVLVDHSDILSEQDIQKYRSIHDDDNEEVNMRGLILSRLPFAEDERV 493

Query: 456 RKFPSLLS-YDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHD 513
            +FP L + +   EK +LE + +     S+MG  N  DG +       S  ++FK + +
Sbjct: 494 SEFPKLSNRHMKNEKSKLEAEEI----DSLMG--NFIDGLDMDGLPAVSDNKYFKSIKE 546

>YMR106C Chr13 complement(478301..480190) [1890 bp, 629 aa] {ON}
           YKU80Subunit of the telomeric Ku complex
           (Yku70p-Yku80p), involved in telomere length
           maintenance, structure and telomere position effect;
           relocates to sites of double-strand cleavage to promote
           nonhomologous end joining during DSB repair
          Length = 629

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 107/480 (22%), Positives = 177/480 (36%), Gaps = 79/480 (16%)

Query: 30  EGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCYFYYCGRDD 89
           E   F +++S SM K     N  S  +  LE    L+++   +R    I CY   C   +
Sbjct: 4   ESTTFIVDVSPSMMKN----NNVSKSMAYLEYT--LLNKSKKSRKTDWISCYLANCPVSE 57

Query: 90  AKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMPLGKLFTFM 149
             + I  +F       +    L  +    + G I   + +  QHS       L  +   +
Sbjct: 58  NSQEIPNVF-------QIQSFLAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCL 110

Query: 150 LDTFLQDIPGQKQLSS--KKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKVNFATFF 207
           L   L DI  Q Q     K+I +FTDN    +  D +         IDL   +++     
Sbjct: 111 LVVSL-DIKQQFQARKILKQIVVFTDNLDDLDITDEE---------IDLLTEELSTRIIL 160

Query: 208 IGYGNNSFDNEFYSDILQL-----GSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILR-KK 261
           I  G ++ +    S+ L+L      S      +L  E   P T  +    + S  LR   
Sbjct: 161 IDCGKDTQEERKKSNWLKLVEAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGA 220

Query: 262 EVKRIAFQCPLIFDEDTN-FIIGVKGYTMHSHEKAGVRYKLVYEHED------------- 307
           ++       P    +D N   I V+ +   +   +G+  K   E ED             
Sbjct: 221 DILSTQTSNPSGSMQDENCLCIKVEAFPA-TKAVSGLNRKTAVEVEDSQKKERYVGVKSI 279

Query: 308 -------------IRQEAYSKRKFLNPTTGADVTGSTVKVYPYG-DLDINLSEKQNQVIM 353
                        + ++  S   ++  T   D   S  K Y YG D  +  S   +Q + 
Sbjct: 280 IEYEIHNEGNKKNVSEDDQSGSSYIPVTISKD---SVTKAYRYGADYVVLPSVLVDQTVY 336

Query: 354 EAYTQKDGFLRIIGFRSPTSSIHYFNNIEKSTFIVPD-EAKYEGSIRTLASLLKTLRKKD 412
           E++   D  LR  GF +  +   YF   E S+FI  D     +  +   ++L+  + +  
Sbjct: 337 ESFPGLD--LR--GFLNREALPRYFLTSE-SSFITADTRLGCQSDLMAFSALVDVMLENR 391

Query: 413 KVAIVWGKLKSNSHPSLFVLSPSSIEEYN--------EGFYLYRIPFLDEIR--KFPSLL 462
           K+A+     K +S  ++  L P  IE  N        +   L R+PF ++ R   FP LL
Sbjct: 392 KIAVARYVSKKDSEVNMCALCPVLIEHSNINSEKKFVKSLTLCRLPFAEDERVTDFPKLL 451

>ZYRO0B05742g Chr2 complement(452478..456092) [3615 bp, 1204 aa]
           {ON} weakly similar to uniprot|Q08236 Saccharomyces
           cerevisiae YOL078W AVO1 Component of a membrane-bound
           complex containing the Tor2p kinase and other proteins
           which may have a role in regulation of cell growth
          Length = 1204

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 102/247 (41%), Gaps = 34/247 (13%)

Query: 184 DERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGP 243
           +E++   +  +D+ DNK    T  +    NSF+   Y D   L S   K + LDS+F G 
Sbjct: 455 NEKSLSSKNELDITDNKDVVTTDSLPEDENSFN---YPDNSDLVSSYGKSL-LDSDFSGD 510

Query: 244 NT-KPIDAKYIKSKILRKKEVK--RIAFQCPLIFDE------------DTNF---IIGVK 285
           N  KP+D+    + IL   +++   ++   PL  DE            DT F   ++ +K
Sbjct: 511 NVFKPVDSATESNSILEDSDLQPETVSHSIPLSLDEYGIYHGQDDTTLDTAFDKAVLNIK 570

Query: 286 GYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLS 345
           G      + + ++ K  Y   + R  + S+    +   G D T S +     GD +  L 
Sbjct: 571 GL-----KPSNLKEKRQYGRPNSRSTSISRHSNSSNAKGKDTTNSFMGA--SGDSNKVLK 623

Query: 346 EKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLL 405
              ++  M A        +     +P SS +   N  K+ ++  ++    G  +   S L
Sbjct: 624 HVDSRAQMHASVDS----KAEKSATPASSAYNNKNPAKNDWLSVEKTTNFGKPKNHNSQL 679

Query: 406 KTL-RKK 411
            +L RKK
Sbjct: 680 SSLFRKK 686

>Ecym_5421 Chr5 (866187..868424) [2238 bp, 745 aa] {ON} similar to
           Ashbya gossypii AFL222W
          Length = 745

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 59/143 (41%), Gaps = 28/143 (19%)

Query: 114 LLEDVSSGRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTD 173
           L+E +S GRIT+ ++    ++ K  Q PL K++  + +T ++D  G+    ++   L  +
Sbjct: 216 LIERLSQGRITISQFLLKANTTKTFQTPLIKVYEHLKETHIKDAEGKLVCMAEVHQLLMN 275

Query: 174 NDK---------------PQESQDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNE 218
           N                 PQ S+ A E+   ++L    F +  N  T             
Sbjct: 276 NPGLLVGCAPGFVDRFIVPQLSEIAKEQIASQQLQKSGFHDPSNLITLV----------- 324

Query: 219 FYSDILQLGSHKNKGVDLDSEFD 241
             +  L+L   ++  + L S FD
Sbjct: 325 --ATALELSCSEHPNIQLTSTFD 345

>TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.444
           YMR106C
          Length = 626

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 8/108 (7%)

Query: 363 LRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGS-IRTLASLLKTLRKKDKVAIVWGKL 421
           + I GF + TS   YF N E S FI  D      S + ++ +L+  L +  K+AIV    
Sbjct: 351 IDIRGFMNETSLPRYFLNSE-SKFIFFDSRNGSKSDVYSMYALVDVLMENKKIAIVRYVQ 409

Query: 422 KSNSHPSLFVLSP--SSIEEYN--EGFYLYRIPFLDE--IRKFPSLLS 463
           K N    +  L P  S I + N    F L R+PF ++  +  FP L++
Sbjct: 410 KHNGEVEMCALYPMVSKISDRNIVRYFVLNRLPFAEDERVSDFPKLVN 457

>TPHA0M00970 Chr13 complement(186308..189322) [3015 bp, 1004 aa]
           {ON} Anc_3.257 YDR027C
          Length = 1004

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 16/100 (16%)

Query: 479 RISQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHE 538
           ++  SI G   + DG    D     +Q+  + L + + Q   NIE+ E    ++  ++ E
Sbjct: 311 KVKNSIQGLDKISDGL--IDIDKNKIQKEIEKLQNMIKQ--KNIEKLEQGLLQVKAILVE 366

Query: 539 DDSLRKLYH------------IRNKILESEKSEDPAIQRL 566
            D+ +KL+               NK+++ +KS+DP +Q++
Sbjct: 367 SDNCKKLFQEEKFDECMTLINTVNKLVKGDKSDDPIVQKI 406

>Smik_13.278 Chr13 (439652..441157) [1506 bp, 501 aa] {ON} YMR094W
           (REAL)
          Length = 501

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 474 YDNMKRISQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARIN 533
           +DN++ +  S + Y +L +   P +FK+ +++R  K+          NIEEN   E +++
Sbjct: 353 WDNLQTLVLSRIAYIDLNNIVLPKNFKSLTMKRISKIKW-------WNIEENILKELKLD 405

Query: 534 R------VIHEDDS-LRKLYHIR-NKILESEKSEDPAIQRLNKYVKIWNTF 576
           R       I ED S   K  ++R  ++ E +KSE   I        +W +F
Sbjct: 406 RKTFKTLYIREDSSRFTKFLNLRQTEVKELDKSEINQITYFRCQALVWLSF 456

>CAGL0A00803g Chr1 complement(81425..84913) [3489 bp, 1162 aa] {ON}
           similar to uniprot|P34111 Saccharomyces cerevisiae
           YAL001c TFC3
          Length = 1162

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 87/209 (41%), Gaps = 29/209 (13%)

Query: 324 GADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHY----FN 379
           G  VT S  ++     + I+  EK  QV+   Y++KD  +    F+      H      N
Sbjct: 68  GNSVTKSVTEIDSACVVSIS-EEKLWQVLTGGYSKKDSSIGNSAFQLLVEIAHARGQGIN 126

Query: 380 NIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEE 439
            +E +     D     G ++ L +L+K+++      I  G +  N     F+   +  EE
Sbjct: 127 TMELAQITKQDPRSITGRLKKLDNLIKSVQ-----VIHNGHVVKNLRLRKFITDIN--EE 179

Query: 440 YNEGFYL----YRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRD--G 493
            NE  Y+    +    +D ++   + +   S  K +L++D  KR+S++ +      D  G
Sbjct: 180 ENEEVYISMRDHLAEIVDVVKNSKNCIRQVSDLKRQLQFDKTKRLSRAFISAIAWLDENG 239

Query: 494 Y-------NPSDFKNPSLQ-RHFKVLHDY 514
           Y       +P    NP ++ R  K L DY
Sbjct: 240 YLRKVIVVSPV---NPDVKIRCVKFLKDY 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,766,563
Number of extensions: 3419355
Number of successful extensions: 11196
Number of sequences better than 10.0: 59
Number of HSP's gapped: 11511
Number of HSP's successfully gapped: 59
Length of query: 602
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 487
Effective length of database: 40,294,809
Effective search space: 19623571983
Effective search space used: 19623571983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)